F471267

General Info

Members Datasets Scaffolds Average Seq Length
635 441 443 193

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10071723|Ga0265760_100717231
Length 219
Sequence MPAGDGRNGAKGPTLAASTYEWSTPLRVFILYANPVAASFGATLCKQVVTTLRSRGHEIDDCDLYAESFNPVMAEQERMRYHNANLNRAPIAAYADRLLAAEALVLIYPVWNEGFPAILKGFFDRVFIPGVSFKIGPDGAAIPNLQKLRKLGAVCTYGASRTTSFLLGDPPKRVVKRLVRSMPGHAVRCDYLAYYDMDHSNPEQRAAFLEKVKRTFEAW

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
9 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
12 2519899620 Rhizobium sp. Pop5 Isolate Nodule
13 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
14 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
15 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
16 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
17 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
18 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
19 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
20 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
21 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
22 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
23 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
24 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
25 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
26 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
27 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
28 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
29 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
30 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
31 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
32 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
33 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
34 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
35 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
36 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
37 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
38 2643221629 Devosia sp. Root105 Isolate Unclassified
39 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
40 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
41 2718217882 Rhizobium sp. N741 Isolate Nodule
42 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
43 2718218009 Rhizobium sp. N561 Isolate Nodule
44 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
45 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
46 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
47 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
48 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
49 2718218363 Rhizobium sp. N113 Isolate Nodule
50 2718218365 Rhizobium sp. N731 Isolate Nodule
51 2718218366 Rhizobium sp. N621 Isolate Nodule
52 2721755514 Rhizobium sp. N6212 Isolate Nodule
53 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
54 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
55 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
56 2721755810 Rhizobium sp. N871 Isolate Nodule
57 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
58 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
59 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
60 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
61 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
62 2728369365 Rhizobium sp. N1341 Isolate Nodule
63 2728369397 Rhizobium sp. N1314 Isolate Nodule
64 2738541293 Rhizobium sp. GV031 Isolate Unclassified
65 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
66 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
67 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
68 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
69 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
70 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
71 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
72 2791355260 Rhizobium sp. L9 Isolate Nodule
73 2791355261 Rhizobium sp. J15 Isolate Nodule
74 2791355262 Rhizobium sp. M1 Isolate Nodule
75 2791355263 Rhizobium chutanense C5 Isolate Nodule
76 2791355264 Rhizobium sp. S9 Isolate Nodule
77 2791355265 Rhizobium sp. H4 Isolate Nodule
78 2791355267 Rhizobium sp. L18 Isolate Nodule
79 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
80 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
81 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
82 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
83 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
84 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
85 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
86 2838048938 Rhizobium pisi 27/80 Isolate Nodule
87 2838061910 Rhizobium phaseoli L15 Isolate Nodule
88 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
89 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
90 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
91 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
92 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
93 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
94 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
95 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
96 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
97 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
98 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
99 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
100 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
101 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
102 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
103 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
104 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
105 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
106 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
107 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
108 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
109 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
110 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
111 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
112 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
113 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
114 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
115 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
116 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
117 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
118 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
119 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
120 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
121 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
122 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
123 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
124 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
125 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
126 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
127 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
128 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
129 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
130 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
131 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
132 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
133 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
134 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
135 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
136 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
137 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
138 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
139 2933599457 Rhizobium phaseoli M3 Isolate Nodule
140 2936381700 Rhizobium chutanense C16 Isolate Unclassified
141 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
142 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
143 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
144 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
145 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
146 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
147 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
148 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
149 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
150 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
151 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
152 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
153 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
154 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
155 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
156 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
157 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
158 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
159 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
160 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
161 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
162 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
163 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
164 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
165 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
166 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
167 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
168 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
169 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
170 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
171 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
172 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
173 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
174 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
175 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
176 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
177 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
178 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
179 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
180 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
181 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
182 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
183 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
184 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
185 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
186 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
187 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
188 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
189 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
190 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
191 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
192 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
193 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
194 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
195 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
196 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
197 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
198 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
199 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
200 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
201 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
202 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
203 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
204 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
205 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
206 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
207 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
208 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
209 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
210 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
211 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
212 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
213 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
214 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
215 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
216 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
217 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
218 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
219 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
220 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
221 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
222 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
223 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
224 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
225 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
226 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
227 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
228 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
229 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
230 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
231 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
232 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
233 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
234 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
235 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
236 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
237 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
238 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
239 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
240 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
241 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
242 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
245 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
246 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
247 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
248 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
249 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
251 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
252 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
253 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
255 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
256 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
258 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
260 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
263 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
299 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
300 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
302 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
303 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
304 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
305 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
307 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
310 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
311 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
312 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
313 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
314 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
315 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
316 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
317 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
320 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
321 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
322 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
323 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
324 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
325 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
326 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
327 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
328 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
329 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
330 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
331 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
332 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
333 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
334 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
335 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
336 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
337 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
340 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
343 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
344 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
345 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
346 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
347 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
348 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
351 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
352 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
353 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
354 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
355 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
356 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
363 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
364 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
365 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
366 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
369 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
374 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
394 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
395 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
396 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
397 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
398 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
399 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
400 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
401 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
402 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
403 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
404 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
405 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
406 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
407 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
408 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
409 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
410 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
411 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
412 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
413 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
414 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
415 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
416 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
417 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
418 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
419 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
420 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
421 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
422 8005382845 Rhizobium sp. R634 Isolate Nodule
423 8005395548 Rhizobium sp. R339 Isolate Nodule
424 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
425 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
426 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
427 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
428 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
429 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
430 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
431 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
432 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
433 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
434 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
435 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
436 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
437 8024501048 Rhizobium sp. H4 Isolate Nodule
438 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
439 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
440 8056382006 Rhizobium croatiense 13T Isolate Nodule
441 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.61
Metatranscriptomes 0.16
Isolates 30.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.36
Nodule 21.1
Rhizoplane 0.79
Rhizosphere 37.95
Stem 0
Stem Tuber 0
Unclassified 17.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000007 3300001979 Bacteria 82531
2 JGI24740J21852_10021589 3300001979 Bacteria 2230
3 JGI25155J39150_1000034 3300002704 Bacteria 105264
4 JGI25156J39149_1000008 3300002705 Bacteria 229035
5 JGI25162J39368_1003125 3300002737 Bacteria 5238
6 JGI25154J39366_1000063 3300002738 Bacteria 104538
7 JGI25158J39367_1000047 3300002739 Bacteria 27752
8 JGI25157J39369_1000062 3300002741 Bacteria 104644
9 JGI25152J39213_1000001 3300002773 Bacteria 224104
10 JGI25152J39213_1000015 3300002773 Bacteria 120605
11 JGI25152J39213_1002654 3300002773 Bacteria 6622
12 JGI25152J39213_1012305 3300002773 Bacteria 1845
13 JGI25152J39213_1012308 3300002773 Bacteria 1845
14 JGI25150J39212_1000007 3300002774 Bacteria 253635
15 JGI25150J39212_1008612 3300002774 Bacteria 1986
16 JGI25159J45721_1002722 3300002987 Bacteria 6562
17 JGI25159J45721_1003122 3300002987 Bacteria 5967
18 JGI25151J46595_10000013 3300003187 Bacteria 253635
19 JGI25151J46595_10000278 3300003187 Bacteria 58449
20 JGI25151J46595_10000462 3300003187 Bacteria 39029
21 JGI25151J46595_10009010 3300003187 Bacteria 4757
22 JGI25151J46595_10056250 3300003187 Bacteria 1291
23 JGI25165J46597_1000169 3300003214 Bacteria 103007
24 JGI25165J46597_1000199 3300003214 Bacteria 88628
25 JGI25165J46597_1000704 3300003214 Bacteria 26410
26 JGI25165J46597_1006800 3300003214 Bacteria 1982
27 JGI25153J46596_10000477 3300003215 Bacteria 25650
28 JGI25153J46596_10004847 3300003215 Bacteria 7169
29 JGI25153J46596_10013107 3300003215 Bacteria 3526
30 JGI25153J46596_10030256 3300003215 Bacteria 1845
31 JGI25153J46596_10030261 3300003215 Bacteria 1845
32 rootH1_10067043 3300003316 Bacteria 1875
33 rootH1_10110946 3300003316 Bacteria 1381
34 rootH2_10005365 3300003320 Bacteria 3965
35 rootH2_10090743 3300003320 Bacteria 1676
36 rootH2_10182880 3300003320 Bacteria 2218
37 rootL2_10087163 3300003322 Bacteria 1336
38 rootL2_10190541 3300003322 Bacteria 5234
39 rootH1_10021850 3300003323 Bacteria 1226
40 JGI25160J50197_1000001 3300003354 Bacteria 782301
41 JGI25161J50226_1000047 3300003374 Bacteria 113472
42 JGI25161J50226_1000780 3300003374 Bacteria 12090
43 Ga0055539_1013619 3300003752 Bacteria 995
44 Ga0055526_1000377 3300003771 Bacteria 36137
45 Ga0055526_1017075 3300003771 Bacteria 2798
46 Ga0055524_1001654 3300003775 Bacteria 12427
47 Ga0055524_1011616 3300003775 Bacteria 3431
48 Ga0055524_1015582 3300003775 Bacteria 2764
49 Ga0055528_1000106 3300003790 Bacteria 67208
50 Ga0055528_1002441 3300003790 Bacteria 9951
51 Ga0055528_1028496 3300003790 Bacteria 1539
52 Ga0055540_1000103 3300003792 Bacteria 94710
53 Ga0055540_1011551 3300003792 Bacteria 2838
54 Ga0055531_10029987 3300003794 Bacteria 1838
55 Ga0058692_1010728 3300003856 Bacteria 2252
56 Ga0055543_1000007 3300004625 Bacteria 204042
57 Ga0055543_1000961 3300004625 Bacteria 13132
58 Ga0065165_1000357 3300005262 Bacteria 75030
59 Ga0065165_1039795 3300005262 Bacteria 1405
60 Ga0070658_10006508 3300005327 Bacteria 9472
61 Ga0070670_100546734 3300005331 Bacteria 1033
62 Ga0070680_100804629 3300005336 Bacteria 810
63 Ga0070682_100472407 3300005337 Bacteria 965
64 Ga0070661_100129831 3300005344 Bacteria 1892
65 Ga0070668_100360086 3300005347 Bacteria 1233
66 Ga0070669_100188677 3300005353 Bacteria 1616
67 Ga0070675_100570555 3300005354 Bacteria 1024
68 Ga0070674_100033061 3300005356 Bacteria 3440
69 Ga0070674_100126710 3300005356 Bacteria 1898
70 Ga0070673_100107102 3300005364 Bacteria 2312
71 Ga0070667_100098513 3300005367 Bacteria 2523
72 Ga0070713_100099317 3300005436 Bacteria 2518
73 Ga0070713_101016742 3300005436 Unclassified 800
74 Ga0070710_10146923 3300005437 Bacteria 1451
75 Ga0070681_10408013 3300005458 Bacteria 1270
76 Ga0070665_100024676 3300005548 Bacteria 6058
77 Ga0070665_100513286 3300005548 Bacteria 1210
78 Ga0070665_100785887 3300005548 Bacteria 965
79 Ga0070665_100789112 3300005548 Bacteria 963
80 Ga0068855_100276478 3300005563 Bacteria 1866
81 Ga0070664_100308349 3300005564 Bacteria 1432
82 Ga0068857_100027640 3300005577 Bacteria 5004
83 Ga0068854_100037278 3300005578 Bacteria 3412
84 Ga0068854_100123500 3300005578 Bacteria 1969
85 Ga0068856_100006812 3300005614 Bacteria 11182
86 Ga0068856_100175801 3300005614 Bacteria 2153
87 Ga0068852_100170714 3300005616 Bacteria 2038
88 Ga0068861_100542548 3300005719 Bacteria 1058
89 Ga0068851_10113610 3300005834 Bacteria 1448
90 Ga0068858_100486691 3300005842 Bacteria 1191
91 Ga0068862_100829494 3300005844 Bacteria 905
92 Ga0081539_10001319 3300005985 Bacteria 43381
93 Ga0075365_10148716 3300006038 Bacteria 1629
94 Ga0075365_10162972 3300006038 Bacteria 1554
95 Ga0075365_10214251 3300006038 Bacteria 1350
96 Ga0075363_100078189 3300006048 Bacteria 1806
97 Ga0075363_100241544 3300006048 Bacteria 1038
98 Ga0070712_100645854 3300006175 Bacteria 899
99 Ga0075362_10017952 3300006177 Bacteria 2921
100 Ga0075367_10016042 3300006178 Bacteria 4084
101 Ga0075369_10010876 3300006186 Bacteria 3566
102 Ga0075369_10035370 3300006186 Bacteria 2123
103 Ga0075369_10050809 3300006186 Bacteria 1794
104 Ga0075369_10052411 3300006186 Bacteria 1769
105 Ga0075366_10370678 3300006195 Bacteria 880
106 Ga0075370_10000997 3300006353 Bacteria 11693
107 Ga0075370_10055995 3300006353 Bacteria 2241
108 Ga0105240_10000014 3300009093 Bacteria 482033
109 Ga0105240_10145429 3300009093 Bacteria 2829
110 Ga0105245_10544938 3300009098 Bacteria 1182
111 Ga0105241_10337656 3300009174 Bacteria 1304
112 Ga0105248_10728742 3300009177 Bacteria 1119
113 Ga0105237_10000770 3300009545 Bacteria 43805
114 Ga0105237_10841174 3300009545 Unclassified 924
115 Ga0105237_11376550 3300009545 Bacteria 712
116 Ga0105238_10230095 3300009551 Bacteria 1831
117 Ga0105249_11298520 3300009553 Bacteria 799
118 Ga0123341_1000019 3300009765 Bacteria 80932
119 Ga0123342_1005624 3300009766 Bacteria 17997
120 Ga0123342_1014594 3300009766 Bacteria 7436
121 Ga0105239_10003623 3300010375 Bacteria 18874
122 Ga0105239_10216553 3300010375 Bacteria 2147
123 Ga0105239_11044902 3300010375 Bacteria 940
124 Ga0157370_10000015 3300013104 Bacteria 185771
125 Ga0157370_10792138 3300013104 Bacteria 863
126 Ga0157369_10266690 3300013105 Bacteria 1785
127 Ga0171463_1001 3300013249 Bacteria 1406070
128 Ga0157378_11674458 3300013297 Bacteria 683
129 Ga0182008_10006019 3300014497 Bacteria 6829
130 Ga0182007_10001308 3300015262 Bacteria 13473
131 Ga0182005_1022393 3300015265 Bacteria 1732
132 Ga0183363_1038 3300015690 Bacteria 43720
133 Ga0213876_10017884 3300021384 Bacteria 3740
134 Ga0213876_10186835 3300021384 Unclassified 1102
135 Ga0209435_100020 3300025206 Bacteria 229105
136 Ga0209436_100086 3300025208 Bacteria 46768
137 Ga0209672_102309 3300025228 Bacteria 4845
138 Ga0209563_104368 3300025230 Bacteria 2717
139 Ga0207427_108238 3300025231 Bacteria 1172
140 Ga0209437_100095 3300025233 Bacteria 236997
141 Ga0207425_1000032 3300025245 Bacteria 253689
142 Ga0207425_1002996 3300025245 Bacteria 5627
143 Ga0207425_1013574 3300025245 Bacteria 1878
144 Ga0207425_1045807 3300025245 Bacteria 816
145 Ga0209646_1000070 3300025246 Bacteria 229105
146 Ga0209646_1031702 3300025246 Bacteria 706
147 Ga0209026_1000057 3300025250 Bacteria 229105
148 Ga0209677_100949 3300025253 Bacteria 14127
149 Ga0209759_1000047 3300025256 Bacteria 229105
150 Ga0209759_1038655 3300025256 Bacteria 846
151 Ga0209129_1000056 3300025258 Bacteria 253689
152 Ga0209129_1000637 3300025258 Bacteria 23458
153 Ga0209129_1000958 3300025258 Bacteria 17387
154 Ga0209129_1000961 3300025258 Bacteria 17333
155 Ga0209129_1002846 3300025258 Bacteria 7995
156 Ga0209233_1000117 3300025261 Bacteria 236984
157 Ga0209233_1000137 3300025261 Bacteria 200314
158 Ga0209455_1026385 3300025272 Bacteria 1043
159 Ga0209673_1000139 3300025273 Bacteria 157765
160 Ga0209673_1001384 3300025273 Bacteria 23793
161 Ga0209673_1010138 3300025273 Bacteria 4001
162 Ga0209673_1015433 3300025273 Bacteria 2903
163 Ga0209673_1026188 3300025273 Bacteria 1921
164 Ga0209130_1000006 3300025284 Bacteria 596528
165 Ga0209130_1000145 3300025284 Bacteria 113201
166 Ga0209676_1018962 3300025292 Bacteria 2380
167 Ga0209025_1000090 3300025294 Bacteria 253689
168 Ga0209025_1000195 3300025294 Bacteria 148218
169 Ga0209025_1000866 3300025294 Bacteria 47843
170 Ga0209025_1004550 3300025294 Bacteria 11948
171 Ga0209025_1059705 3300025294 Bacteria 1437
172 Ga0209025_1064215 3300025294 Bacteria 1350
173 Ga0209564_1000331 3300025295 Bacteria 91919
174 Ga0209564_1000739 3300025295 Bacteria 46443
175 Ga0209758_1000084 3300025297 Bacteria 256346
176 Ga0209758_1000633 3300025297 Bacteria 53969
177 Ga0209758_1002108 3300025297 Bacteria 21094
178 Ga0209758_1002534 3300025297 Bacteria 18440
179 Ga0209758_1002560 3300025297 Bacteria 18300
180 Ga0209050_1004101 3300025298 Bacteria 10177
181 Ga0209256_1000299 3300025299 Bacteria 86909
182 Ga0209256_1009840 3300025299 Bacteria 4113
183 Ga0209256_1012419 3300025299 Bacteria 3267
184 Ga0207426_1000003 3300025302 Bacteria 1063212
185 Ga0207426_1000011 3300025302 Bacteria 791203
186 Ga0209051_1000095 3300025303 Bacteria 167840
187 Ga0209051_1008489 3300025303 Bacteria 5427
188 Ga0209257_1000901 3300025304 Bacteria 41650
189 Ga0207656_10097596 3300025321 Bacteria 1343
190 Ga0207692_10410013 3300025898 Unclassified 847
191 Ga0207647_10194444 3300025904 Bacteria 1175
192 Ga0207699_10094032 3300025906 Bacteria 1888
193 Ga0207645_10051969 3300025907 Bacteria 2618
194 Ga0207684_10440066 3300025910 Unclassified 1120
195 Ga0207695_10000037 3300025913 Bacteria 476303
196 Ga0207695_10140665 3300025913 Bacteria 2362
197 Ga0207671_10000080 3300025914 Bacteria 148567
198 Ga0207671_10799236 3300025914 Bacteria 748
199 Ga0207657_10237956 3300025919 Bacteria 1454
200 Ga0207649_10635530 3300025920 Bacteria 824
201 Ga0207694_10780738 3300025924 Bacteria 807
202 Ga0207687_10169323 3300025927 Bacteria 1683
203 Ga0207700_10142726 3300025928 Bacteria 1970
204 Ga0207706_10139904 3300025933 Bacteria 2129
205 Ga0207669_10055689 3300025937 Bacteria 2396
206 Ga0207669_10057885 3300025937 Bacteria 2362
207 Ga0207704_10048784 3300025938 Bacteria 2541
208 Ga0207691_10097929 3300025940 Bacteria 2621
209 Ga0207679_10113761 3300025945 Bacteria 2141
210 Ga0207667_10352167 3300025949 Bacteria 1502
211 Ga0207651_10124330 3300025960 Bacteria 1963
212 Ga0207668_10596404 3300025972 Bacteria 962
213 Ga0207640_10238241 3300025981 Bacteria 1404
214 Ga0207640_10343172 3300025981 Bacteria 1197
215 Ga0207658_10077809 3300025986 Bacteria 2532
216 Ga0207703_10673005 3300026035 Bacteria 983
217 Ga0207639_10054425 3300026041 Bacteria 3058
218 Ga0207678_10131820 3300026067 Bacteria 2133
219 Ga0207702_10012779 3300026078 Bacteria 6987
220 Ga0207648_10258361 3300026089 Bacteria 1554
221 Ga0207676_10955173 3300026095 Bacteria 843
222 Ga0207674_10003842 3300026116 Bacteria 18310
223 Ga0207675_100785790 3300026118 Bacteria 965
224 Ga0209371_1005586 3300027312 Bacteria 4947
225 Ga0268266_10018581 3300028379 Bacteria 5924
226 Ga0268266_10420040 3300028379 Bacteria 1267
227 Ga0268266_10436661 3300028379 Bacteria 1243
228 Ga0307515_10018154 3300028794 Bacteria 12761
229 Ga0307515_10029079 3300028794 Bacteria 9361
230 Ga0307515_10402094 3300028794 Bacteria 995
231 Ga0307515_10439474 3300028794 Bacteria 922
232 Ga0268256_1005982 3300030500 Bacteria 4640
233 Ga0265760_10071723 3300031090 Unclassified 1063
234 Ga0307513_10032990 3300031456 Bacteria 5828
235 Ga0307508_10174444 3300031616 Bacteria 1753
236 Ga0316583_10061393 3300032133 Bacteria 1317
237 Ga0373927_0000139 3300035695 Bacteria 56397
238 Ga0373927_0165824 3300035695 Bacteria 1448
239 Ga0373937_0371462 3300036401 Bacteria 1356
240 Ga0373925_0121508 3300037068 Bacteria 2028
241 Ga0373925_0122694 3300037068 Bacteria 2018
242 Ga0400483_054961 3300039062 Bacteria 1586
243 Ga0400483_236731 3300039062 Bacteria 1023
244 Ga0436365_0602588 3300039437 Bacteria 9076
245 Ga0436361_0280631 3300039447 Bacteria 1251
246 Ga0439439_0214150 3300041406 Bacteria 563
247 Ga0439465_0012710 3300041413 Bacteria 2633
248 Ga0439465_0017670 3300041413 Bacteria 2228
249 Ga0451833_0419462 3300041491 Bacteria 823
250 Ga0451835_0956841 3300041492 Bacteria 1570
251 Ga0451845_0688499 3300041501 Bacteria 1500
252 Ga0451849_1212919 3300041505 Bacteria 1174
253 Ga0451853_3773653 3300041512 Bacteria 1413
254 Ga0466965_0468614 3300044683 Bacteria 703
255 Ga0466963_0043848 3300044694 Bacteria 2942
256 Ga0466970_0071269 3300044765 Bacteria 1869
257 Ga0466967_0282573 3300045976 Bacteria 1593
258 Ga0495617_074185 3300046452 Bacteria 1117
259 Ga0495592_0583809 3300046454 Bacteria 683
260 Ga0495629_0355048 3300046459 Bacteria 999
261 Ga0495638_0000084 3300046460 Bacteria 153168
262 Ga0495605_0012679 3300046474 Bacteria 4668
263 Ga0495662_0037129 3300046476 Bacteria 2353
264 Ga0495585_0150769 3300046492 Bacteria 1212
265 Ga0495585_0171356 3300046492 Bacteria 1121
266 Ga0495585_0195617 3300046492 Bacteria 1032
267 Ga0495607_0338707 3300046501 Bacteria 697
268 Ga0495583_0012857 3300046506 Bacteria 4708
269 Ga0495583_0059798 3300046506 Bacteria 1706
270 Ga0495583_0099381 3300046506 Bacteria 1243
271 Ga0495606_0001215 3300046507 Bacteria 36112
272 Ga0495606_0030826 3300046507 Bacteria 3739
273 Ga0495606_0068244 3300046507 Bacteria 2250
274 Ga0495606_0381522 3300046507 Bacteria 739
275 Ga0495610_0001402 3300046512 Bacteria 21414
276 Ga0495610_0077864 3300046512 Bacteria 1530
277 Ga0495616_0203874 3300046513 Bacteria 868
278 Ga0495616_0252184 3300046513 Bacteria 758
279 Ga0495620_0026545 3300046515 Bacteria 2723
280 Ga0495620_0052866 3300046515 Bacteria 1723
281 Ga0495620_0053204 3300046515 Bacteria 1715
282 Ga0495631_0047398 3300046518 Bacteria 1887
283 Ga0495632_0007421 3300046519 Bacteria 6888
284 Ga0495632_0026207 3300046519 Bacteria 3073
285 Ga0495632_0082906 3300046519 Bacteria 1527
286 Ga0495632_0321587 3300046519 Bacteria 683
287 Ga0495643_0008164 3300046522 Bacteria 6660
288 Ga0495643_0039329 3300046522 Bacteria 2587
289 Ga0495648_0103215 3300046524 Bacteria 1569
290 Ga0495640_0309870 3300046533 Bacteria 979
291 Ga0495609_0259903 3300046538 Bacteria 713
292 Ga0495597_0036970 3300046542 Bacteria 2195
293 Ga0495622_0041598 3300046557 Bacteria 2137
294 Ga0495633_0012467 3300046558 Bacteria 4520
295 Ga0495656_0191534 3300046615 Bacteria 1010
296 Ga0495668_0054314 3300046616 Bacteria 2214
297 Ga0495668_0380529 3300046616 Bacteria 775
298 Ga0495625_0021268 3300046660 Bacteria 4997
299 Ga0495625_0270614 3300046660 Bacteria 1096
300 Ga0495588_0008475 3300046674 Bacteria 4722
301 Ga0495588_0141508 3300046674 Bacteria 1271
302 Ga0495658_0182452 3300046683 Bacteria 1303
303 Ga0495670_0124438 3300046691 Bacteria 1341
304 Ga0495649_0096203 3300046694 Bacteria 1576
305 Ga0495649_0306063 3300046694 Bacteria 808
306 Ga0495600_0222641 3300046809 Bacteria 1206
307 Ga0495604_0067664 3300047317 Bacteria 2713
308 Ga0495636_0109936 3300047318 Bacteria 1212
309 Ga0495672_0061043 3300047320 Bacteria 2174
310 Ga0495676_0179694 3300047321 Bacteria 1484
311 Ga0495687_068150 3300047443 Bacteria 1437
312 Ga0495681_0000810 3300047470 Bacteria 24119
313 Ga0495686_0000296 3300047472 Bacteria 86346
314 Ga0495686_0023821 3300047472 Bacteria 4029
315 Ga0495686_0045835 3300047472 Bacteria 2765
316 Ga0495686_0057348 3300047472 Bacteria 2431
317 Ga0495686_0225506 3300047472 Bacteria 1064
318 Ga0496100_0514012 3300048903 Bacteria 924
319 Ga0496102_0325201 3300048905 Bacteria 1448
320 Ga0496106_0003638 3300048909 Bacteria 11496
321 Ga0496113_0078879 3300048916 Bacteria 2520
322 Ga0496116_0012877 3300048919 Bacteria 6793
323 Ga0496116_0012878 3300048919 Bacteria 6793
324 Ga0496116_0023674 3300048919 Bacteria 4566
325 Ga0496116_0033119 3300048919 Bacteria 3671
326 Ga0496117_0002935 3300048920 Bacteria 20638
327 Ga0496117_0007065 3300048920 Bacteria 11104
328 Ga0496117_0272745 3300048920 Bacteria 910
329 Ga0496118_0009924 3300048921 Bacteria 9512
330 Ga0496118_0010596 3300048921 Bacteria 9107
331 Ga0496118_0151712 3300048921 Bacteria 1449
332 Ga0496118_0182928 3300048921 Bacteria 1264
333 Ga0496119_0011254 3300048922 Bacteria 7440
334 Ga0496119_0041595 3300048922 Bacteria 2924
335 Ga0496119_0233727 3300048922 Bacteria 934
336 Ga0496120_0005182 3300048923 Bacteria 10523
337 Ga0496121_0014935 3300048924 Bacteria 8181
338 Ga0496121_0015473 3300048924 Bacteria 7991
339 Ga0496121_0019085 3300048924 Bacteria 6878
340 Ga0496121_0072988 3300048924 Bacteria 2752
341 Ga0496121_0136795 3300048924 Bacteria 1824
342 Ga0496122_0004149 3300048925 Bacteria 18287
343 Ga0496122_0016413 3300048925 Bacteria 7006
344 Ga0496122_0019733 3300048925 Bacteria 6142
345 Ga0496122_0019824 3300048925 Bacteria 6121
346 Ga0496123_0002119 3300048926 Bacteria 25445
347 Ga0496123_0013335 3300048926 Bacteria 6912
348 Ga0496123_0015360 3300048926 Bacteria 6284
349 Ga0496123_0108080 3300048926 Bacteria 1598
350 Ga0496124_0002110 3300048927 Bacteria 26805
351 Ga0496124_0010016 3300048927 Bacteria 9674
352 Ga0496124_0023187 3300048927 Bacteria 5671
353 Ga0496124_0050037 3300048927 Bacteria 3562
354 Ga0496124_0084016 3300048927 Bacteria 2611
355 Ga0496124_0136851 3300048927 Bacteria 1938
356 Ga0496124_0327258 3300048927 Bacteria 1094
357 Ga0496124_0500085 3300048927 Bacteria 815
358 Ga0496125_0002940 3300048928 Bacteria 21447
359 Ga0496125_0003382 3300048928 Bacteria 19414
360 Ga0496125_0030906 3300048928 Bacteria 4781
361 Ga0496125_0079433 3300048928 Bacteria 2517
362 Ga0496125_0086003 3300048928 Bacteria 2380
363 Ga0496125_0117658 3300048928 Bacteria 1905
364 Ga0496125_0220401 3300048928 Bacteria 1223
365 Ga0496126_0002668 3300048929 Bacteria 23630
366 Ga0496126_0139694 3300048929 Bacteria 2086
367 Ga0496126_0163553 3300048929 Bacteria 1900
368 Ga0496126_0242009 3300048929 Bacteria 1507
369 Ga0496126_0246944 3300048929 Unclassified 1489
370 Ga0496126_0396505 3300048929 Bacteria 1120
371 Ga0495682_0085957 3300049460 Bacteria 1130
372 Ga0501032_0017901 3300049569 Bacteria 4971
373 Ga0501032_0046581 3300049569 Bacteria 2930
374 Ga0501033_0052991 3300049570 Bacteria 3006
375 Ga0501033_0112803 3300049570 Bacteria 1977
376 Ga0501033_0153819 3300049570 Bacteria 1658
377 Ga0501033_0177060 3300049570 Bacteria 1530
378 Ga0501034_0015877 3300049571 Bacteria 7732
379 Ga0501034_0128682 3300049571 Bacteria 2516
380 Ga0501034_0190146 3300049571 Bacteria 2015
381 Ga0501034_0318475 3300049571 Bacteria 1488
382 Ga0501034_0361133 3300049571 Bacteria 1379
383 Ga0501034_0662657 3300049571 Bacteria 944
384 Ga0501034_0709881 3300049571 Bacteria 903
385 Ga0501036_0222792 3300049572 Bacteria 1584
386 Ga0501038_0013866 3300049574 Bacteria 7344
387 Ga0501038_0493790 3300049574 Bacteria 937
388 Ga0501039_0100415 3300049575 Bacteria 2258
389 Ga0501039_0123519 3300049575 Bacteria 2030
390 Ga0501043_0143781 3300049579 Bacteria 1867
391 Ga0501043_0362039 3300049579 Bacteria 1101
392 Ga0501046_0269135 3300049580 Bacteria 1250
393 Ga0501046_0272401 3300049580 Bacteria 1241
394 Ga0501047_0055854 3300049581 Bacteria 3818
395 Ga0501047_0064326 3300049581 Bacteria 3537
396 Ga0501047_0336301 3300049581 Bacteria 1348
397 Ga0501047_0629654 3300049581 Bacteria 893
398 Ga0501076_0752658 3300049592 Bacteria 804
399 Ga0501083_0044073 3300049744 Bacteria 3020
400 Ga0501035_0557464 3300049822 Bacteria 938
401 Ga0501044_0030308 3300049823 Bacteria 5703
402 Ga0501044_0119399 3300049823 Bacteria 2639
403 Ga0501044_0167310 3300049823 Bacteria 2172
404 Ga0501044_1066895 3300049823 Bacteria 678
405 nmdc:mga03n38_338619_c1 3300050490 Bacteria 816
406 nmdc:mga00v17_259246_c1 3300050491 Bacteria 1128
407 nmdc:mga00v17_84797_c2 3300050491 Bacteria 1475
408 nmdc:mga0yw44_25923_c1 3300050492 Bacteria 3342
409 nmdc:mga0k408_320021_c1 3300050493 Bacteria 926
410 nmdc:mga07m45_279601_c1 3300050496 Bacteria 971
411 nmdc:mga0rr50_1043517_c1 3300050513 Unclassified 696
412 nmdc:mga0sz30_77592_c1 3300050516 Bacteria 1435
413 Ga0495601_0157412 3300053077 Bacteria 1484
414 Ga0500610_0122119 3300053079 Bacteria 1331
415 Ga0500578_0095069 3300053086 Bacteria 1890
416 Ga0500578_0138278 3300053086 Bacteria 1524
417 Ga0500643_004879 3300053087 Bacteria 5915
418 Ga0500644_0025629 3300053088 Bacteria 1817
419 Ga0500650_0295560 3300053098 Bacteria 718
420 Ga0500560_000445 3300053107 Bacteria 5689
421 Ga0500562_058072 3300053108 Bacteria 1038
422 Ga0500608_064631 3300053122 Bacteria 1746
423 Ga0500608_072153 3300053122 Bacteria 1641
424 Ga0500608_218109 3300053122 Bacteria 772
425 Ga0500628_192171 3300053129 Bacteria 586
426 Ga0500559_0002335 3300053136 Bacteria 9920
427 Ga0500559_0202181 3300053136 Bacteria 937
428 Ga0500568_0002316 3300053139 Bacteria 11300
429 Ga0500568_0002514 3300053139 Bacteria 10727
430 Ga0500573_0005124 3300053140 Bacteria 6987
431 Ga0500588_0102153 3300053146 Bacteria 990
432 Ga0500590_046899 3300053148 Bacteria 2207
433 Ga0500604_0021173 3300053151 Bacteria 1836
434 Ga0500616_0000795 3300053153 Bacteria 36180
435 Ga0500616_0009177 3300053153 Bacteria 6038
436 Ga0500616_0025458 3300053153 Bacteria 3282
437 Ga0500622_0000178 3300053156 Bacteria 69024
438 Ga0500622_0001743 3300053156 Bacteria 16801
439 Ga0500627_0233090 3300053158 Bacteria 819
440 Ga0500633_0032685 3300053160 Bacteria 1691
441 Ga0500634_0122967 3300053161 Bacteria 1259
442 Ga0500599_051279 3300053736 Bacteria 655
443 Ga0466962_0067305 3300061719 Bacteria 1710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026095 Ga0207676_10955173 Ga0207676_109551732 155
2 3300025919 Ga0207657_10237956 Ga0207657_102379562 156
3 3300041406 Ga0439439_0214150 Ga0439439_0214150_55_537 160
4 3300041492 Ga0451835_0956841 Ga0451835_0956841_1076_1558 160
5 3300053129 Ga0500628_192171 Ga0500628_192171_91_576 161
6 3300003320 rootH2_10182880 rootH2_101828801 168
7 3300048928 Ga0496125_0117658 Ga0496125_0117658_671_1282 176
8 3300021384 Ga0213876_10017884 Ga0213876_100178845 181
9 3300039437 Ga0436365_0602588 Ga0436365_0602588_3567_4115 181
10 3300046506 Ga0495583_0012857 Ga0495583_0012857_3424_3972 182
11 3300046506 Ga0495583_0059798 Ga0495583_0059798_17_568 183
12 3300046507 Ga0495606_0068244 Ga0495606_0068244_1481_2032 183
13 3300046512 Ga0495610_0001402 Ga0495610_0001402_6407_6958 183
14 3300046515 Ga0495620_0026545 Ga0495620_0026545_640_1191 183
15 3300046519 Ga0495632_0026207 Ga0495632_0026207_1881_2432 183
16 3300046616 Ga0495668_0380529 Ga0495668_0380529_101_652 183
17 3300047472 Ga0495686_0045835 Ga0495686_0045835_1783_2334 183
18 3300048927 Ga0496124_0050037 Ga0496124_0050037_50_601 183
19 3300048927 Ga0496124_0327258 Ga0496124_0327258_303_854 183
20 3300048927 Ga0496124_0500085 Ga0496124_0500085_55_606 183
21 3300053146 Ga0500588_0102153 Ga0500588_0102153_423_974 183
22 iso_pu_bacteria 2917554339 2917554556 188
23 3300049579 Ga0501043_0362039 Ga0501043_0362039_330_908 189
24 3300049580 Ga0501046_0272401 Ga0501046_0272401_520_1098 189
25 3300049823 Ga0501044_0119399 Ga0501044_0119399_1850_2428 189
26 iso_pu_bacteria 2509276021 2509386996 189
27 iso_pu_bacteria 2509276033 2509445348 189
28 iso_pu_bacteria 2510065019 2510135753 189
29 iso_pu_bacteria 2510917022 2511137357 189
30 iso_pu_bacteria 2510917028 2511181872 189
31 iso_pu_bacteria 2510917030 2511195105 189
32 iso_pu_bacteria 2513237084 2513568149 189
33 iso_pu_bacteria 2513237084 2513570915 189
34 iso_pu_bacteria 2513237088 2513599386 189
35 iso_pu_bacteria 2513237138 2513867808 189
36 iso_pu_bacteria 2513237144 2513914427 189
37 iso_pu_bacteria 2517287029 2517409002 189
38 iso_pu_bacteria 2517287029 2517410155 189
39 iso_pu_bacteria 2519899620 2520378967 189
40 iso_pu_bacteria 2523231067 2523469527 189
41 iso_pu_bacteria 2529292951 2530645210 189
42 iso_pu_bacteria 2582581298 2585226045 189
43 iso_pu_bacteria 2582581299 2585230243 189
44 iso_pu_bacteria 2582581304 2585254494 189
45 iso_pu_bacteria 2582581307 2585274044 189
46 iso_pu_bacteria 2582581308 2585279508 189
47 iso_pu_bacteria 2582581315 2585322832 189
48 iso_pu_bacteria 2582581316 2585334604 189
49 iso_pu_bacteria 2582581866 2585393622 189
50 iso_pu_bacteria 2582581867 2585403149 189
51 iso_pu_bacteria 2585427527 2585531008 189
52 iso_pu_bacteria 2585427529 2585547078 189
53 iso_pu_bacteria 2585427530 2585553071 189
54 iso_pu_bacteria 2585427531 2585560495 189
55 iso_pu_bacteria 2585427590 2585823972 189
56 iso_pu_bacteria 2585427594 2585845945 189
57 iso_pu_bacteria 2585427608 2585898690 189
58 iso_pu_bacteria 2585427609 2585903723 189
59 iso_pu_bacteria 2585428125 2587981158 189
60 iso_pu_bacteria 2615840624 2616294718 189
61 iso_pu_bacteria 2615840626 2616307080 189
62 iso_pu_bacteria 2615840698 2616557317 189
63 iso_pu_bacteria 2617270742 2617384065 189
64 iso_pu_bacteria 2643221629 2644168961 189
65 iso_pu_bacteria 2643221689 2644498647 189
66 iso_pu_bacteria 2667528174 2671115137 189
67 iso_pu_bacteria 2718217882 2719180875 189
68 iso_pu_bacteria 2718217997 2719668364 189
69 iso_pu_bacteria 2718218009 2719731624 189
70 iso_pu_bacteria 2718218199 2720489057 189
71 iso_pu_bacteria 2718218232 2720609750 189
72 iso_pu_bacteria 2718218233 2720617181 189
73 iso_pu_bacteria 2718218235 2720628313 189
74 iso_pu_bacteria 2718218269 2720772277 189
75 iso_pu_bacteria 2718218363 2721146969 189
76 iso_pu_bacteria 2718218365 2721158499 189
77 iso_pu_bacteria 2718218366 2721163887 189
78 iso_pu_bacteria 2721755514 2722840057 189
79 iso_pu_bacteria 2721755556 2723029697 189
80 iso_pu_bacteria 2721755684 2723564066 189
81 iso_pu_bacteria 2721755685 2723569601 189
82 iso_pu_bacteria 2721755810 2724044380 189
83 iso_pu_bacteria 2721755819 2724092306 189
84 iso_pu_bacteria 2721755822 2724101148 189
85 iso_pu_bacteria 2721755823 2724112673 189
86 iso_pu_bacteria 2724679232 2725947151 189
87 iso_pu_bacteria 2728369352 2730110230 189
88 iso_pu_bacteria 2728369365 2730164112 189
89 iso_pu_bacteria 2728369397 2730298131 189
90 iso_pu_bacteria 2738541293 2738803354 189
91 iso_pu_bacteria 2738543031 2739349510 189
92 iso_pu_bacteria 2751185821 2753459889 189
93 iso_pu_bacteria 2765235942 2766063241 189
94 iso_pu_bacteria 2775507266 2778177934 189
95 iso_pu_bacteria 2791355094 2792637676 189
96 iso_pu_bacteria 2791355253 2793283129 189
97 iso_pu_bacteria 2791355259 2793317761 189
98 iso_pu_bacteria 2791355260 2793321185 189
99 iso_pu_bacteria 2791355261 2793329489 189
100 iso_pu_bacteria 2791355262 2793337007 189
101 iso_pu_bacteria 2791355263 2793341226 189
102 iso_pu_bacteria 2791355264 2793347601 189
103 iso_pu_bacteria 2791355265 2793356007 189
104 iso_pu_bacteria 2791355267 2793366480 189
105 iso_pu_bacteria 2802429605 2805928280 189
106 iso_pu_bacteria 2802429605 2805930667 189
107 iso_pu_bacteria 2818991448 2819613442 189
108 iso_pu_bacteria 2818991453 2819639959 189
109 iso_pu_bacteria 2838016132 2838016419 189
110 iso_pu_bacteria 2838022645 2838025458 189
111 iso_pu_bacteria 2838029111 2838032883 189
112 iso_pu_bacteria 2838042994 2838045348 189
113 iso_pu_bacteria 2838048938 2838050136 189
114 iso_pu_bacteria 2838061910 2838065168 189
115 iso_pu_bacteria 2838068647 2838068955 189
116 iso_pu_bacteria 2838668709 2838671329 189
117 iso_pu_bacteria 2838668709 2838674084 189
118 iso_pu_bacteria 2838701080 2838703490 189
119 iso_pu_bacteria 2838701080 2838706476 189
120 iso_pu_bacteria 2841864319 2841864873 189
121 iso_pu_bacteria 2842110456 2842112662 189
122 iso_pu_bacteria 2842146304 2842149508 189
123 iso_pu_bacteria 2842146304 2842151134 189
124 iso_pu_bacteria 2842198810 2842201026 189
125 iso_pu_bacteria 2842250916 2842253854 189
126 iso_pu_bacteria 2842250916 2842256190 189
127 iso_pu_bacteria 2842264693 2842265292 189
128 iso_pu_bacteria 2842285085 2842287458 189
129 iso_pu_bacteria 2842311132 2842313451 189
130 iso_pu_bacteria 2842317721 2842321582 189
131 iso_pu_bacteria 2842317721 2842321895 189
132 iso_pu_bacteria 2842341865 2842347199 189
133 iso_pu_bacteria 2842363717 2842366616 189
134 iso_pu_bacteria 2842395702 2842397344 189
135 iso_pu_bacteria 2842402390 2842405013 189
136 iso_pu_bacteria 2842409023 2842411595 189
137 iso_pu_bacteria 2842415677 2842417954 189
138 iso_pu_bacteria 2842422224 2842423101 189
139 iso_pu_bacteria 2842428310 2842428655 189
140 iso_pu_bacteria 2842434925 2842435269 189
141 iso_pu_bacteria 2842441272 2842441868 189
142 iso_pu_bacteria 2842447887 2842448082 189
143 iso_pu_bacteria 2842462802 2842463081 189
144 iso_pu_bacteria 2842469257 2842469601 189
145 iso_pu_bacteria 2842475841 2842479616 189
146 iso_pu_bacteria 2842489311 2842493083 189
147 iso_pu_bacteria 2842495871 2842499349 189
148 iso_pu_bacteria 2842495871 2842499794 189
149 iso_pu_bacteria 2842502639 2842506719 189
150 iso_pu_bacteria 2842509118 2842510466 189
151 iso_pu_bacteria 2847670302 2847675820 189
152 iso_pu_bacteria 2852387548 2852390888 189
153 iso_pu_bacteria 2855872281 2855877826 189
154 iso_pu_bacteria 2856314179 2856314636 189
155 iso_pu_bacteria 2869162929 2869166262 189
156 iso_pu_bacteria 2871495908 2871499916 189
157 iso_pu_bacteria 2876369609 2876377433 189
158 iso_pu_bacteria 2878035449 2878039892 189
159 iso_pu_bacteria 2878760144 2878764071 189
160 iso_pu_bacteria 2878767105 2878771110 189
161 iso_pu_bacteria 2891048133 2891049988 189
162 iso_pu_bacteria 2891373044 2891375370 189
163 iso_pu_bacteria 2903540706 2903544730 189
164 iso_pu_bacteria 2906414383 2906414589 189
165 iso_pu_bacteria 2919100787 2919104211 189
166 iso_pu_bacteria 2919408235 2919412051 189
167 iso_pu_bacteria 2920822456 2920822894 189
168 iso_pu_bacteria 2923556063 2923559369 189
169 iso_pu_bacteria 2924762789 2924764097 189
170 iso_pu_bacteria 2933586486 2933588449 189
171 iso_pu_bacteria 2933599457 2933599622 189
172 iso_pu_bacteria 2936381700 2936385972 189
173 iso_pu_bacteria 2937994558 2937998576 189
174 iso_pu_bacteria 2939669807 2939672368 189
175 iso_pu_bacteria 2958165035 2958169056 189
176 iso_pu_bacteria 2961163497 2961167515 189
177 iso_pu_bacteria 2965018300 2965022338 189
178 iso_pu_bacteria 2968171901 2968175922 189
179 iso_pu_bacteria 2970554993 2970558916 189
180 iso_pu_bacteria 2987659509 2987663521 189
181 iso_pu_bacteria 2987666974 2987668998 189
182 iso_pu_bacteria 2989349275 2989351879 189
183 iso_pu_bacteria 2995392953 2995395614 189
184 iso_pu_bacteria 2996336353 2996340964 189
185 iso_pu_bacteria 3000135777 3000140354 189
186 iso_pu_bacteria 3004188549 3004192582 189
187 iso_pu_bacteria 3005416602 3005422283 189
188 iso_pu_bacteria 3005445848 3005447068 189
189 iso_pu_bacteria 3005452660 3005457202 189
190 iso_pu_bacteria 8005282627 8005287060 189
191 iso_pu_bacteria 8005289223 8005290978 189
192 iso_pu_bacteria 8005301065 8005307286 189
193 iso_pu_bacteria 8005314921 8005316330 189
194 iso_pu_bacteria 8005382845 8005383628 189
195 iso_pu_bacteria 8005395548 8005398122 189
196 iso_pu_bacteria 8005430974 8005434819 189
197 iso_pu_bacteria 8005484373 8005488090 189
198 iso_pu_bacteria 8005497431 8005502571 189
199 iso_pu_bacteria 8005619151 8005623780 189
200 iso_pu_bacteria 8005626139 8005626338 189
201 iso_pu_bacteria 8005645114 8005651678 189
202 iso_pu_bacteria 8005668836 8005673999 189
203 iso_pu_bacteria 8005682033 8005686245 189
204 iso_pu_bacteria 8005688590 8005688847 189
205 iso_pu_bacteria 8005695170 8005696095 189
206 iso_pu_bacteria 8018127388 8018131938 189
207 iso_pu_bacteria 8018163183 8018165616 189
208 iso_pu_bacteria 8023680758 8023681191 189
209 iso_pu_bacteria 8024501048 8024506133 189
210 iso_pu_bacteria 8046767195 8046772562 189
211 iso_pu_bacteria 8056375014 8056380192 189
212 iso_pu_bacteria 8056382006 8056382934 189
213 iso_pu_bacteria 8057575449 8057576977 189
214 3300009093 Ga0105240_10145429 Ga0105240_101454295 190
215 3300025913 Ga0207695_10140665 Ga0207695_101406653 190
216 iso_pu_bacteria 2597489875 2597813519 190
217 3300006175 Ga0070712_100645854 Ga0070712_1006458542 191
218 3300050513 nmdc:mga0rr50_1043517_c1 nmdc:mga0rr50_1043517_c1_59_661 191
219 3300026118 Ga0207675_100785790 Ga0207675_1007857902 192
220 3300032133 Ga0316583_10061393 Ga0316583_100613931 192
221 3300039062 Ga0400483_054961 Ga0400483_054961_39_620 192
222 3300039062 Ga0400483_236731 Ga0400483_236731_368_949 192
223 3300048928 Ga0496125_0003382 Ga0496125_0003382_8311_8898 192
224 3300001979 JGI24740J21852_10000007 JGI24740J21852_1000000760 193
225 3300001979 JGI24740J21852_10021589 JGI24740J21852_100215892 193
226 3300002704 JGI25155J39150_1000034 JGI25155J39150_100003473 193
227 3300002705 JGI25156J39149_1000008 JGI25156J39149_1000008156 193
228 3300002737 JGI25162J39368_1003125 JGI25162J39368_10031254 193
229 3300002738 JGI25154J39366_1000063 JGI25154J39366_100006373 193
230 3300002739 JGI25158J39367_1000047 JGI25158J39367_10000471 193
231 3300002741 JGI25157J39369_1000062 JGI25157J39369_100006233 193
232 3300002773 JGI25152J39213_1000001 JGI25152J39213_1000001106 193
233 3300002773 JGI25152J39213_1000015 JGI25152J39213_10000152 193
234 3300002773 JGI25152J39213_1002654 JGI25152J39213_10026543 193
235 3300002773 JGI25152J39213_1012305 JGI25152J39213_10123052 193
236 3300002773 JGI25152J39213_1012308 JGI25152J39213_10123082 193
237 3300002774 JGI25150J39212_1000007 JGI25150J39212_1000007126 193
238 3300002774 JGI25150J39212_1008612 JGI25150J39212_10086122 193
239 3300002987 JGI25159J45721_1002722 JGI25159J45721_10027225 193
240 3300002987 JGI25159J45721_1003122 JGI25159J45721_10031223 193
241 3300003187 JGI25151J46595_10000013 JGI25151J46595_10000013127 193
242 3300003187 JGI25151J46595_10000278 JGI25151J46595_1000027837 193
243 3300003187 JGI25151J46595_10000462 JGI25151J46595_1000046226 193
244 3300003187 JGI25151J46595_10009010 JGI25151J46595_100090106 193
245 3300003187 JGI25151J46595_10056250 JGI25151J46595_100562502 193
246 3300003214 JGI25165J46597_1000169 JGI25165J46597_100016947 193
247 3300003214 JGI25165J46597_1000199 JGI25165J46597_10001994 193
248 3300003214 JGI25165J46597_1000704 JGI25165J46597_100070424 193
249 3300003214 JGI25165J46597_1006800 JGI25165J46597_10068002 193
250 3300003215 JGI25153J46596_10000477 JGI25153J46596_1000047713 193
251 3300003215 JGI25153J46596_10004847 JGI25153J46596_100048472 193
252 3300003215 JGI25153J46596_10013107 JGI25153J46596_100131074 193
253 3300003215 JGI25153J46596_10030256 JGI25153J46596_100302562 193
254 3300003215 JGI25153J46596_10030261 JGI25153J46596_100302612 193
255 3300003316 rootH1_10067043 rootH1_100670432 193
256 3300003316 rootH1_10110946 rootH1_101109462 193
257 3300003320 rootH2_10005365 rootH2_100053654 193
258 3300003320 rootH2_10090743 rootH2_100907431 193
259 3300003322 rootL2_10087163 rootL2_100871631 193
260 3300003322 rootL2_10190541 rootL2_101905412 193
261 3300003323 rootH1_10021850 rootH1_100218502 193
262 3300003354 JGI25160J50197_1000001 JGI25160J50197_100000199 193
263 3300003374 JGI25161J50226_1000047 JGI25161J50226_10000475 193
264 3300003374 JGI25161J50226_1000780 JGI25161J50226_10007802 193
265 3300003752 Ga0055539_1013619 Ga0055539_10136191 193
266 3300003771 Ga0055526_1000377 Ga0055526_100037742 193
267 3300003771 Ga0055526_1017075 Ga0055526_10170753 193
268 3300003775 Ga0055524_1001654 Ga0055524_10016542 193
269 3300003775 Ga0055524_1011616 Ga0055524_10116162 193
270 3300003775 Ga0055524_1015582 Ga0055524_10155822 193
271 3300003790 Ga0055528_1000106 Ga0055528_100010656 193
272 3300003790 Ga0055528_1002441 Ga0055528_100244113 193
273 3300003790 Ga0055528_1028496 Ga0055528_10284962 193
274 3300003792 Ga0055540_1000103 Ga0055540_100010340 193
275 3300003792 Ga0055540_1011551 Ga0055540_10115512 193
276 3300003794 Ga0055531_10029987 Ga0055531_100299872 193
277 3300003856 Ga0058692_1010728 Ga0058692_10107283 193
278 3300004625 Ga0055543_1000007 Ga0055543_100000796 193
279 3300004625 Ga0055543_1000961 Ga0055543_100096114 193
280 3300005262 Ga0065165_1000357 Ga0065165_100035742 193
281 3300005262 Ga0065165_1039795 Ga0065165_10397951 193
282 3300005327 Ga0070658_10006508 Ga0070658_100065086 193
283 3300005331 Ga0070670_100546734 Ga0070670_1005467342 193
284 3300005336 Ga0070680_100804629 Ga0070680_1008046291 193
285 3300005337 Ga0070682_100472407 Ga0070682_1004724071 193
286 3300005344 Ga0070661_100129831 Ga0070661_1001298314 193
287 3300005347 Ga0070668_100360086 Ga0070668_1003600861 193
288 3300005353 Ga0070669_100188677 Ga0070669_1001886771 193
289 3300005354 Ga0070675_100570555 Ga0070675_1005705551 193
290 3300005356 Ga0070674_100033061 Ga0070674_1000330613 193
291 3300005356 Ga0070674_100126710 Ga0070674_1001267101 193
292 3300005364 Ga0070673_100107102 Ga0070673_1001071022 193
293 3300005367 Ga0070667_100098513 Ga0070667_1000985134 193
294 3300005436 Ga0070713_100099317 Ga0070713_1000993172 193
295 3300005436 Ga0070713_101016742 Ga0070713_1010167421 193
296 3300005437 Ga0070710_10146923 Ga0070710_101469232 193
297 3300005458 Ga0070681_10408013 Ga0070681_104080131 193
298 3300005548 Ga0070665_100024676 Ga0070665_1000246762 193
299 3300005548 Ga0070665_100513286 Ga0070665_1005132862 193
300 3300005548 Ga0070665_100785887 Ga0070665_1007858872 193
301 3300005548 Ga0070665_100789112 Ga0070665_1007891122 193
302 3300005563 Ga0068855_100276478 Ga0068855_1002764782 193
303 3300005564 Ga0070664_100308349 Ga0070664_1003083492 193
304 3300005577 Ga0068857_100027640 Ga0068857_1000276406 193
305 3300005578 Ga0068854_100037278 Ga0068854_1000372782 193
306 3300005578 Ga0068854_100123500 Ga0068854_1001235002 193
307 3300005614 Ga0068856_100006812 Ga0068856_10000681210 193
308 3300005614 Ga0068856_100175801 Ga0068856_1001758012 193
309 3300005616 Ga0068852_100170714 Ga0068852_1001707142 193
310 3300005719 Ga0068861_100542548 Ga0068861_1005425482 193
311 3300005834 Ga0068851_10113610 Ga0068851_101136102 193
312 3300005842 Ga0068858_100486691 Ga0068858_1004866912 193
313 3300005844 Ga0068862_100829494 Ga0068862_1008294942 193
314 3300005985 Ga0081539_10001319 Ga0081539_1000131918 193
315 3300006038 Ga0075365_10148716 Ga0075365_101487163 193
316 3300006038 Ga0075365_10162972 Ga0075365_101629722 193
317 3300006038 Ga0075365_10214251 Ga0075365_102142512 193
318 3300006048 Ga0075363_100078189 Ga0075363_1000781892 193
319 3300006048 Ga0075363_100241544 Ga0075363_1002415442 193
320 3300006177 Ga0075362_10017952 Ga0075362_100179522 193
321 3300006178 Ga0075367_10016042 Ga0075367_100160424 193
322 3300006186 Ga0075369_10010876 Ga0075369_100108763 193
323 3300006186 Ga0075369_10035370 Ga0075369_100353703 193
324 3300006186 Ga0075369_10050809 Ga0075369_100508092 193
325 3300006186 Ga0075369_10052411 Ga0075369_100524112 193
326 3300006195 Ga0075366_10370678 Ga0075366_103706782 193
327 3300006353 Ga0075370_10000997 Ga0075370_100009972 193
328 3300006353 Ga0075370_10055995 Ga0075370_100559953 193
329 3300009093 Ga0105240_10000014 Ga0105240_1000001453 193
330 3300009098 Ga0105245_10544938 Ga0105245_105449382 193
331 3300009174 Ga0105241_10337656 Ga0105241_103376562 193
332 3300009177 Ga0105248_10728742 Ga0105248_107287422 193
333 3300009545 Ga0105237_10000770 Ga0105237_1000077015 193
334 3300009545 Ga0105237_10841174 Ga0105237_108411741 193
335 3300009545 Ga0105237_11376550 Ga0105237_113765501 193
336 3300009551 Ga0105238_10230095 Ga0105238_102300952 193
337 3300009553 Ga0105249_11298520 Ga0105249_112985202 193
338 3300009765 Ga0123341_1000019 Ga0123341_100001926 193
339 3300009766 Ga0123342_1005624 Ga0123342_100562417 193
340 3300009766 Ga0123342_1014594 Ga0123342_10145942 193
341 3300010375 Ga0105239_10003623 Ga0105239_100036239 193
342 3300010375 Ga0105239_10216553 Ga0105239_102165532 193
343 3300010375 Ga0105239_11044902 Ga0105239_110449022 193
344 3300013104 Ga0157370_10000015 Ga0157370_1000001553 193
345 3300013104 Ga0157370_10792138 Ga0157370_107921382 193
346 3300013105 Ga0157369_10266690 Ga0157369_102666902 193
347 3300013249 Ga0171463_1001 Ga0171463_10011185 193
348 3300013297 Ga0157378_11674458 Ga0157378_116744581 193
349 3300014497 Ga0182008_10006019 Ga0182008_100060192 193
350 3300015262 Ga0182007_10001308 Ga0182007_100013088 193
351 3300015265 Ga0182005_1022393 Ga0182005_10223931 193
352 3300015690 Ga0183363_1038 Ga0183363_10384 193
353 3300021384 Ga0213876_10186835 Ga0213876_101868352 193
354 3300025206 Ga0209435_100020 Ga0209435_100020149 193
355 3300025208 Ga0209436_100086 Ga0209436_10008618 193
356 3300025228 Ga0209672_102309 Ga0209672_1023091 193
357 3300025230 Ga0209563_104368 Ga0209563_1043684 193
358 3300025231 Ga0207427_108238 Ga0207427_1082382 193
359 3300025233 Ga0209437_100095 Ga0209437_10009536 193
360 3300025245 Ga0207425_1000032 Ga0207425_1000032123 193
361 3300025245 Ga0207425_1002996 Ga0207425_10029967 193
362 3300025245 Ga0207425_1013574 Ga0207425_10135743 193
363 3300025245 Ga0207425_1045807 Ga0207425_10458072 193
364 3300025246 Ga0209646_1000070 Ga0209646_1000070149 193
365 3300025246 Ga0209646_1031702 Ga0209646_10317021 193
366 3300025250 Ga0209026_1000057 Ga0209026_100005772 193
367 3300025253 Ga0209677_100949 Ga0209677_1009497 193
368 3300025256 Ga0209759_1000047 Ga0209759_100004772 193
369 3300025256 Ga0209759_1038655 Ga0209759_10386551 193
370 3300025258 Ga0209129_1000056 Ga0209129_1000056123 193
371 3300025258 Ga0209129_1000637 Ga0209129_10006373 193
372 3300025258 Ga0209129_1000958 Ga0209129_10009583 193
373 3300025258 Ga0209129_1000961 Ga0209129_10009613 193
374 3300025258 Ga0209129_1002846 Ga0209129_10028469 193
375 3300025261 Ga0209233_1000117 Ga0209233_100011736 193
376 3300025261 Ga0209233_1000137 Ga0209233_100013754 193
377 3300025272 Ga0209455_1026385 Ga0209455_10263852 193
378 3300025273 Ga0209673_1000139 Ga0209673_100013995 193
379 3300025273 Ga0209673_1001384 Ga0209673_100138420 193
380 3300025273 Ga0209673_1010138 Ga0209673_10101383 193
381 3300025273 Ga0209673_1015433 Ga0209673_10154332 193
382 3300025273 Ga0209673_1026188 Ga0209673_10261882 193
383 3300025284 Ga0209130_1000006 Ga0209130_1000006205 193
384 3300025284 Ga0209130_1000145 Ga0209130_100014598 193
385 3300025292 Ga0209676_1018962 Ga0209676_10189624 193
386 3300025294 Ga0209025_1000090 Ga0209025_1000090123 193
387 3300025294 Ga0209025_1000195 Ga0209025_100019513 193
388 3300025294 Ga0209025_1000866 Ga0209025_100086615 193
389 3300025294 Ga0209025_1004550 Ga0209025_10045509 193
390 3300025294 Ga0209025_1059705 Ga0209025_10597052 193
391 3300025294 Ga0209025_1064215 Ga0209025_10642152 193
392 3300025295 Ga0209564_1000331 Ga0209564_100033121 193
393 3300025295 Ga0209564_1000739 Ga0209564_100073941 193
394 3300025297 Ga0209758_1000084 Ga0209758_1000084123 193
395 3300025297 Ga0209758_1000633 Ga0209758_100063326 193
396 3300025297 Ga0209758_1002108 Ga0209758_100210823 193
397 3300025297 Ga0209758_1002534 Ga0209758_100253421 193
398 3300025297 Ga0209758_1002560 Ga0209758_10025602 193
399 3300025298 Ga0209050_1004101 Ga0209050_10041015 193
400 3300025299 Ga0209256_1000299 Ga0209256_100029916 193
401 3300025299 Ga0209256_1009840 Ga0209256_10098403 193
402 3300025299 Ga0209256_1012419 Ga0209256_10124195 193
403 3300025302 Ga0207426_1000003 Ga0207426_10000031066 193
404 3300025302 Ga0207426_1000011 Ga0207426_100001199 193
405 3300025303 Ga0209051_1000095 Ga0209051_100009562 193
406 3300025303 Ga0209051_1008489 Ga0209051_10084896 193
407 3300025304 Ga0209257_1000901 Ga0209257_100090145 193
408 3300025321 Ga0207656_10097596 Ga0207656_100975962 193
409 3300025898 Ga0207692_10410013 Ga0207692_104100132 193
410 3300025904 Ga0207647_10194444 Ga0207647_101944442 193
411 3300025906 Ga0207699_10094032 Ga0207699_100940322 193
412 3300025907 Ga0207645_10051969 Ga0207645_100519692 193
413 3300025910 Ga0207684_10440066 Ga0207684_104400662 193
414 3300025913 Ga0207695_10000037 Ga0207695_1000003754 193
415 3300025914 Ga0207671_10000080 Ga0207671_1000008054 193
416 3300025914 Ga0207671_10799236 Ga0207671_107992361 193
417 3300025920 Ga0207649_10635530 Ga0207649_106355302 193
418 3300025924 Ga0207694_10780738 Ga0207694_107807382 193
419 3300025927 Ga0207687_10169323 Ga0207687_101693232 193
420 3300025928 Ga0207700_10142726 Ga0207700_101427262 193
421 3300025933 Ga0207706_10139904 Ga0207706_101399042 193
422 3300025937 Ga0207669_10055689 Ga0207669_100556892 193
423 3300025937 Ga0207669_10057885 Ga0207669_100578853 193
424 3300025938 Ga0207704_10048784 Ga0207704_100487842 193
425 3300025940 Ga0207691_10097929 Ga0207691_100979293 193
426 3300025945 Ga0207679_10113761 Ga0207679_101137612 193
427 3300025949 Ga0207667_10352167 Ga0207667_103521672 193
428 3300025960 Ga0207651_10124330 Ga0207651_101243302 193
429 3300025972 Ga0207668_10596404 Ga0207668_105964041 193
430 3300025981 Ga0207640_10238241 Ga0207640_102382412 193
431 3300025981 Ga0207640_10343172 Ga0207640_103431722 193
432 3300025986 Ga0207658_10077809 Ga0207658_100778092 193
433 3300026035 Ga0207703_10673005 Ga0207703_106730052 193
434 3300026041 Ga0207639_10054425 Ga0207639_100544252 193
435 3300026067 Ga0207678_10131820 Ga0207678_101318202 193
436 3300026078 Ga0207702_10012779 Ga0207702_100127792 193
437 3300026089 Ga0207648_10258361 Ga0207648_102583611 193
438 3300026116 Ga0207674_10003842 Ga0207674_100038422 193
439 3300027312 Ga0209371_1005586 Ga0209371_10055863 193
440 3300028379 Ga0268266_10018581 Ga0268266_100185818 193
441 3300028379 Ga0268266_10420040 Ga0268266_104200402 193
442 3300028379 Ga0268266_10436661 Ga0268266_104366612 193
443 3300028794 Ga0307515_10018154 Ga0307515_100181549 193
444 3300028794 Ga0307515_10029079 Ga0307515_100290792 193
445 3300028794 Ga0307515_10402094 Ga0307515_104020942 193
446 3300028794 Ga0307515_10439474 Ga0307515_104394742 193
447 3300030500 Ga0268256_1005982 Ga0268256_10059823 193
448 3300031090 Ga0265760_10071723 Ga0265760_100717231 193
449 3300031456 Ga0307513_10032990 Ga0307513_100329902 193
450 3300031616 Ga0307508_10174444 Ga0307508_101744442 193
451 3300035695 Ga0373927_0000139 Ga0373927_0000139_7140_7721 193
452 3300035695 Ga0373927_0165824 Ga0373927_0165824_625_1215 193
453 3300036401 Ga0373937_0371462 Ga0373937_0371462_296_922 193
454 3300037068 Ga0373925_0121508 Ga0373925_0121508_853_1455 193
455 3300037068 Ga0373925_0122694 Ga0373925_0122694_697_1278 193
456 3300039447 Ga0436361_0280631 Ga0436361_0280631_23_607 193
457 3300041413 Ga0439465_0012710 Ga0439465_0012710_45_626 193
458 3300041413 Ga0439465_0017670 Ga0439465_0017670_749_1330 193
459 3300041491 Ga0451833_0419462 Ga0451833_0419462_219_800 193
460 3300041501 Ga0451845_0688499 Ga0451845_0688499_154_735 193
461 3300041505 Ga0451849_1212919 Ga0451849_1212919_426_1007 193
462 3300041512 Ga0451853_3773653 Ga0451853_3773653_123_704 193
463 3300044683 Ga0466965_0468614 Ga0466965_0468614_71_673 193
464 3300044694 Ga0466963_0043848 Ga0466963_0043848_2233_2814 193
465 3300044765 Ga0466970_0071269 Ga0466970_0071269_261_896 193
466 3300045976 Ga0466967_0282573 Ga0466967_0282573_526_1110 193
467 3300046452 Ga0495617_074185 Ga0495617_074185_51_632 193
468 3300046454 Ga0495592_0583809 Ga0495592_0583809_77_658 193
469 3300046459 Ga0495629_0355048 Ga0495629_0355048_211_792 193
470 3300046460 Ga0495638_0000084 Ga0495638_0000084_92538_93119 193
471 3300046474 Ga0495605_0012679 Ga0495605_0012679_3047_3628 193
472 3300046476 Ga0495662_0037129 Ga0495662_0037129_538_1119 193
473 3300046492 Ga0495585_0150769 Ga0495585_0150769_552_1145 193
474 3300046492 Ga0495585_0171356 Ga0495585_0171356_228_809 193
475 3300046492 Ga0495585_0195617 Ga0495585_0195617_252_833 193
476 3300046501 Ga0495607_0338707 Ga0495607_0338707_60_641 193
477 3300046506 Ga0495583_0099381 Ga0495583_0099381_210_791 193
478 3300046507 Ga0495606_0001215 Ga0495606_0001215_1108_1689 193
479 3300046507 Ga0495606_0030826 Ga0495606_0030826_201_794 193
480 3300046507 Ga0495606_0381522 Ga0495606_0381522_43_624 193
481 3300046512 Ga0495610_0077864 Ga0495610_0077864_731_1312 193
482 3300046513 Ga0495616_0203874 Ga0495616_0203874_208_789 193
483 3300046513 Ga0495616_0252184 Ga0495616_0252184_107_688 193
484 3300046515 Ga0495620_0052866 Ga0495620_0052866_266_859 193
485 3300046515 Ga0495620_0053204 Ga0495620_0053204_53_634 193
486 3300046518 Ga0495631_0047398 Ga0495631_0047398_787_1368 193
487 3300046519 Ga0495632_0007421 Ga0495632_0007421_5251_5832 193
488 3300046519 Ga0495632_0082906 Ga0495632_0082906_303_896 193
489 3300046519 Ga0495632_0321587 Ga0495632_0321587_53_634 193
490 3300046522 Ga0495643_0008164 Ga0495643_0008164_2445_3038 193
491 3300046522 Ga0495643_0039329 Ga0495643_0039329_1642_2223 193
492 3300046524 Ga0495648_0103215 Ga0495648_0103215_52_633 193
493 3300046533 Ga0495640_0309870 Ga0495640_0309870_22_603 193
494 3300046538 Ga0495609_0259903 Ga0495609_0259903_121_702 193
495 3300046542 Ga0495597_0036970 Ga0495597_0036970_501_1094 193
496 3300046557 Ga0495622_0041598 Ga0495622_0041598_147_728 193
497 3300046558 Ga0495633_0012467 Ga0495633_0012467_3249_3842 193
498 3300046615 Ga0495656_0191534 Ga0495656_0191534_159_740 193
499 3300046616 Ga0495668_0054314 Ga0495668_0054314_483_1064 193
500 3300046660 Ga0495625_0021268 Ga0495625_0021268_1006_1587 193
501 3300046660 Ga0495625_0270614 Ga0495625_0270614_32_625 193
502 3300046674 Ga0495588_0008475 Ga0495588_0008475_778_1359 193
503 3300046674 Ga0495588_0141508 Ga0495588_0141508_230_823 193
504 3300046683 Ga0495658_0182452 Ga0495658_0182452_25_606 193
505 3300046691 Ga0495670_0124438 Ga0495670_0124438_568_1152 193
506 3300046694 Ga0495649_0096203 Ga0495649_0096203_375_956 193
507 3300046694 Ga0495649_0306063 Ga0495649_0306063_183_776 193
508 3300046809 Ga0495600_0222641 Ga0495600_0222641_502_1083 193
509 3300047317 Ga0495604_0067664 Ga0495604_0067664_621_1202 193
510 3300047318 Ga0495636_0109936 Ga0495636_0109936_571_1152 193
511 3300047320 Ga0495672_0061043 Ga0495672_0061043_1470_2051 193
512 3300047321 Ga0495676_0179694 Ga0495676_0179694_180_761 193
513 3300047443 Ga0495687_068150 Ga0495687_068150_15_596 193
514 3300047470 Ga0495681_0000810 Ga0495681_0000810_20423_21004 193
515 3300047472 Ga0495686_0000296 Ga0495686_0000296_26222_26803 193
516 3300047472 Ga0495686_0023821 Ga0495686_0023821_2624_3226 193
517 3300047472 Ga0495686_0057348 Ga0495686_0057348_941_1522 193
518 3300047472 Ga0495686_0225506 Ga0495686_0225506_456_1037 193
519 3300048903 Ga0496100_0514012 Ga0496100_0514012_215_796 193
520 3300048905 Ga0496102_0325201 Ga0496102_0325201_155_736 193
521 3300048909 Ga0496106_0003638 Ga0496106_0003638_10053_10634 193
522 3300048916 Ga0496113_0078879 Ga0496113_0078879_43_624 193
523 3300048919 Ga0496116_0012877 Ga0496116_0012877_1836_2417 193
524 3300048919 Ga0496116_0012878 Ga0496116_0012878_1836_2417 193
525 3300048919 Ga0496116_0023674 Ga0496116_0023674_363_944 193
526 3300048919 Ga0496116_0033119 Ga0496116_0033119_272_853 193
527 3300048920 Ga0496117_0002935 Ga0496117_0002935_8259_8849 193
528 3300048920 Ga0496117_0007065 Ga0496117_0007065_1084_1665 193
529 3300048920 Ga0496117_0272745 Ga0496117_0272745_117_698 193
530 3300048921 Ga0496118_0009924 Ga0496118_0009924_1204_1785 193
531 3300048921 Ga0496118_0010596 Ga0496118_0010596_265_846 193
532 3300048921 Ga0496118_0151712 Ga0496118_0151712_563_1144 193
533 3300048921 Ga0496118_0182928 Ga0496118_0182928_18_599 193
534 3300048922 Ga0496119_0011254 Ga0496119_0011254_964_1545 193
535 3300048922 Ga0496119_0041595 Ga0496119_0041595_240_821 193
536 3300048922 Ga0496119_0233727 Ga0496119_0233727_215_796 193
537 3300048923 Ga0496120_0005182 Ga0496120_0005182_999_1580 193
538 3300048924 Ga0496121_0014935 Ga0496121_0014935_6866_7468 193
539 3300048924 Ga0496121_0015473 Ga0496121_0015473_1075_1656 193
540 3300048924 Ga0496121_0019085 Ga0496121_0019085_963_1544 193
541 3300048924 Ga0496121_0072988 Ga0496121_0072988_1717_2298 193
542 3300048924 Ga0496121_0136795 Ga0496121_0136795_1096_1677 193
543 3300048925 Ga0496122_0004149 Ga0496122_0004149_2399_2989 193
544 3300048925 Ga0496122_0016413 Ga0496122_0016413_722_1303 193
545 3300048925 Ga0496122_0019733 Ga0496122_0019733_55_636 193
546 3300048925 Ga0496122_0019824 Ga0496122_0019824_3532_4113 193
547 3300048926 Ga0496123_0002119 Ga0496123_0002119_11925_12515 193
548 3300048926 Ga0496123_0013335 Ga0496123_0013335_5857_6438 193
549 3300048926 Ga0496123_0015360 Ga0496123_0015360_5360_5941 193
550 3300048926 Ga0496123_0108080 Ga0496123_0108080_116_697 193
551 3300048927 Ga0496124_0002110 Ga0496124_0002110_13488_14078 193
552 3300048927 Ga0496124_0010016 Ga0496124_0010016_2436_3017 193
553 3300048927 Ga0496124_0023187 Ga0496124_0023187_4390_4971 193
554 3300048927 Ga0496124_0084016 Ga0496124_0084016_408_989 193
555 3300048927 Ga0496124_0136851 Ga0496124_0136851_137_718 193
556 3300048928 Ga0496125_0002940 Ga0496125_0002940_10702_11283 193
557 3300048928 Ga0496125_0030906 Ga0496125_0030906_269_850 193
558 3300048928 Ga0496125_0079433 Ga0496125_0079433_382_963 193
559 3300048928 Ga0496125_0086003 Ga0496125_0086003_1738_2319 193
560 3300048928 Ga0496125_0220401 Ga0496125_0220401_420_1010 193
561 3300048929 Ga0496126_0002668 Ga0496126_0002668_9348_9938 193
562 3300048929 Ga0496126_0139694 Ga0496126_0139694_850_1440 193
563 3300048929 Ga0496126_0163553 Ga0496126_0163553_970_1551 193
564 3300048929 Ga0496126_0242009 Ga0496126_0242009_396_998 193
565 3300048929 Ga0496126_0246944 Ga0496126_0246944_195_779 193
566 3300048929 Ga0496126_0396505 Ga0496126_0396505_241_822 193
567 3300049460 Ga0495682_0085957 Ga0495682_0085957_344_925 193
568 3300049569 Ga0501032_0017901 Ga0501032_0017901_3856_4443 193
569 3300049569 Ga0501032_0046581 Ga0501032_0046581_1662_2264 193
570 3300049570 Ga0501033_0052991 Ga0501033_0052991_1868_2452 193
571 3300049570 Ga0501033_0112803 Ga0501033_0112803_673_1275 193
572 3300049570 Ga0501033_0153819 Ga0501033_0153819_491_1078 193
573 3300049570 Ga0501033_0177060 Ga0501033_0177060_803_1384 193
574 3300049571 Ga0501034_0015877 Ga0501034_0015877_3061_3648 193
575 3300049571 Ga0501034_0128682 Ga0501034_0128682_542_1144 193
576 3300049571 Ga0501034_0190146 Ga0501034_0190146_1065_1667 193
577 3300049571 Ga0501034_0318475 Ga0501034_0318475_301_903 193
578 3300049571 Ga0501034_0361133 Ga0501034_0361133_311_892 193
579 3300049571 Ga0501034_0662657 Ga0501034_0662657_118_699 193
580 3300049571 Ga0501034_0709881 Ga0501034_0709881_182_784 193
581 3300049572 Ga0501036_0222792 Ga0501036_0222792_888_1472 193
582 3300049574 Ga0501038_0013866 Ga0501038_0013866_300_902 193
583 3300049574 Ga0501038_0493790 Ga0501038_0493790_308_892 193
584 3300049575 Ga0501039_0100415 Ga0501039_0100415_571_1173 193
585 3300049575 Ga0501039_0123519 Ga0501039_0123519_1184_1771 193
586 3300049579 Ga0501043_0143781 Ga0501043_0143781_161_748 193
587 3300049580 Ga0501046_0269135 Ga0501046_0269135_60_641 193
588 3300049581 Ga0501047_0055854 Ga0501047_0055854_3223_3804 193
589 3300049581 Ga0501047_0064326 Ga0501047_0064326_685_1287 193
590 3300049581 Ga0501047_0336301 Ga0501047_0336301_293_874 193
591 3300049581 Ga0501047_0629654 Ga0501047_0629654_173_757 193
592 3300049592 Ga0501076_0752658 Ga0501076_0752658_67_648 193
593 3300049744 Ga0501083_0044073 Ga0501083_0044073_2103_2684 193
594 3300049822 Ga0501035_0557464 Ga0501035_0557464_141_743 193
595 3300049823 Ga0501044_0030308 Ga0501044_0030308_429_1031 193
596 3300049823 Ga0501044_0167310 Ga0501044_0167310_541_1125 193
597 3300049823 Ga0501044_1066895 Ga0501044_1066895_67_648 193
598 3300050490 nmdc:mga03n38_338619_c1 nmdc:mga03n38_338619_c1_62_655 193
599 3300050491 nmdc:mga00v17_259246_c1 nmdc:mga00v17_259246_c1_368_949 193
600 3300050491 nmdc:mga00v17_84797_c2 nmdc:mga00v17_84797_c2_132_734 193
601 3300050492 nmdc:mga0yw44_25923_c1 nmdc:mga0yw44_25923_c1_1012_1593 193
602 3300050493 nmdc:mga0k408_320021_c1 nmdc:mga0k408_320021_c1_249_851 193
603 3300050496 nmdc:mga07m45_279601_c1 nmdc:mga07m45_279601_c1_250_831 193
604 3300050516 nmdc:mga0sz30_77592_c1 nmdc:mga0sz30_77592_c1_415_996 193
605 3300053077 Ga0495601_0157412 Ga0495601_0157412_130_711 193
606 3300053079 Ga0500610_0122119 Ga0500610_0122119_479_1060 193
607 3300053086 Ga0500578_0095069 Ga0500578_0095069_291_884 193
608 3300053086 Ga0500578_0138278 Ga0500578_0138278_897_1478 193
609 3300053087 Ga0500643_004879 Ga0500643_004879_5100_5681 193
610 3300053088 Ga0500644_0025629 Ga0500644_0025629_319_900 193
611 3300053098 Ga0500650_0295560 Ga0500650_0295560_113_694 193
612 3300053107 Ga0500560_000445 Ga0500560_000445_3287_3868 193
613 3300053108 Ga0500562_058072 Ga0500562_058072_361_942 193
614 3300053122 Ga0500608_064631 Ga0500608_064631_926_1507 193
615 3300053122 Ga0500608_072153 Ga0500608_072153_907_1488 193
616 3300053122 Ga0500608_218109 Ga0500608_218109_13_594 193
617 3300053136 Ga0500559_0002335 Ga0500559_0002335_357_938 193
618 3300053136 Ga0500559_0202181 Ga0500559_0202181_161_742 193
619 3300053139 Ga0500568_0002316 Ga0500568_0002316_5584_6165 193
620 3300053139 Ga0500568_0002514 Ga0500568_0002514_10088_10669 193
621 3300053140 Ga0500573_0005124 Ga0500573_0005124_4713_5294 193
622 3300053148 Ga0500590_046899 Ga0500590_046899_131_712 193
623 3300053151 Ga0500604_0021173 Ga0500604_0021173_1165_1746 193
624 3300053153 Ga0500616_0000795 Ga0500616_0000795_24449_25030 193
625 3300053153 Ga0500616_0009177 Ga0500616_0009177_2363_2956 193
626 3300053153 Ga0500616_0025458 Ga0500616_0025458_2599_3180 193
627 3300053156 Ga0500622_0000178 Ga0500622_0000178_17287_17868 193
628 3300053156 Ga0500622_0001743 Ga0500622_0001743_15174_15755 193
629 3300053158 Ga0500627_0233090 Ga0500627_0233090_35_637 193
630 3300053160 Ga0500633_0032685 Ga0500633_0032685_116_697 193
631 3300053161 Ga0500634_0122967 Ga0500634_0122967_32_616 193
632 3300053736 Ga0500599_051279 Ga0500599_051279_60_641 193
633 3300061719 Ga0466962_0067305 Ga0466962_0067305_872_1453 193
634 iso_pu_bacteria 2958071322 2958072920 193
635 iso_pu_bacteria 8004633249 8004639874 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02525

Flavodoxin_2

Flavodoxin-like fold

26

215

0.89

PF03358

FMN_red

NADPH-dependent FMN reductase

26

165

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r81-assembly3.cif.gz_C-2 nad(p)h:quinone oxidoreductase from methanothermobacter marburgensis 0.8553 1 191
4f8y-assembly2.cif.gz_D complex structure of nadph:quinone oxidoreductase with menadione in streptococcus mutans 0.8492 1 193
4f8y-assembly2.cif.gz_D complex structure of nadph:quinone oxidoreductase with menadione in streptococcus mutans 0.845 1 193
5lbz-assembly1.cif.gz_A structure of the human quinone reductase 2 (nqo2) in complex with pacritinib 0.8436 1 191
4r81-assembly3.cif.gz_C-2 nad(p)h:quinone oxidoreductase from methanothermobacter marburgensis 0.843 1 191
ID Description Score Start End Superfamily
4r81C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8553 1 191 3.40.50.360
3lcmC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8484 1 190 3.40.50.360
4r81C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.843 1 191 3.40.50.360
5lbtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8295 2 191 3.40.50.360
5lbtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8136 2 191 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A5C7SBY1-F1-model_v4 Flavodoxin family protein 1.002 1 193 GO:0003955
GO:0005829
AF-A0A1H6GRX0-F1-model_v4 Putative NADPH-quinone reductase (Modulator of drug activity B) 0.998 1 193 GO:0003955
GO:0005829
AF-A0A530ZPV5-F1-model_v4 Flavodoxin family protein 0.998 1 106 GO:0003955
GO:0005829
AF-A0A1Q9A5S3-F1-model_v4 NAD(P)H dehydrogenase 0.9974 1 193 GO:0003955
GO:0005829
AF-A0A1M5J962-F1-model_v4 Putative NADPH-quinone reductase (Modulator of drug activity B) 0.9956 1 193 GO:0003955
GO:0005829

Feature Viewer

pLDDT pTM Quality
96.53 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map