F471258

General Info

Members Datasets Scaffolds Average Seq Length
635 293 588 215

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10018442|Ga0163162_100184425
Length 260
Sequence MHHEFSVAFMAQCPCASFMPANLAGIFLSDARRSLRGAQRGTYPAMTRVLISDDHTLVRDGLRHILDSADGIEVAGEASDGATTIAMIREIPADVLVLDLSMPGRNGVELLKQIKDEKPALRVLILTMHAEQQYAVRAFKAGASGYLTKESASAELVAAVNKLASGGVYVSLAMAERLALSLYERGDDLPHQRLSDREFEVFRRIAGGETITQIAQALSVSAKTISTYKTRILDKMQMPHDAALVRYAVRQKLFEDDHET

Samples

Sample ID Description Type Environment
1 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
2 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
5 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
6 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
7 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
8 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
9 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
10 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
11 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
12 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
13 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
14 2818991450 Burkholderia sp. 604 Isolate Unclassified
15 2818991452 Burkholderia cepacia 561 Isolate Unclassified
16 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
17 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
18 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
19 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
20 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
21 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
22 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
23 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
24 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
25 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
26 2928170801 Burkholderia sp. 572 Isolate Unclassified
27 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
28 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
41 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
42 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
43 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
96 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
269 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
284 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
285 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
286 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
287 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
288 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
289 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
290 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
291 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
292 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
293 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.65
Metatranscriptomes 1.1
Isolates 7.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.83
Nodule 1.89
Rhizoplane 6.14
Rhizosphere 78.27
Stem 0
Stem Tuber 0
Unclassified 7.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10012722 3300001989 Bacteria 3085
2 JGI24739J22299_10026164 3300001989 Bacteria 2049
3 JGI24739J22299_10031933 3300001989 Bacteria 1816
4 JGI24737J22298_10032965 3300001990 Bacteria 1611
5 JGI24735J21928_10006689 3300002067 Bacteria 3784
6 JGI24735J21928_10009537 3300002067 Bacteria 3113
7 JGI24735J21928_10019398 3300002067 Bacteria 2090
8 JGI25156J39149_1000356 3300002705 Bacteria 29641
9 JGI25156J39149_1000856 3300002705 Bacteria 15160
10 JGI25151J46595_10010761 3300003187 Bacteria 4233
11 JGI25165J46597_1001118 3300003214 Bacteria 16924
12 rootH2_10005359 3300003320 Bacteria 12606
13 rootH2_10108596 3300003320 Bacteria 10417
14 rootL2_10003788 3300003322 Bacteria 5631
15 rootH1_10076393 3300003323 Bacteria 2762
16 rootH1_10089848 3300003323 Bacteria 4992
17 rootH1_10221373 3300003323 Bacteria 1877
18 JGI25160J50197_1024162 3300003354 Bacteria 1731
19 Ga0055533_1000072 3300003756 Bacteria 144571
20 Ga0055532_1000013 3300003758 Bacteria 380677
21 Ga0055532_1000434 3300003758 Bacteria 19777
22 Ga0055527_1000010 3300003760 Bacteria 380677
23 Ga0055527_1000153 3300003760 Bacteria 48693
24 Ga0055535_1000010 3300003761 Bacteria 380677
25 Ga0055535_1000316 3300003761 Bacteria 48693
26 Ga0055542_1000016 3300003762 Bacteria 380677
27 Ga0055542_1001996 3300003762 Bacteria 7873
28 Ga0055529_1000012 3300003763 Bacteria 380677
29 Ga0055526_1024025 3300003771 Bacteria 2010
30 Ga0065165_1000040 3300005262 Bacteria 205767
31 Ga0065712_10186121 3300005290 Bacteria 1169
32 Ga0070658_10021856 3300005327 Bacteria 5129
33 Ga0070670_100089804 3300005331 Bacteria 2641
34 Ga0070660_100036558 3300005339 Bacteria 3720
35 Ga0070660_100658236 3300005339 Bacteria 877
36 Ga0070689_100362370 3300005340 Bacteria 1218
37 Ga0070689_100819759 3300005340 Bacteria 819
38 Ga0070661_100178432 3300005344 Bacteria 1615
39 Ga0070668_100005466 3300005347 Bacteria 9432
40 Ga0070675_100078523 3300005354 Bacteria 2749
41 Ga0070673_100099144 3300005364 Bacteria 2396
42 Ga0070659_100028345 3300005366 Bacteria 4323
43 Ga0070667_100161251 3300005367 Bacteria 1975
44 Ga0070714_100012222 3300005435 Bacteria 6847
45 Ga0070663_100237218 3300005455 Bacteria 1438
46 Ga0070662_100189570 3300005457 Unclassified 1625
47 Ga0070662_100736792 3300005457 Bacteria 835
48 Ga0070706_100766031 3300005467 Bacteria 894
49 Ga0070698_100048197 3300005471 Bacteria 4354
50 Ga0070697_100135410 3300005536 Bacteria 2068
51 Ga0070697_100919077 3300005536 Bacteria 777
52 Ga0068853_100052639 3300005539 Bacteria 3506
53 Ga0070696_100316191 3300005546 Bacteria 1200
54 Ga0070665_100026850 3300005548 Bacteria 5800
55 Ga0070665_100226472 3300005548 Bacteria 1870
56 Ga0068855_100149587 3300005563 Bacteria 2655
57 Ga0068856_100432149 3300005614 Bacteria 1337
58 Ga0068864_100343969 3300005618 Bacteria 1406
59 Ga0068858_100077335 3300005842 Bacteria 3091
60 Ga0068858_100857952 3300005842 Bacteria 887
61 Ga0070717_10560174 3300006028 Bacteria 1035
62 Ga0070716_100422458 3300006173 Bacteria 964
63 Ga0097621_100004366 3300006237 Bacteria 9833
64 Ga0075434_100110110 3300006871 Bacteria 2765
65 Ga0068865_100445146 3300006881 Bacteria 1070
66 Ga0075436_100064402 3300006914 Bacteria 2534
67 Ga0105251_10000069 3300009011 Bacteria 98334
68 Ga0105251_10005574 3300009011 Bacteria 8191
69 Ga0105251_10049052 3300009011 Bacteria 2023
70 Ga0105250_10093739 3300009092 Bacteria 1223
71 Ga0105240_10017557 3300009093 Bacteria 9640
72 Ga0105240_10034713 3300009093 Bacteria 6503
73 Ga0105240_10096577 3300009093 Bacteria 3601
74 Ga0105240_10121287 3300009093 Bacteria 3147
75 Ga0105240_10163508 3300009093 Bacteria 2641
76 Ga0105240_10200084 3300009093 Bacteria 2342
77 Ga0105240_10218952 3300009093 Bacteria 2219
78 Ga0105240_10701677 3300009093 Bacteria 1104
79 Ga0105241_10789944 3300009174 Unclassified 874
80 Ga0105242_10007665 3300009176 Bacteria 8307
81 Ga0105248_10231170 3300009177 Bacteria 2082
82 Ga0105237_10297839 3300009545 Bacteria 1616
83 Ga0105238_10003214 3300009551 Bacteria 16317
84 Ga0105238_10008459 3300009551 Bacteria 10303
85 Ga0105238_10421317 3300009551 Bacteria 1330
86 Ga0157371_10074243 3300013102 Bacteria 2409
87 Ga0157370_10003155 3300013104 Bacteria 19532
88 Ga0157370_10014496 3300013104 Bacteria 8057
89 Ga0157370_10194965 3300013104 Bacteria 1880
90 Ga0157370_10332212 3300013104 Bacteria 1401
91 Ga0157369_10000145 3300013105 Bacteria 100895
92 Ga0157369_10000293 3300013105 Bacteria 66670
93 Ga0157369_10051315 3300013105 Bacteria 4464
94 Ga0157369_10076466 3300013105 Bacteria 3588
95 Ga0157369_10159418 3300013105 Bacteria 2382
96 Ga0157374_10726532 3300013296 Bacteria 1007
97 Ga0163162_10018442 3300013306 Bacteria 6838
98 Ga0163162_10375633 3300013306 Bacteria 1554
99 Ga0157380_10250481 3300014326 Bacteria 1603
100 Ga0157380_10469252 3300014326 Bacteria 1214
101 Ga0157376_10254357 3300014969 Bacteria 1642
102 Ga0182007_10002791 3300015262 Bacteria 8509
103 Ga0197907_10509736 3300020069 Bacteria 2233
104 Ga0206356_11033659 3300020070 Bacteria 1415
105 Ga0206355_1458904 3300020076 Bacteria 1533
106 Ga0206350_10742459 3300020080 Bacteria 1931
107 Ga0206354_11125356 3300020081 Bacteria 2927
108 Ga0206353_10180509 3300020082 Bacteria 2692
109 Ga0224712_10000027 3300022467 Bacteria 22074
110 Ga0209674_100011 3300025226 Bacteria 997175
111 Ga0209674_102961 3300025226 Bacteria 3326
112 Ga0209672_100002 3300025228 Bacteria 1733325
113 Ga0209672_100012 3300025228 Bacteria 795742
114 Ga0209147_100003 3300025229 Bacteria 1733325
115 Ga0209147_100007 3300025229 Bacteria 795684
116 Ga0209563_100990 3300025230 Bacteria 8331
117 Ga0207427_103698 3300025231 Bacteria 3013
118 Ga0209258_100014 3300025242 Bacteria 720132
119 Ga0209258_100042 3300025242 Bacteria 380729
120 Ga0209148_1000006 3300025254 Bacteria 1733325
121 Ga0209148_1000287 3300025254 Bacteria 75762
122 Ga0209759_1000028 3300025256 Bacteria 298755
123 Ga0209759_1000051 3300025256 Bacteria 214016
124 Ga0209233_1000033 3300025261 Bacteria 596094
125 Ga0209455_1000003 3300025272 Bacteria 1471893
126 Ga0209455_1000664 3300025272 Bacteria 20829
127 Ga0209455_1000720 3300025272 Bacteria 19165
128 Ga0209130_1004156 3300025284 Bacteria 5672
129 Ga0209025_1001263 3300025294 Bacteria 34922
130 Ga0209025_1002150 3300025294 Bacteria 22035
131 Ga0209564_1008013 3300025295 Bacteria 5303
132 Ga0207426_1000004 3300025302 Bacteria 1047900
133 Ga0207426_1002029 3300025302 Bacteria 14200
134 Ga0207696_1055691 3300025711 Bacteria 1121
135 Ga0207713_1001033 3300025735 Bacteria 24198
136 Ga0207713_1024904 3300025735 Bacteria 2776
137 Ga0207647_10024398 3300025904 Bacteria 3987
138 Ga0207647_10063461 3300025904 Bacteria 2246
139 Ga0207705_10005089 3300025909 Bacteria 9856
140 Ga0207695_10017601 3300025913 Bacteria 8305
141 Ga0207695_10225491 3300025913 Bacteria 1780
142 Ga0207695_10251676 3300025913 Bacteria 1666
143 Ga0207657_10195860 3300025919 Bacteria 1628
144 Ga0207694_10018489 3300025924 Bacteria 5267
145 Ga0207694_10242101 3300025924 Bacteria 1474
146 Ga0207694_10368702 3300025924 Bacteria 1191
147 Ga0207694_10409052 3300025924 Bacteria 1129
148 Ga0207650_10096584 3300025925 Bacteria 2267
149 Ga0207659_10061563 3300025926 Bacteria 2705
150 Ga0207664_10190855 3300025929 Bacteria 1763
151 Ga0207690_10010816 3300025932 Bacteria 5437
152 Ga0207706_10083641 3300025933 Unclassified 2806
153 Ga0207706_10707761 3300025933 Bacteria 860
154 Ga0207686_10012545 3300025934 Bacteria 4661
155 Ga0207709_10620641 3300025935 Bacteria 858
156 Ga0207704_10115259 3300025938 Bacteria 1826
157 Ga0207691_10175879 3300025940 Bacteria 1872
158 Ga0207711_10292136 3300025941 Bacteria 1502
159 Ga0207667_10006817 3300025949 Bacteria 13803
160 Ga0207668_10020162 3300025972 Bacteria 4230
161 Ga0207658_10242497 3300025986 Bacteria 1528
162 Ga0207703_10167636 3300026035 Bacteria 1929
163 Ga0207639_10000006 3300026041 Bacteria 544415
164 Ga0207639_10911050 3300026041 Bacteria 822
165 Ga0207702_10565599 3300026078 Bacteria 1113
166 Ga0207648_10223395 3300026089 Bacteria 1674
167 Ga0207676_10258049 3300026095 Bacteria 1572
168 Ga0268266_10018312 3300028379 Bacteria 5970
169 Ga0265319_1029842 3300028563 Bacteria 1912
170 Ga0307515_10078871 3300028794 Bacteria 4323
171 Ga0265338_10000159 3300028800 Bacteria 123495
172 Ga0265338_10003994 3300028800 Bacteria 20275
173 Ga0265342_10104752 3300031712 Bacteria 1607
174 Ga0373932_0000074 3300035112 Bacteria 25250
175 Ga0373932_0000318 3300035112 Bacteria 14684
176 Ga0373953_0054236 3300035117 Bacteria 1626
177 Ga0373933_0217228 3300035724 Bacteria 1226
178 Ga0373937_0037938 3300036401 Bacteria 4391
179 Ga0373925_0538364 3300037068 Bacteria 960
180 Ga0395899_0000005 3300037312 Bacteria 772966
181 Ga0395899_0133072 3300037312 Bacteria 1774
182 Ga0395900_0000003 3300037418 Bacteria 587648
183 Ga0395900_0000053 3300037418 Bacteria 221135
184 Ga0395900_0001448 3300037418 Bacteria 28301
185 Ga0395900_0012574 3300037418 Bacteria 8662
186 Ga0395900_0048919 3300037418 Bacteria 4354
187 Ga0395900_0071313 3300037418 Bacteria 3571
188 Ga0395900_0072560 3300037418 Bacteria 3539
189 Ga0395900_0101776 3300037418 Bacteria 2951
190 Ga0395898_0000003 3300037466 Bacteria 772986
191 Ga0395898_0001273 3300037466 Bacteria 37246
192 Ga0395898_0071913 3300037466 Bacteria 3342
193 Ga0395898_0186246 3300037466 Bacteria 1983
194 Ga0395905_0000035 3300037471 Bacteria 272014
195 Ga0395901_0000004 3300038443 Bacteria 657361
196 Ga0395901_0000042 3300038443 Bacteria 201819
197 Ga0395901_0000130 3300038443 Bacteria 97728
198 Ga0395901_0036096 3300038443 Bacteria 5107
199 Ga0395901_0608523 3300038443 Bacteria 1101
200 Ga0451577_0122113 3300042876 Bacteria 2334
201 Ga0466969_0001183 3300044656 Bacteria 14087
202 Ga0466969_0004417 3300044656 Bacteria 7479
203 Ga0466973_0008737 3300044659 Bacteria 9211
204 Ga0466965_0020294 3300044683 Bacteria 3193
205 Ga0466965_0048170 3300044683 Bacteria 2111
206 Ga0466966_0000029 3300044684 Bacteria 104527
207 Ga0466966_0004888 3300044684 Bacteria 8806
208 Ga0466966_0017051 3300044684 Bacteria 4803
209 Ga0466966_0051786 3300044684 Bacteria 2609
210 Ga0466961_0001351 3300044693 Bacteria 15111
211 Ga0466961_0003113 3300044693 Bacteria 10330
212 Ga0466961_0011759 3300044693 Bacteria 5593
213 Ga0466961_0022028 3300044693 Bacteria 4101
214 Ga0466961_0057733 3300044693 Bacteria 2470
215 Ga0466961_0180873 3300044693 Bacteria 1309
216 Ga0466963_0000211 3300044694 Bacteria 24901
217 Ga0466963_0000725 3300044694 Bacteria 16157
218 Ga0466963_0009541 3300044694 Bacteria 5845
219 Ga0466963_0019497 3300044694 Bacteria 4256
220 Ga0466964_0041026 3300044706 Bacteria 1870
221 Ga0466971_0003180 3300044719 Bacteria 7007
222 Ga0466971_0018269 3300044719 Bacteria 3105
223 Ga0466971_0021399 3300044719 Bacteria 2878
224 Ga0466971_0166041 3300044719 Bacteria 1034
225 Ga0466968_0016888 3300044735 Bacteria 2910
226 Ga0466970_0019110 3300044765 Bacteria 3551
227 Ga0466970_0052199 3300044765 Bacteria 2182
228 Ga0466957_0015354 3300044842 Bacteria 4473
229 Ga0466957_0016207 3300044842 Bacteria 4358
230 Ga0466957_0034079 3300044842 Bacteria 3055
231 Ga0466957_0037843 3300044842 Bacteria 2905
232 Ga0466957_0337906 3300044842 Bacteria 1019
233 Ga0466959_0015408 3300045049 Bacteria 5568
234 Ga0466959_0355426 3300045049 Bacteria 998
235 Ga0466958_0012260 3300045836 Bacteria 4852
236 Ga0466958_0048288 3300045836 Bacteria 2572
237 Ga0466958_0053025 3300045836 Bacteria 2459
238 Ga0495592_0065657 3300046454 Bacteria 2656
239 Ga0495592_0200674 3300046454 Bacteria 1346
240 Ga0495603_0002093 3300046455 Bacteria 11739
241 Ga0495603_0047427 3300046455 Bacteria 2558
242 Ga0495603_0084085 3300046455 Bacteria 1863
243 Ga0495590_0007124 3300046457 Bacteria 4327
244 Ga0495590_0073213 3300046457 Bacteria 1204
245 Ga0495629_0000224 3300046459 Bacteria 50510
246 Ga0495629_0000249 3300046459 Bacteria 46689
247 Ga0495629_0001627 3300046459 Bacteria 17647
248 Ga0495629_0001671 3300046459 Bacteria 17413
249 Ga0495629_0001695 3300046459 Bacteria 17311
250 Ga0495629_0010138 3300046459 Bacteria 6872
251 Ga0495629_0038919 3300046459 Bacteria 3348
252 Ga0495629_0165957 3300046459 Bacteria 1533
253 Ga0495641_0023325 3300046461 Bacteria 3077
254 Ga0495641_0118837 3300046461 Bacteria 1179
255 Ga0495651_0094787 3300046462 Bacteria 2233
256 Ga0495651_0103105 3300046462 Bacteria 2120
257 Ga0495651_0103184 3300046462 Bacteria 2119
258 Ga0495651_0350213 3300046462 Bacteria 976
259 Ga0495651_0424151 3300046462 Bacteria 864
260 Ga0495653_0000942 3300046463 Bacteria 22393
261 Ga0495653_0001591 3300046463 Bacteria 17839
262 Ga0495653_0001903 3300046463 Bacteria 16451
263 Ga0495653_0005724 3300046463 Bacteria 10161
264 Ga0495653_0021842 3300046463 Bacteria 5179
265 Ga0495653_0028865 3300046463 Bacteria 4435
266 Ga0495653_0052357 3300046463 Bacteria 3128
267 Ga0495653_0053827 3300046463 Bacteria 3078
268 Ga0495653_0098115 3300046463 Bacteria 2128
269 Ga0495653_0141106 3300046463 Bacteria 1694
270 Ga0495650_0001852 3300046471 Bacteria 18928
271 Ga0495650_0003687 3300046471 Bacteria 10978
272 Ga0495580_0000355 3300046472 Bacteria 37382
273 Ga0495580_0001105 3300046472 Bacteria 23679
274 Ga0495580_0002219 3300046472 Bacteria 16996
275 Ga0495580_0002335 3300046472 Bacteria 16559
276 Ga0495580_0011077 3300046472 Bacteria 6989
277 Ga0495580_0042306 3300046472 Bacteria 3246
278 Ga0495580_0131331 3300046472 Bacteria 1737
279 Ga0495580_0215990 3300046472 Bacteria 1318
280 Ga0495580_0372097 3300046472 Bacteria 966
281 Ga0495582_0004443 3300046473 Bacteria 7889
282 Ga0495582_0005945 3300046473 Bacteria 6805
283 Ga0495582_0057919 3300046473 Bacteria 2136
284 Ga0495582_0060879 3300046473 Bacteria 2083
285 Ga0495582_0210040 3300046473 Bacteria 1112
286 Ga0495605_0022344 3300046474 Bacteria 3342
287 Ga0495605_0058470 3300046474 Bacteria 1853
288 Ga0495605_0058847 3300046474 Bacteria 1846
289 Ga0495639_0143893 3300046475 Bacteria 1147
290 Ga0495662_0029085 3300046476 Bacteria 2668
291 Ga0495662_0101983 3300046476 Bacteria 1404
292 Ga0495664_0001056 3300046477 Bacteria 14231
293 Ga0495664_0001152 3300046477 Bacteria 13732
294 Ga0495664_0012627 3300046477 Bacteria 4786
295 Ga0495664_0043690 3300046477 Bacteria 2655
296 Ga0495664_0134400 3300046477 Bacteria 1498
297 Ga0495596_0023148 3300046500 Bacteria 2522
298 Ga0495607_0065134 3300046501 Bacteria 2056
299 Ga0495583_0002761 3300046506 Bacteria 14497
300 Ga0495583_0037118 3300046506 Bacteria 2312
301 Ga0495606_0045942 3300046507 Bacteria 2890
302 Ga0495608_0004535 3300046511 Bacteria 9923
303 Ga0495610_0002901 3300046512 Bacteria 13874
304 Ga0495616_0048759 3300046513 Bacteria 2126
305 Ga0495616_0094322 3300046513 Bacteria 1412
306 Ga0495618_0005997 3300046514 Bacteria 7384
307 Ga0495618_0040229 3300046514 Bacteria 2941
308 Ga0495618_0054741 3300046514 Bacteria 2525
309 Ga0495620_0021272 3300046515 Bacteria 3152
310 Ga0495628_0000239 3300046516 Bacteria 48349
311 Ga0495628_0009868 3300046516 Bacteria 8133
312 Ga0495628_0014304 3300046516 Bacteria 6657
313 Ga0495628_0014998 3300046516 Bacteria 6475
314 Ga0495628_0026057 3300046516 Bacteria 4773
315 Ga0495628_0041436 3300046516 Bacteria 3676
316 Ga0495628_0066259 3300046516 Bacteria 2823
317 Ga0495628_0085025 3300046516 Bacteria 2454
318 Ga0495628_0093641 3300046516 Bacteria 2323
319 Ga0495628_0331982 3300046516 Bacteria 1120
320 Ga0495630_0009125 3300046517 Bacteria 7133
321 Ga0495630_0012843 3300046517 Bacteria 6087
322 Ga0495630_0014371 3300046517 Bacteria 5767
323 Ga0495630_0043128 3300046517 Bacteria 3369
324 Ga0495630_0050641 3300046517 Bacteria 3108
325 Ga0495630_0057170 3300046517 Bacteria 2923
326 Ga0495643_0036642 3300046522 Bacteria 2694
327 Ga0495648_0002596 3300046524 Bacteria 16534
328 Ga0495648_0009339 3300046524 Bacteria 7618
329 Ga0495648_0018361 3300046524 Bacteria 4952
330 Ga0495666_0002176 3300046526 Bacteria 9753
331 Ga0495666_0004470 3300046526 Bacteria 7065
332 Ga0495666_0005695 3300046526 Bacteria 6281
333 Ga0495666_0006738 3300046526 Bacteria 5776
334 Ga0495642_0069287 3300046528 Bacteria 1473
335 Ga0495642_0202616 3300046528 Bacteria 865
336 Ga0495652_0021043 3300046529 Bacteria 5798
337 Ga0495652_0031882 3300046529 Bacteria 4612
338 Ga0495652_0043233 3300046529 Bacteria 3882
339 Ga0495652_0148059 3300046529 Bacteria 1838
340 Ga0495652_0390646 3300046529 Bacteria 987
341 Ga0495652_0458204 3300046529 Bacteria 891
342 Ga0495665_0000183 3300046531 Bacteria 31950
343 Ga0495665_0004733 3300046531 Bacteria 7349
344 Ga0495665_0007911 3300046531 Bacteria 5761
345 Ga0495665_0011506 3300046531 Bacteria 4790
346 Ga0495665_0031381 3300046531 Bacteria 2844
347 Ga0495665_0110109 3300046531 Bacteria 1444
348 Ga0495665_0255698 3300046531 Bacteria 901
349 Ga0495665_0319800 3300046531 Bacteria 792
350 Ga0495640_0189870 3300046533 Bacteria 1306
351 Ga0495640_0404861 3300046533 Bacteria 837
352 Ga0495586_0009019 3300046535 Bacteria 5305
353 Ga0495586_0030326 3300046535 Bacteria 2894
354 Ga0495586_0138721 3300046535 Bacteria 1364
355 Ga0495586_0359169 3300046535 Bacteria 837
356 Ga0495587_0001594 3300046536 Bacteria 15112
357 Ga0495609_0056925 3300046538 Bacteria 1732
358 Ga0495597_0039318 3300046542 Bacteria 2118
359 Ga0495645_0000899 3300046543 Bacteria 20250
360 Ga0495645_0001599 3300046543 Bacteria 15330
361 Ga0495645_0009829 3300046543 Bacteria 6692
362 Ga0495645_0051526 3300046543 Bacteria 2995
363 Ga0495645_0059668 3300046543 Bacteria 2765
364 Ga0495645_0382110 3300046543 Bacteria 901
365 Ga0495622_0000022 3300046557 Bacteria 161180
366 Ga0495667_0025442 3300046559 Bacteria 3988
367 Ga0495667_0225013 3300046559 Bacteria 1197
368 Ga0495634_0017905 3300046642 Bacteria 5049
369 Ga0495634_0030366 3300046642 Bacteria 3732
370 Ga0495634_0105391 3300046642 Bacteria 1818
371 Ga0495611_0014391 3300046648 Bacteria 3379
372 Ga0495625_0150830 3300046660 Bacteria 1563
373 Ga0495625_0180373 3300046660 Bacteria 1405
374 Ga0495625_0494241 3300046660 Bacteria 749
375 Ga0495635_0000808 3300046663 Bacteria 20488
376 Ga0495635_0002163 3300046663 Bacteria 13350
377 Ga0495635_0003916 3300046663 Bacteria 10349
378 Ga0495635_0012987 3300046663 Bacteria 5830
379 Ga0495661_0029761 3300046665 Bacteria 3482
380 Ga0495588_0120789 3300046674 Bacteria 1381
381 Ga0495588_0297683 3300046674 Bacteria 849
382 Ga0495657_0006631 3300046675 Bacteria 9042
383 Ga0495599_0003822 3300046678 Bacteria 8843
384 Ga0495599_0005137 3300046678 Bacteria 7799
385 Ga0495599_0044124 3300046678 Bacteria 2797
386 Ga0495599_0059666 3300046678 Bacteria 2386
387 Ga0495599_0114953 3300046678 Bacteria 1674
388 Ga0495623_0000736 3300046679 Bacteria 21957
389 Ga0495623_0002295 3300046679 Bacteria 12744
390 Ga0495623_0002630 3300046679 Bacteria 11848
391 Ga0495623_0006339 3300046679 Bacteria 7689
392 Ga0495623_0078842 3300046679 Bacteria 2041
393 Ga0495623_0196215 3300046679 Bacteria 1163
394 Ga0495646_0000952 3300046680 Bacteria 16519
395 Ga0495646_0001837 3300046680 Bacteria 12754
396 Ga0495646_0004629 3300046680 Bacteria 8657
397 Ga0495646_0005306 3300046680 Bacteria 8137
398 Ga0495646_0011233 3300046680 Bacteria 5686
399 Ga0495646_0055330 3300046680 Bacteria 2383
400 Ga0495646_0078843 3300046680 Bacteria 1924
401 Ga0495647_0067083 3300046681 Bacteria 1428
402 Ga0495669_0074780 3300046684 Bacteria 1549
403 Ga0495613_0010901 3300046689 Bacteria 6749
404 Ga0495613_0030037 3300046689 Bacteria 4037
405 Ga0495613_0055461 3300046689 Bacteria 2912
406 Ga0495624_0000059 3300046690 Bacteria 70115
407 Ga0495624_0000062 3300046690 Bacteria 67917
408 Ga0495624_0000471 3300046690 Bacteria 31497
409 Ga0495624_0003825 3300046690 Bacteria 11126
410 Ga0495624_0015100 3300046690 Bacteria 5225
411 Ga0495624_0067674 3300046690 Bacteria 2227
412 Ga0495624_0071563 3300046690 Bacteria 2157
413 Ga0495624_0197765 3300046690 Bacteria 1222
414 Ga0495671_0122403 3300046692 Bacteria 1269
415 Ga0495649_0019755 3300046694 Bacteria 3783
416 Ga0495649_0091398 3300046694 Bacteria 1622
417 Ga0495649_0132237 3300046694 Bacteria 1316
418 Ga0495589_0017177 3300046794 Bacteria 3715
419 Ga0495589_0024409 3300046794 Bacteria 3073
420 Ga0495589_0199734 3300046794 Bacteria 944
421 Ga0495600_0000367 3300046809 Bacteria 23668
422 Ga0495600_0000851 3300046809 Bacteria 16267
423 Ga0495600_0027629 3300046809 Bacteria 3667
424 Ga0495600_0031310 3300046809 Bacteria 3446
425 Ga0495600_0068240 3300046809 Bacteria 2324
426 Ga0495600_0363358 3300046809 Bacteria 905
427 Ga0495581_0027177 3300047315 Bacteria 3318
428 Ga0495581_0046679 3300047315 Bacteria 2503
429 Ga0495604_0000600 3300047317 Bacteria 31084
430 Ga0495604_0003227 3300047317 Bacteria 13038
431 Ga0495604_0043220 3300047317 Bacteria 3529
432 Ga0495604_0052308 3300047317 Bacteria 3164
433 Ga0495604_0070467 3300047317 Bacteria 2647
434 Ga0495604_0095892 3300047317 Bacteria 2190
435 Ga0495674_0000180 3300047319 Bacteria 49901
436 Ga0495674_0010758 3300047319 Bacteria 8654
437 Ga0495674_0014155 3300047319 Bacteria 7472
438 Ga0495674_0018159 3300047319 Bacteria 6547
439 Ga0495674_0027686 3300047319 Bacteria 5176
440 Ga0495674_0035900 3300047319 Bacteria 4468
441 Ga0495674_0042527 3300047319 Bacteria 4051
442 Ga0495674_0046132 3300047319 Bacteria 3868
443 Ga0495674_0051948 3300047319 Bacteria 3611
444 Ga0495674_0057137 3300047319 Bacteria 3415
445 Ga0495674_0074799 3300047319 Bacteria 2916
446 Ga0495674_0114257 3300047319 Bacteria 2286
447 Ga0495674_0171118 3300047319 Bacteria 1812
448 Ga0495674_0180777 3300047319 Bacteria 1756
449 Ga0495674_0461849 3300047319 Bacteria 1019
450 Ga0495672_0001083 3300047320 Bacteria 27678
451 Ga0495672_0034396 3300047320 Bacteria 3131
452 Ga0495672_0045383 3300047320 Bacteria 2629
453 Ga0495672_0064763 3300047320 Bacteria 2091
454 Ga0495672_0067791 3300047320 Bacteria 2031
455 Ga0495676_0033814 3300047321 Bacteria 4297
456 Ga0495676_0072679 3300047321 Bacteria 2640
457 Ga0495680_0002137 3300047322 Bacteria 20525
458 Ga0495680_0002605 3300047322 Bacteria 18345
459 Ga0495680_0019384 3300047322 Bacteria 5741
460 Ga0495680_0076643 3300047322 Bacteria 2535
461 Ga0495680_0083084 3300047322 Bacteria 2415
462 Ga0495683_0008827 3300047323 Bacteria 5376
463 Ga0495683_0016086 3300047323 Bacteria 3884
464 Ga0495683_0054521 3300047323 Bacteria 1992
465 Ga0495683_0072886 3300047323 Bacteria 1684
466 Ga0495683_0088942 3300047323 Bacteria 1498
467 Ga0495687_035325 3300047443 Bacteria 2248
468 Ga0495687_119178 3300047443 Bacteria 955
469 Ga0495675_0005440 3300047444 Bacteria 7767
470 Ga0495675_0011811 3300047444 Bacteria 5486
471 Ga0495675_0026476 3300047444 Bacteria 3698
472 Ga0495675_0044820 3300047444 Bacteria 2817
473 Ga0495675_0054610 3300047444 Bacteria 2534
474 Ga0495675_0064299 3300047444 Bacteria 2321
475 Ga0495675_0122618 3300047444 Unclassified 1618
476 Ga0495675_0167352 3300047444 Bacteria 1351
477 Ga0495679_002634 3300047446 Bacteria 9011
478 Ga0495673_0017387 3300047469 Bacteria 3655
479 Ga0495673_0028169 3300047469 Bacteria 2663
480 Ga0495673_0067250 3300047469 Bacteria 1517
481 Ga0495673_0086757 3300047469 Bacteria 1286
482 Ga0495684_0073997 3300047471 Bacteria 2588
483 Ga0495686_0000045 3300047472 Bacteria 284761
484 Ga0495686_0021021 3300047472 Bacteria 4345
485 Ga0495593_0000061 3300047673 Bacteria 45310
486 Ga0495593_0003026 3300047673 Bacteria 10129
487 Ga0495593_0011715 3300047673 Bacteria 5031
488 Ga0495593_0020589 3300047673 Bacteria 3693
489 Ga0495593_0035425 3300047673 Bacteria 2710
490 Ga0495602_0001650 3300048088 Bacteria 22204
491 Ga0495602_0013840 3300048088 Bacteria 8224
492 Ga0495602_0014244 3300048088 Bacteria 8079
493 Ga0495602_0033590 3300048088 Bacteria 4810
494 Ga0495602_0047318 3300048088 Bacteria 3876
495 Ga0495602_0053499 3300048088 Bacteria 3575
496 Ga0495602_0075197 3300048088 Bacteria 2867
497 Ga0495602_0082088 3300048088 Bacteria 2706
498 Ga0495602_0102737 3300048088 Bacteria 2341
499 Ga0495602_0116835 3300048088 Bacteria 2155
500 Ga0495602_0127889 3300048088 Bacteria 2032
501 Ga0495614_0022859 3300048089 Bacteria 2695
502 Ga0495614_0030984 3300048089 Bacteria 2302
503 Ga0495614_0086643 3300048089 Bacteria 1360
504 Ga0495614_0092154 3300048089 Bacteria 1319
505 Ga0495614_0168790 3300048089 Bacteria 981
506 Ga0495614_0365067 3300048089 Unclassified 674
507 Ga0495626_0026084 3300048091 Bacteria 2852
508 Ga0495626_0117718 3300048091 Bacteria 1145
509 Ga0496100_0000245 3300048903 Bacteria 28407
510 Ga0496100_0015927 3300048903 Bacteria 4402
511 Ga0496101_0000198 3300048904 Bacteria 46691
512 Ga0496101_0006933 3300048904 Bacteria 7316
513 Ga0496101_0007248 3300048904 Bacteria 7175
514 Ga0496101_0190054 3300048904 Bacteria 1584
515 Ga0496102_0000181 3300048905 Bacteria 85605
516 Ga0496102_0075415 3300048905 Bacteria 3101
517 Ga0496102_0364181 3300048905 Bacteria 1361
518 Ga0496103_0000566 3300048906 Bacteria 29345
519 Ga0496103_0009180 3300048906 Bacteria 5855
520 Ga0496103_0223056 3300048906 Bacteria 1212
521 Ga0496104_0082671 3300048907 Bacteria 3062
522 Ga0496104_0134425 3300048907 Bacteria 2376
523 Ga0496104_0265311 3300048907 Bacteria 1630
524 Ga0496105_0092138 3300048908 Bacteria 2502
525 Ga0496105_0133488 3300048908 Bacteria 2045
526 Ga0496106_0000114 3300048909 Bacteria 61763
527 Ga0496106_0011348 3300048909 Bacteria 6594
528 Ga0496106_0046792 3300048909 Bacteria 3254
529 Ga0496107_0029436 3300048910 Bacteria 3906
530 Ga0496109_0082344 3300048912 Bacteria 2966
531 Ga0496109_0120766 3300048912 Bacteria 2441
532 Ga0496109_0408996 3300048912 Bacteria 1282
533 Ga0496110_0024154 3300048913 Bacteria 5177
534 Ga0496110_0038154 3300048913 Bacteria 4179
535 Ga0496110_0282073 3300048913 Bacteria 1513
536 Ga0496111_0012304 3300048914 Bacteria 5789
537 Ga0496111_0034302 3300048914 Bacteria 3623
538 Ga0496112_0017107 3300048915 Bacteria 6807
539 Ga0496113_0000678 3300048916 Bacteria 17322
540 Ga0496113_0000987 3300048916 Bacteria 15205
541 Ga0496113_0309882 3300048916 Bacteria 1264
542 Ga0496113_0767956 3300048916 Bacteria 767
543 Ga0496114_0163423 3300048917 Bacteria 1937
544 Ga0496115_0287273 3300048918 Bacteria 1350
545 Ga0496115_0529307 3300048918 Bacteria 944
546 Ga0496116_0188418 3300048919 Bacteria 1095
547 Ga0496117_0000263 3300048920 Bacteria 99186
548 Ga0496117_0007003 3300048920 Bacteria 11173
549 Ga0496117_0163476 3300048920 Bacteria 1301
550 Ga0496118_0000135 3300048921 Bacteria 130330
551 Ga0496118_0000445 3300048921 Bacteria 68593
552 Ga0496118_0026663 3300048921 Bacteria 4914
553 Ga0496118_0043282 3300048921 Bacteria 3542
554 Ga0496119_0111221 3300048922 Bacteria 1520
555 Ga0496120_0059149 3300048923 Bacteria 2149
556 Ga0496121_0000598 3300048924 Bacteria 67841
557 Ga0496121_0002013 3300048924 Bacteria 32276
558 Ga0496121_0004016 3300048924 Bacteria 20243
559 Ga0496121_0004080 3300048924 Bacteria 20059
560 Ga0496121_0015631 3300048924 Bacteria 7924
561 Ga0496121_0043172 3300048924 Bacteria 3909
562 Ga0496122_0012744 3300048925 Bacteria 8321
563 Ga0496122_0099892 3300048925 Bacteria 1944
564 Ga0496123_0038090 3300048926 Bacteria 3385
565 Ga0496124_0030824 3300048927 Bacteria 4752
566 Ga0496125_0008075 3300048928 Bacteria 11095
567 Ga0496126_0000596 3300048929 Bacteria 68201
568 Ga0496126_0001268 3300048929 Bacteria 40643
569 Ga0496126_0032701 3300048929 Bacteria 4898
570 Ga0496126_0139194 3300048929 Bacteria 2091
571 Ga0495678_136246 3300049459 Bacteria 808
572 Ga0495682_0009467 3300049460 Bacteria 3800
573 Ga0495682_0013094 3300049460 Bacteria 3162
574 Ga0501033_0001436 3300049570 Bacteria 21146
575 Ga0501034_0047771 3300049571 Bacteria 4321
576 Ga0501037_0155973 3300049573 Bacteria 1629
577 Ga0501038_0001368 3300049574 Bacteria 22255
578 Ga0501043_0102243 3300049579 Bacteria 2253
579 Ga0501047_0172856 3300049581 Unclassified 2029
580 Ga0501069_0091503 3300049585 Bacteria 1720
581 Ga0501070_0004312 3300049586 Bacteria 12224
582 Ga0501074_0031407 3300049590 Bacteria 3847
583 Ga0501035_0013592 3300049822 Bacteria 7511
584 nmdc:mga0n895_627571_c1 3300050512 Bacteria 1075
585 nmdc:mga08x19_121684_c1 3300050514 Bacteria 1750
586 Ga0466962_0000189 3300061719 Bacteria 25707
587 Ga0466962_0004375 3300061719 Bacteria 6775
588 Ga0466962_0019412 3300061719 Bacteria 3266

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100028345 Ga0070659_1000283452 182
2 3300046690 Ga0495624_0067674 Ga0495624_0067674_1512_2189 201
3 3300046809 Ga0495600_0000367 Ga0495600_0000367_10018_10695 201
4 3300046459 Ga0495629_0001671 Ga0495629_0001671_6129_6752 203
5 3300046463 Ga0495653_0001591 Ga0495653_0001591_10652_11275 203
6 3300046473 Ga0495582_0057919 Ga0495582_0057919_197_820 203
7 3300046524 Ga0495648_0009339 Ga0495648_0009339_1519_2142 203
8 3300046529 Ga0495652_0148059 Ga0495652_0148059_616_1239 203
9 3300046531 Ga0495665_0004733 Ga0495665_0004733_3166_3789 203
10 3300046690 Ga0495624_0000062 Ga0495624_0000062_10690_11313 203
11 3300047673 Ga0495593_0003026 Ga0495593_0003026_8281_8904 203
12 3300048089 Ga0495614_0365067 Ga0495614_0365067_11_634 203
13 3300005340 Ga0070689_100819759 Ga0070689_1008197591 205
14 3300005546 Ga0070696_100316191 Ga0070696_1003161912 205
15 3300035112 Ga0373932_0000074 Ga0373932_0000074_17964_18590 205
16 3300042876 Ga0451577_0122113 Ga0451577_0122113_233_856 205
17 3300006871 Ga0075434_100110110 Ga0075434_1001101102 206
18 3300050512 nmdc:mga0n895_627571_c1 nmdc:mga0n895_627571_c1_14_649 206
19 3300006881 Ga0068865_100445146 Ga0068865_1004451462 208
20 3300046474 Ga0495605_0058847 Ga0495605_0058847_1092_1721 208
21 iso_pu_bacteria 2599185239 2599735763 208
22 iso_pu_bacteria 2816332253 2817259118 208
23 iso_pu_bacteria 2816332256 2817280464 208
24 iso_pu_bacteria 2816332286 2817452345 208
25 iso_pu_bacteria 2818991452 2819630197 208
26 iso_pu_bacteria 2928170801 2928173837 208
27 iso_pu_bacteria 641736154 642420579 208
28 iso_pu_bacteria 8020807995 8020808958 208
29 iso_pu_bacteria 8021120328 8021121256 208
30 iso_pu_bacteria 8040167225 8040167865 208
31 iso_pu_bacteria 8040173305 8040173542 208
32 3300005340 Ga0070689_100362370 Ga0070689_1003623702 209
33 3300005435 Ga0070714_100012222 Ga0070714_1000122222 209
34 3300005457 Ga0070662_100189570 Ga0070662_1001895702 209
35 3300005457 Ga0070662_100736792 Ga0070662_1007367921 209
36 3300005467 Ga0070706_100766031 Ga0070706_1007660311 209
37 3300005536 Ga0070697_100135410 Ga0070697_1001354103 209
38 3300005536 Ga0070697_100919077 Ga0070697_1009190771 209
39 3300005539 Ga0068853_100052639 Ga0068853_1000526393 209
40 3300005614 Ga0068856_100432149 Ga0068856_1004321493 209
41 3300006173 Ga0070716_100422458 Ga0070716_1004224581 209
42 3300006914 Ga0075436_100064402 Ga0075436_1000644023 209
43 3300009093 Ga0105240_10034713 Ga0105240_100347135 209
44 3300009093 Ga0105240_10163508 Ga0105240_101635082 209
45 3300009174 Ga0105241_10789944 Ga0105241_107899441 209
46 3300013104 Ga0157370_10014496 Ga0157370_1001449610 209
47 3300014326 Ga0157380_10250481 Ga0157380_102504812 209
48 3300025913 Ga0207695_10017601 Ga0207695_100176018 209
49 3300025929 Ga0207664_10190855 Ga0207664_101908552 209
50 3300025932 Ga0207690_10010816 Ga0207690_100108162 209
51 3300025933 Ga0207706_10083641 Ga0207706_100836413 209
52 3300025933 Ga0207706_10707761 Ga0207706_107077611 209
53 3300026041 Ga0207639_10000006 Ga0207639_1000000662 209
54 3300026078 Ga0207702_10565599 Ga0207702_105655992 209
55 3300037418 Ga0395900_0012574 Ga0395900_0012574_3750_4385 209
56 3300037418 Ga0395900_0101776 Ga0395900_0101776_827_1462 209
57 3300038443 Ga0395901_0608523 Ga0395901_0608523_177_812 209
58 3300044683 Ga0466965_0020294 Ga0466965_0020294_2187_2876 209
59 3300048912 Ga0496109_0082344 Ga0496109_0082344_1622_2263 209
60 3300049570 Ga0501033_0001436 Ga0501033_0001436_10678_11313 209
61 3300049571 Ga0501034_0047771 Ga0501034_0047771_777_1412 209
62 3300049573 Ga0501037_0155973 Ga0501037_0155973_22_657 209
63 3300049574 Ga0501038_0001368 Ga0501038_0001368_13373_14005 209
64 3300049579 Ga0501043_0102243 Ga0501043_0102243_840_1475 209
65 3300049581 Ga0501047_0172856 Ga0501047_0172856_262_897 209
66 3300050514 nmdc:mga08x19_121684_c1 nmdc:mga08x19_121684_c1_256_888 209
67 iso_pu_bacteria 2513237166 2514051151 209
68 iso_pu_bacteria 642555112 642592916 209
69 3300028794 Ga0307515_10078871 Ga0307515_100788714 210
70 3300035112 Ga0373932_0000318 Ga0373932_0000318_1123_1755 210
71 iso_pu_bacteria 2513237082 2513557678 210
72 iso_pu_bacteria 2513237166 2514047146 210
73 iso_pu_bacteria 2513237166 2514052542 210
74 iso_pu_bacteria 2515154122 2515683505 210
75 iso_pu_bacteria 2562617112 2563060843 210
76 iso_pu_bacteria 2562617112 2563062633 210
77 iso_pu_bacteria 2711768613 2713476869 210
78 iso_pu_bacteria 2711768613 2713480257 210
79 iso_pu_bacteria 2808606384 2808969732 210
80 iso_pu_bacteria 2808606390 2809004624 210
81 iso_pu_bacteria 2808606391 2809011437 210
82 iso_pu_bacteria 2856287931 2856288975 210
83 iso_pu_bacteria 2857357740 2857363746 210
84 iso_pu_bacteria 2858688981 2858693905 210
85 iso_pu_bacteria 2902682994 2902684942 210
86 iso_pu_bacteria 2921643360 2921643912 210
87 iso_pu_bacteria 642555112 642597523 210
88 iso_pu_bacteria 642555112 642598696 210
89 iso_pu_bacteria 8020945358 8020949302 210
90 iso_pu_bacteria 8039098773 8039101248 210
91 3300005290 Ga0065712_10186121 Ga0065712_101861211 211
92 3300005331 Ga0070670_100089804 Ga0070670_1000898043 211
93 3300005347 Ga0070668_100005466 Ga0070668_10000546611 211
94 3300005354 Ga0070675_100078523 Ga0070675_1000785234 211
95 3300005364 Ga0070673_100099144 Ga0070673_1000991442 211
96 3300005471 Ga0070698_100048197 Ga0070698_1000481972 211
97 3300005548 Ga0070665_100026850 Ga0070665_1000268504 211
98 3300005618 Ga0068864_100343969 Ga0068864_1003439692 211
99 3300005842 Ga0068858_100077335 Ga0068858_1000773353 211
100 3300005842 Ga0068858_100857952 Ga0068858_1008579522 211
101 3300006028 Ga0070717_10560174 Ga0070717_105601742 211
102 3300006237 Ga0097621_100004366 Ga0097621_1000043666 211
103 3300009176 Ga0105242_10007665 Ga0105242_100076652 211
104 3300009177 Ga0105248_10231170 Ga0105248_102311704 211
105 3300013296 Ga0157374_10726532 Ga0157374_107265321 211
106 3300013306 Ga0163162_10375633 Ga0163162_103756332 211
107 3300014969 Ga0157376_10254357 Ga0157376_102543572 211
108 3300025925 Ga0207650_10096584 Ga0207650_100965842 211
109 3300025926 Ga0207659_10061563 Ga0207659_100615634 211
110 3300025934 Ga0207686_10012545 Ga0207686_100125455 211
111 3300025935 Ga0207709_10620641 Ga0207709_106206411 211
112 3300025938 Ga0207704_10115259 Ga0207704_101152592 211
113 3300025940 Ga0207691_10175879 Ga0207691_101758793 211
114 3300025941 Ga0207711_10292136 Ga0207711_102921362 211
115 3300025972 Ga0207668_10020162 Ga0207668_100201622 211
116 3300026089 Ga0207648_10223395 Ga0207648_102233951 211
117 3300026095 Ga0207676_10258049 Ga0207676_102580492 211
118 3300028379 Ga0268266_10018312 Ga0268266_100183126 211
119 3300046457 Ga0495590_0007124 Ga0495590_0007124_3660_4301 211
120 3300046507 Ga0495606_0045942 Ga0495606_0045942_963_1604 211
121 3300046515 Ga0495620_0021272 Ga0495620_0021272_813_1454 211
122 3300046528 Ga0495642_0069287 Ga0495642_0069287_116_757 211
123 3300046542 Ga0495597_0039318 Ga0495597_0039318_246_887 211
124 3300046694 Ga0495649_0132237 Ga0495649_0132237_465_1106 211
125 3300046794 Ga0495589_0199734 Ga0495589_0199734_12_653 211
126 3300047323 Ga0495683_0072886 Ga0495683_0072886_948_1589 211
127 3300048904 Ga0496101_0006933 Ga0496101_0006933_2237_2878 211
128 3300048906 Ga0496103_0009180 Ga0496103_0009180_1792_2433 211
129 3300048907 Ga0496104_0134425 Ga0496104_0134425_36_677 211
130 3300048909 Ga0496106_0011348 Ga0496106_0011348_1911_2552 211
131 3300048910 Ga0496107_0029436 Ga0496107_0029436_2114_2755 211
132 3300048912 Ga0496109_0120766 Ga0496109_0120766_14_655 211
133 3300048913 Ga0496110_0038154 Ga0496110_0038154_2327_2968 211
134 3300048914 Ga0496111_0012304 Ga0496111_0012304_2428_3069 211
135 3300048915 Ga0496112_0017107 Ga0496112_0017107_2832_3473 211
136 3300048916 Ga0496113_0309882 Ga0496113_0309882_328_969 211
137 3300048920 Ga0496117_0007003 Ga0496117_0007003_6388_7029 211
138 3300048921 Ga0496118_0026663 Ga0496118_0026663_3715_4356 211
139 3300048922 Ga0496119_0111221 Ga0496119_0111221_351_992 211
140 3300048924 Ga0496121_0043172 Ga0496121_0043172_2135_2776 211
141 3300048925 Ga0496122_0012744 Ga0496122_0012744_2085_2726 211
142 3300048926 Ga0496123_0038090 Ga0496123_0038090_406_1047 211
143 3300048927 Ga0496124_0030824 Ga0496124_0030824_456_1097 211
144 3300048928 Ga0496125_0008075 Ga0496125_0008075_8788_9429 211
145 iso_pu_bacteria 2512047030 2512345995 211
146 iso_pu_bacteria 2818991450 2819623000 211
147 iso_pu_bacteria 2900634093 2900639878 211
148 iso_pu_bacteria 2904483920 2904485967 211
149 iso_pu_bacteria 2928108538 2928114964 211
150 iso_pu_bacteria 2928135762 2928140982 211
151 iso_pu_bacteria 2928503688 2928507126 211
152 iso_pu_bacteria 2990703756 2990710607 211
153 iso_pu_bacteria 641736151 642425086 211
154 iso_pu_bacteria 642555113 642617369 211
155 iso_pu_bacteria 8055301274 8055307086 211
156 3300003758 Ga0055532_1000434 Ga0055532_10004343 212
157 3300003760 Ga0055527_1000153 Ga0055527_10001539 212
158 3300003761 Ga0055535_1000316 Ga0055535_10003169 212
159 3300003762 Ga0055542_1001996 Ga0055542_10019963 212
160 3300009093 Ga0105240_10017557 Ga0105240_100175578 212
161 3300009545 Ga0105237_10297839 Ga0105237_102978392 212
162 3300009551 Ga0105238_10008459 Ga0105238_100084599 212
163 3300013104 Ga0157370_10194965 Ga0157370_101949652 212
164 3300025226 Ga0209674_102961 Ga0209674_1029612 212
165 3300025228 Ga0209672_100012 Ga0209672_100012113 212
166 3300025229 Ga0209147_100007 Ga0209147_100007659 212
167 3300025242 Ga0209258_100014 Ga0209258_10001444 212
168 3300025254 Ga0209148_1000287 Ga0209148_100028739 212
169 3300025272 Ga0209455_1000720 Ga0209455_10007209 212
170 3300035117 Ga0373953_0054236 Ga0373953_0054236_573_1232 212
171 3300035724 Ga0373933_0217228 Ga0373933_0217228_124_783 212
172 3300036401 Ga0373937_0037938 Ga0373937_0037938_2691_3350 212
173 3300037068 Ga0373925_0538364 Ga0373925_0538364_160_819 212
174 3300046472 Ga0495580_0372097 Ga0495580_0372097_233_892 212
175 3300046475 Ga0495639_0143893 Ga0495639_0143893_52_711 212
176 3300046531 Ga0495665_0031381 Ga0495665_0031381_1230_1874 212
177 3300046531 Ga0495665_0255698 Ga0495665_0255698_40_681 212
178 3300046535 Ga0495586_0138721 Ga0495586_0138721_538_1197 212
179 3300046678 Ga0495599_0003822 Ga0495599_0003822_5413_6051 212
180 3300046679 Ga0495623_0000736 Ga0495623_0000736_11641_12279 212
181 3300046681 Ga0495647_0067083 Ga0495647_0067083_27_686 212
182 3300046809 Ga0495600_0363358 Ga0495600_0363358_108_746 212
183 3300047317 Ga0495604_0000600 Ga0495604_0000600_11153_11791 212
184 3300047319 Ga0495674_0046132 Ga0495674_0046132_1797_2438 212
185 3300047320 Ga0495672_0001083 Ga0495672_0001083_12884_13525 212
186 3300047444 Ga0495675_0026476 Ga0495675_0026476_739_1377 212
187 3300047472 Ga0495686_0000045 Ga0495686_0000045_74137_74778 212
188 3300048088 Ga0495602_0013840 Ga0495602_0013840_4542_5180 212
189 3300049585 Ga0501069_0091503 Ga0501069_0091503_685_1341 212
190 3300049586 Ga0501070_0004312 Ga0501070_0004312_1390_2046 212
191 3300049590 Ga0501074_0031407 Ga0501074_0031407_2244_2900 212
192 3300003322 rootL2_10003788 rootL2_100037886 213
193 3300009093 Ga0105240_10200084 Ga0105240_102000842 213
194 3300013105 Ga0157369_10051315 Ga0157369_100513156 213
195 3300037418 Ga0395900_0001448 Ga0395900_0001448_22077_22724 213
196 3300044683 Ga0466965_0048170 Ga0466965_0048170_1246_1938 213
197 3300044684 Ga0466966_0051786 Ga0466966_0051786_206_901 213
198 3300044693 Ga0466961_0022028 Ga0466961_0022028_2500_3192 213
199 3300044693 Ga0466961_0057733 Ga0466961_0057733_1101_1796 213
200 3300044694 Ga0466963_0000725 Ga0466963_0000725_12497_13192 213
201 3300044719 Ga0466971_0166041 Ga0466971_0166041_141_836 213
202 3300044842 Ga0466957_0037843 Ga0466957_0037843_641_1336 213
203 3300045836 Ga0466958_0048288 Ga0466958_0048288_1390_2085 213
204 3300046459 Ga0495629_0038919 Ga0495629_0038919_437_1084 213
205 3300046462 Ga0495651_0350213 Ga0495651_0350213_15_662 213
206 3300046463 Ga0495653_0005724 Ga0495653_0005724_6783_7430 213
207 3300046463 Ga0495653_0141106 Ga0495653_0141106_757_1404 213
208 3300046472 Ga0495580_0042306 Ga0495580_0042306_129_773 213
209 3300046477 Ga0495664_0043690 Ga0495664_0043690_443_1090 213
210 3300046516 Ga0495628_0085025 Ga0495628_0085025_1064_1711 213
211 3300046517 Ga0495630_0009125 Ga0495630_0009125_5030_5677 213
212 3300046529 Ga0495652_0021043 Ga0495652_0021043_744_1391 213
213 3300046531 Ga0495665_0000183 Ga0495665_0000183_20828_21475 213
214 3300046535 Ga0495586_0030326 Ga0495586_0030326_171_818 213
215 3300046543 Ga0495645_0051526 Ga0495645_0051526_2216_2863 213
216 3300046663 Ga0495635_0003916 Ga0495635_0003916_3429_4076 213
217 3300046678 Ga0495599_0044124 Ga0495599_0044124_326_973 213
218 3300046679 Ga0495623_0002295 Ga0495623_0002295_1432_2079 213
219 3300046680 Ga0495646_0011233 Ga0495646_0011233_279_926 213
220 3300046690 Ga0495624_0000471 Ga0495624_0000471_10502_11149 213
221 3300046809 Ga0495600_0031310 Ga0495600_0031310_755_1402 213
222 3300047319 Ga0495674_0014155 Ga0495674_0014155_4663_5307 213
223 3300047319 Ga0495674_0042527 Ga0495674_0042527_1153_1800 213
224 3300047322 Ga0495680_0002605 Ga0495680_0002605_6633_7280 213
225 3300047444 Ga0495675_0064299 Ga0495675_0064299_1177_1824 213
226 3300047673 Ga0495593_0020589 Ga0495593_0020589_594_1241 213
227 3300048088 Ga0495602_0001650 Ga0495602_0001650_10540_11187 213
228 3300048904 Ga0496101_0007248 Ga0496101_0007248_3621_4268 213
229 3300048906 Ga0496103_0223056 Ga0496103_0223056_60_707 213
230 3300048907 Ga0496104_0265311 Ga0496104_0265311_572_1219 213
231 3300048912 Ga0496109_0408996 Ga0496109_0408996_57_704 213
232 3300061719 Ga0466962_0000189 Ga0466962_0000189_18158_18853 213
233 iso_pu_bacteria 2904434214 2904437375 213
234 3300001989 JGI24739J22299_10026164 JGI24739J22299_100261642 214
235 3300001990 JGI24737J22298_10032965 JGI24737J22298_100329652 214
236 3300002067 JGI24735J21928_10006689 JGI24735J21928_100066892 214
237 3300002067 JGI24735J21928_10009537 JGI24735J21928_100095372 214
238 3300003187 JGI25151J46595_10010761 JGI25151J46595_100107616 214
239 3300003320 rootH2_10005359 rootH2_1000535910 214
240 3300003320 rootH2_10108596 rootH2_1010859613 214
241 3300003323 rootH1_10076393 rootH1_100763932 214
242 3300003323 rootH1_10089848 rootH1_100898483 214
243 3300003323 rootH1_10221373 rootH1_102213734 214
244 3300003354 JGI25160J50197_1024162 JGI25160J50197_10241622 214
245 3300003771 Ga0055526_1024025 Ga0055526_10240253 214
246 3300005262 Ga0065165_1000040 Ga0065165_1000040136 214
247 3300005327 Ga0070658_10021856 Ga0070658_100218564 214
248 3300005339 Ga0070660_100036558 Ga0070660_1000365581 214
249 3300005339 Ga0070660_100658236 Ga0070660_1006582361 214
250 3300005344 Ga0070661_100178432 Ga0070661_1001784321 214
251 3300005455 Ga0070663_100237218 Ga0070663_1002372182 214
252 3300005548 Ga0070665_100226472 Ga0070665_1002264722 214
253 3300005563 Ga0068855_100149587 Ga0068855_1001495872 214
254 3300009011 Ga0105251_10005574 Ga0105251_1000557411 214
255 3300009092 Ga0105250_10093739 Ga0105250_100937392 214
256 3300009093 Ga0105240_10096577 Ga0105240_100965772 214
257 3300009093 Ga0105240_10121287 Ga0105240_101212874 214
258 3300009551 Ga0105238_10003214 Ga0105238_100032148 214
259 3300009551 Ga0105238_10421317 Ga0105238_104213172 214
260 3300013102 Ga0157371_10074243 Ga0157371_100742434 214
261 3300013104 Ga0157370_10003155 Ga0157370_1000315514 214
262 3300013104 Ga0157370_10332212 Ga0157370_103322122 214
263 3300013105 Ga0157369_10000145 Ga0157369_1000014560 214
264 3300013105 Ga0157369_10000293 Ga0157369_1000029338 214
265 3300013306 Ga0163162_10018442 Ga0163162_100184425 214
266 3300014326 Ga0157380_10469252 Ga0157380_104692522 214
267 3300020069 Ga0197907_10509736 Ga0197907_105097361 214
268 3300020070 Ga0206356_11033659 Ga0206356_110336592 214
269 3300020076 Ga0206355_1458904 Ga0206355_14589042 214
270 3300020080 Ga0206350_10742459 Ga0206350_107424593 214
271 3300020081 Ga0206354_11125356 Ga0206354_111253563 214
272 3300020082 Ga0206353_10180509 Ga0206353_101805092 214
273 3300022467 Ga0224712_10000027 Ga0224712_100000274 214
274 3300025272 Ga0209455_1000664 Ga0209455_100066417 214
275 3300025284 Ga0209130_1004156 Ga0209130_10041565 214
276 3300025294 Ga0209025_1001263 Ga0209025_100126328 214
277 3300025294 Ga0209025_1002150 Ga0209025_100215012 214
278 3300025295 Ga0209564_1008013 Ga0209564_10080135 214
279 3300025302 Ga0207426_1000004 Ga0207426_1000004814 214
280 3300025302 Ga0207426_1002029 Ga0207426_10020296 214
281 3300025711 Ga0207696_1055691 Ga0207696_10556912 214
282 3300025735 Ga0207713_1024904 Ga0207713_10249042 214
283 3300025904 Ga0207647_10024398 Ga0207647_100243982 214
284 3300025909 Ga0207705_10005089 Ga0207705_100050897 214
285 3300025913 Ga0207695_10225491 Ga0207695_102254912 214
286 3300025919 Ga0207657_10195860 Ga0207657_101958601 214
287 3300025924 Ga0207694_10018489 Ga0207694_100184894 214
288 3300025924 Ga0207694_10368702 Ga0207694_103687022 214
289 3300025924 Ga0207694_10409052 Ga0207694_104090522 214
290 3300025949 Ga0207667_10006817 Ga0207667_1000681712 214
291 3300025986 Ga0207658_10242497 Ga0207658_102424972 214
292 3300026035 Ga0207703_10167636 Ga0207703_101676362 214
293 3300026041 Ga0207639_10911050 Ga0207639_109110501 214
294 3300028800 Ga0265338_10000159 Ga0265338_1000015917 214
295 3300028800 Ga0265338_10003994 Ga0265338_1000399411 214
296 3300037312 Ga0395899_0000005 Ga0395899_0000005_385638_386285 214
297 3300037312 Ga0395899_0133072 Ga0395899_0133072_944_1591 214
298 3300037418 Ga0395900_0000003 Ga0395900_0000003_386682_387329 214
299 3300037418 Ga0395900_0000053 Ga0395900_0000053_121333_121980 214
300 3300037418 Ga0395900_0048919 Ga0395900_0048919_1422_2069 214
301 3300037418 Ga0395900_0071313 Ga0395900_0071313_1973_2620 214
302 3300037418 Ga0395900_0072560 Ga0395900_0072560_87_734 214
303 3300037466 Ga0395898_0000003 Ga0395898_0000003_385658_386305 214
304 3300037466 Ga0395898_0001273 Ga0395898_0001273_1806_2453 214
305 3300037466 Ga0395898_0071913 Ga0395898_0071913_1489_2136 214
306 3300037466 Ga0395898_0186246 Ga0395898_0186246_78_725 214
307 3300037471 Ga0395905_0000035 Ga0395905_0000035_52606_53253 214
308 3300038443 Ga0395901_0000004 Ga0395901_0000004_50441_51088 214
309 3300038443 Ga0395901_0000042 Ga0395901_0000042_73824_74471 214
310 3300038443 Ga0395901_0036096 Ga0395901_0036096_4383_5030 214
311 3300044656 Ga0466969_0001183 Ga0466969_0001183_2468_3115 214
312 3300044656 Ga0466969_0004417 Ga0466969_0004417_6799_7446 214
313 3300044659 Ga0466973_0008737 Ga0466973_0008737_6829_7476 214
314 3300044684 Ga0466966_0000029 Ga0466966_0000029_81996_82643 214
315 3300044684 Ga0466966_0004888 Ga0466966_0004888_5519_6166 214
316 3300044684 Ga0466966_0017051 Ga0466966_0017051_802_1449 214
317 3300044693 Ga0466961_0001351 Ga0466961_0001351_6130_6777 214
318 3300044693 Ga0466961_0003113 Ga0466961_0003113_3088_3735 214
319 3300044693 Ga0466961_0011759 Ga0466961_0011759_888_1535 214
320 3300044693 Ga0466961_0180873 Ga0466961_0180873_230_877 214
321 3300044694 Ga0466963_0000211 Ga0466963_0000211_1198_1845 214
322 3300044694 Ga0466963_0009541 Ga0466963_0009541_3671_4318 214
323 3300044694 Ga0466963_0019497 Ga0466963_0019497_663_1310 214
324 3300044706 Ga0466964_0041026 Ga0466964_0041026_651_1298 214
325 3300044719 Ga0466971_0003180 Ga0466971_0003180_2991_3638 214
326 3300044719 Ga0466971_0018269 Ga0466971_0018269_1382_2029 214
327 3300044719 Ga0466971_0021399 Ga0466971_0021399_1071_1718 214
328 3300044735 Ga0466968_0016888 Ga0466968_0016888_1921_2568 214
329 3300044765 Ga0466970_0019110 Ga0466970_0019110_1707_2354 214
330 3300044765 Ga0466970_0052199 Ga0466970_0052199_1373_2020 214
331 3300044842 Ga0466957_0015354 Ga0466957_0015354_103_750 214
332 3300044842 Ga0466957_0016207 Ga0466957_0016207_1309_1956 214
333 3300044842 Ga0466957_0034079 Ga0466957_0034079_1089_1736 214
334 3300044842 Ga0466957_0337906 Ga0466957_0337906_167_814 214
335 3300045049 Ga0466959_0015408 Ga0466959_0015408_4861_5529 214
336 3300045049 Ga0466959_0355426 Ga0466959_0355426_248_895 214
337 3300045836 Ga0466958_0012260 Ga0466958_0012260_1102_1749 214
338 3300045836 Ga0466958_0053025 Ga0466958_0053025_1319_1966 214
339 3300046454 Ga0495592_0065657 Ga0495592_0065657_612_1262 214
340 3300046455 Ga0495603_0002093 Ga0495603_0002093_7961_8608 214
341 3300046455 Ga0495603_0047427 Ga0495603_0047427_1488_2147 214
342 3300046457 Ga0495590_0073213 Ga0495590_0073213_227_874 214
343 3300046459 Ga0495629_0001627 Ga0495629_0001627_9476_10126 214
344 3300046459 Ga0495629_0010138 Ga0495629_0010138_20_673 214
345 3300046459 Ga0495629_0165957 Ga0495629_0165957_826_1476 214
346 3300046462 Ga0495651_0424151 Ga0495651_0424151_177_827 214
347 3300046463 Ga0495653_0028865 Ga0495653_0028865_1355_2008 214
348 3300046471 Ga0495650_0001852 Ga0495650_0001852_7563_8213 214
349 3300046472 Ga0495580_0011077 Ga0495580_0011077_4480_5130 214
350 3300046472 Ga0495580_0215990 Ga0495580_0215990_658_1305 214
351 3300046474 Ga0495605_0022344 Ga0495605_0022344_439_1086 214
352 3300046474 Ga0495605_0058470 Ga0495605_0058470_814_1473 214
353 3300046476 Ga0495662_0101983 Ga0495662_0101983_28_681 214
354 3300046477 Ga0495664_0001152 Ga0495664_0001152_5449_6099 214
355 3300046477 Ga0495664_0012627 Ga0495664_0012627_933_1583 214
356 3300046501 Ga0495607_0065134 Ga0495607_0065134_598_1248 214
357 3300046506 Ga0495583_0037118 Ga0495583_0037118_1088_1735 214
358 3300046513 Ga0495616_0048759 Ga0495616_0048759_576_1223 214
359 3300046513 Ga0495616_0094322 Ga0495616_0094322_470_1129 214
360 3300046516 Ga0495628_0009868 Ga0495628_0009868_5250_5906 214
361 3300046516 Ga0495628_0041436 Ga0495628_0041436_2075_2725 214
362 3300046517 Ga0495630_0050641 Ga0495630_0050641_2230_2883 214
363 3300046528 Ga0495642_0202616 Ga0495642_0202616_109_756 214
364 3300046529 Ga0495652_0390646 Ga0495652_0390646_298_951 214
365 3300046531 Ga0495665_0007911 Ga0495665_0007911_1515_2168 214
366 3300046543 Ga0495645_0000899 Ga0495645_0000899_8670_9320 214
367 3300046543 Ga0495645_0009829 Ga0495645_0009829_5109_5759 214
368 3300046543 Ga0495645_0059668 Ga0495645_0059668_17_667 214
369 3300046559 Ga0495667_0025442 Ga0495667_0025442_2984_3634 214
370 3300046660 Ga0495625_0180373 Ga0495625_0180373_719_1378 214
371 3300046660 Ga0495625_0494241 Ga0495625_0494241_63_710 214
372 3300046663 Ga0495635_0002163 Ga0495635_0002163_11189_11842 214
373 3300046674 Ga0495588_0297683 Ga0495588_0297683_84_734 214
374 3300046678 Ga0495599_0005137 Ga0495599_0005137_6323_7087 214
375 3300046678 Ga0495599_0059666 Ga0495599_0059666_557_1207 214
376 3300046679 Ga0495623_0006339 Ga0495623_0006339_5648_6301 214
377 3300046679 Ga0495623_0078842 Ga0495623_0078842_817_1467 214
378 3300046679 Ga0495623_0196215 Ga0495623_0196215_333_983 214
379 3300046680 Ga0495646_0004629 Ga0495646_0004629_941_1597 214
380 3300046680 Ga0495646_0055330 Ga0495646_0055330_997_1647 214
381 3300046680 Ga0495646_0078843 Ga0495646_0078843_1201_1854 214
382 3300046684 Ga0495669_0074780 Ga0495669_0074780_71_718 214
383 3300046689 Ga0495613_0010901 Ga0495613_0010901_6025_6675 214
384 3300046690 Ga0495624_0071563 Ga0495624_0071563_418_1071 214
385 3300046690 Ga0495624_0197765 Ga0495624_0197765_285_935 214
386 3300046692 Ga0495671_0122403 Ga0495671_0122403_80_730 214
387 3300046694 Ga0495649_0091398 Ga0495649_0091398_892_1551 214
388 3300046794 Ga0495589_0017177 Ga0495589_0017177_3005_3655 214
389 3300046794 Ga0495589_0024409 Ga0495589_0024409_117_764 214
390 3300046809 Ga0495600_0027629 Ga0495600_0027629_1167_1817 214
391 3300046809 Ga0495600_0068240 Ga0495600_0068240_632_1282 214
392 3300047317 Ga0495604_0043220 Ga0495604_0043220_2128_2781 214
393 3300047317 Ga0495604_0052308 Ga0495604_0052308_1674_2324 214
394 3300047319 Ga0495674_0010758 Ga0495674_0010758_3557_4216 214
395 3300047319 Ga0495674_0018159 Ga0495674_0018159_1857_2504 214
396 3300047319 Ga0495674_0035900 Ga0495674_0035900_3499_4146 214
397 3300047319 Ga0495674_0074799 Ga0495674_0074799_885_1535 214
398 3300047319 Ga0495674_0114257 Ga0495674_0114257_776_1423 214
399 3300047319 Ga0495674_0180777 Ga0495674_0180777_730_1383 214
400 3300047319 Ga0495674_0461849 Ga0495674_0461849_180_830 214
401 3300047320 Ga0495672_0064763 Ga0495672_0064763_1311_1958 214
402 3300047320 Ga0495672_0067791 Ga0495672_0067791_618_1265 214
403 3300047322 Ga0495680_0002137 Ga0495680_0002137_2476_3129 214
404 3300047322 Ga0495680_0076643 Ga0495680_0076643_1282_1932 214
405 3300047323 Ga0495683_0054521 Ga0495683_0054521_261_908 214
406 3300047323 Ga0495683_0088942 Ga0495683_0088942_226_885 214
407 3300047443 Ga0495687_035325 Ga0495687_035325_980_1627 214
408 3300047443 Ga0495687_119178 Ga0495687_119178_259_918 214
409 3300047444 Ga0495675_0005440 Ga0495675_0005440_663_1313 214
410 3300047444 Ga0495675_0122618 Ga0495675_0122618_841_1497 214
411 3300047469 Ga0495673_0028169 Ga0495673_0028169_587_1234 214
412 3300047469 Ga0495673_0067250 Ga0495673_0067250_664_1323 214
413 3300048088 Ga0495602_0047318 Ga0495602_0047318_1540_2304 214
414 3300048088 Ga0495602_0127889 Ga0495602_0127889_16_666 214
415 3300048089 Ga0495614_0092154 Ga0495614_0092154_637_1290 214
416 3300048091 Ga0495626_0026084 Ga0495626_0026084_794_1441 214
417 3300048091 Ga0495626_0117718 Ga0495626_0117718_376_1035 214
418 3300048903 Ga0496100_0000245 Ga0496100_0000245_10048_10695 214
419 3300048903 Ga0496100_0015927 Ga0496100_0015927_2492_3139 214
420 3300048904 Ga0496101_0000198 Ga0496101_0000198_20192_20839 214
421 3300048904 Ga0496101_0190054 Ga0496101_0190054_913_1560 214
422 3300048905 Ga0496102_0000181 Ga0496102_0000181_63931_64578 214
423 3300048905 Ga0496102_0364181 Ga0496102_0364181_13_672 214
424 3300048906 Ga0496103_0000566 Ga0496103_0000566_13310_13957 214
425 3300048907 Ga0496104_0082671 Ga0496104_0082671_1332_1979 214
426 3300048908 Ga0496105_0092138 Ga0496105_0092138_1332_1979 214
427 3300048908 Ga0496105_0133488 Ga0496105_0133488_761_1420 214
428 3300048909 Ga0496106_0000114 Ga0496106_0000114_36769_37416 214
429 3300048909 Ga0496106_0046792 Ga0496106_0046792_179_826 214
430 3300048913 Ga0496110_0024154 Ga0496110_0024154_3282_3932 214
431 3300048913 Ga0496110_0282073 Ga0496110_0282073_591_1238 214
432 3300048914 Ga0496111_0034302 Ga0496111_0034302_544_1194 214
433 3300048916 Ga0496113_0000678 Ga0496113_0000678_6188_6835 214
434 3300048916 Ga0496113_0000987 Ga0496113_0000987_755_1402 214
435 3300048916 Ga0496113_0767956 Ga0496113_0767956_94_741 214
436 3300048917 Ga0496114_0163423 Ga0496114_0163423_929_1579 214
437 3300048918 Ga0496115_0529307 Ga0496115_0529307_52_711 214
438 3300048919 Ga0496116_0188418 Ga0496116_0188418_345_992 214
439 3300048920 Ga0496117_0000263 Ga0496117_0000263_29630_30277 214
440 3300048921 Ga0496118_0000135 Ga0496118_0000135_13329_13976 214
441 3300048923 Ga0496120_0059149 Ga0496120_0059149_1364_2011 214
442 3300048924 Ga0496121_0000598 Ga0496121_0000598_34108_34755 214
443 3300048924 Ga0496121_0002013 Ga0496121_0002013_14702_15349 214
444 3300048924 Ga0496121_0004016 Ga0496121_0004016_9638_10285 214
445 3300048924 Ga0496121_0004080 Ga0496121_0004080_19188_19835 214
446 3300048924 Ga0496121_0015631 Ga0496121_0015631_606_1265 214
447 3300048929 Ga0496126_0000596 Ga0496126_0000596_33922_34569 214
448 3300048929 Ga0496126_0032701 Ga0496126_0032701_3306_3953 214
449 3300048929 Ga0496126_0139194 Ga0496126_0139194_343_990 214
450 3300049459 Ga0495678_136246 Ga0495678_136246_85_744 214
451 3300049460 Ga0495682_0009467 Ga0495682_0009467_322_969 214
452 3300049822 Ga0501035_0013592 Ga0501035_0013592_4506_5153 214
453 3300061719 Ga0466962_0004375 Ga0466962_0004375_2354_3001 214
454 3300061719 Ga0466962_0019412 Ga0466962_0019412_923_1570 214
455 iso_pu_bacteria 2921643360 2921645331 214
456 3300001989 JGI24739J22299_10012722 JGI24739J22299_100127224 215
457 3300001989 JGI24739J22299_10031933 JGI24739J22299_100319333 215
458 3300002067 JGI24735J21928_10019398 JGI24735J21928_100193982 215
459 3300002705 JGI25156J39149_1000356 JGI25156J39149_10003566 215
460 3300002705 JGI25156J39149_1000856 JGI25156J39149_100085613 215
461 3300003214 JGI25165J46597_1001118 JGI25165J46597_10011188 215
462 3300003756 Ga0055533_1000072 Ga0055533_100007276 215
463 3300003758 Ga0055532_1000013 Ga0055532_1000013141 215
464 3300003760 Ga0055527_1000010 Ga0055527_1000010228 215
465 3300003761 Ga0055535_1000010 Ga0055535_1000010141 215
466 3300003762 Ga0055542_1000016 Ga0055542_1000016141 215
467 3300003763 Ga0055529_1000012 Ga0055529_1000012141 215
468 3300005367 Ga0070667_100161251 Ga0070667_1001612512 215
469 3300009011 Ga0105251_10000069 Ga0105251_1000006973 215
470 3300009011 Ga0105251_10049052 Ga0105251_100490523 215
471 3300009093 Ga0105240_10218952 Ga0105240_102189522 215
472 3300009093 Ga0105240_10701677 Ga0105240_107016772 215
473 3300013105 Ga0157369_10076466 Ga0157369_100764663 215
474 3300013105 Ga0157369_10159418 Ga0157369_101594182 215
475 3300015262 Ga0182007_10002791 Ga0182007_100027919 215
476 3300025226 Ga0209674_100011 Ga0209674_100011227 215
477 3300025228 Ga0209672_100002 Ga0209672_100002222 215
478 3300025229 Ga0209147_100003 Ga0209147_100003222 215
479 3300025230 Ga0209563_100990 Ga0209563_1009907 215
480 3300025231 Ga0207427_103698 Ga0207427_1036984 215
481 3300025242 Ga0209258_100042 Ga0209258_100042138 215
482 3300025254 Ga0209148_1000006 Ga0209148_1000006222 215
483 3300025256 Ga0209759_1000028 Ga0209759_100002834 215
484 3300025256 Ga0209759_1000051 Ga0209759_100005196 215
485 3300025261 Ga0209233_1000033 Ga0209233_1000033322 215
486 3300025272 Ga0209455_1000003 Ga0209455_1000003222 215
487 3300025735 Ga0207713_1001033 Ga0207713_10010339 215
488 3300025904 Ga0207647_10063461 Ga0207647_100634611 215
489 3300025913 Ga0207695_10251676 Ga0207695_102516763 215
490 3300025924 Ga0207694_10242101 Ga0207694_102421012 215
491 3300028563 Ga0265319_1029842 Ga0265319_10298422 215
492 3300031712 Ga0265342_10104752 Ga0265342_101047522 215
493 3300038443 Ga0395901_0000130 Ga0395901_0000130_1858_2511 215
494 3300046454 Ga0495592_0200674 Ga0495592_0200674_664_1314 215
495 3300046455 Ga0495603_0084085 Ga0495603_0084085_800_1450 215
496 3300046459 Ga0495629_0000224 Ga0495629_0000224_10597_11244 215
497 3300046459 Ga0495629_0000249 Ga0495629_0000249_17487_18137 215
498 3300046459 Ga0495629_0001695 Ga0495629_0001695_11214_11864 215
499 3300046461 Ga0495641_0023325 Ga0495641_0023325_1474_2124 215
500 3300046461 Ga0495641_0118837 Ga0495641_0118837_113_763 215
501 3300046462 Ga0495651_0094787 Ga0495651_0094787_739_1389 215
502 3300046462 Ga0495651_0103105 Ga0495651_0103105_696_1343 215
503 3300046462 Ga0495651_0103184 Ga0495651_0103184_44_694 215
504 3300046463 Ga0495653_0000942 Ga0495653_0000942_8089_8736 215
505 3300046463 Ga0495653_0001903 Ga0495653_0001903_15097_15747 215
506 3300046463 Ga0495653_0021842 Ga0495653_0021842_503_1153 215
507 3300046463 Ga0495653_0052357 Ga0495653_0052357_1924_2574 215
508 3300046463 Ga0495653_0053827 Ga0495653_0053827_2106_2756 215
509 3300046463 Ga0495653_0098115 Ga0495653_0098115_1377_2027 215
510 3300046471 Ga0495650_0003687 Ga0495650_0003687_4273_4923 215
511 3300046472 Ga0495580_0000355 Ga0495580_0000355_26556_27206 215
512 3300046472 Ga0495580_0001105 Ga0495580_0001105_20490_21140 215
513 3300046472 Ga0495580_0002219 Ga0495580_0002219_9988_10635 215
514 3300046472 Ga0495580_0002335 Ga0495580_0002335_11238_11888 215
515 3300046472 Ga0495580_0131331 Ga0495580_0131331_267_917 215
516 3300046473 Ga0495582_0004443 Ga0495582_0004443_1935_2585 215
517 3300046473 Ga0495582_0005945 Ga0495582_0005945_3328_3978 215
518 3300046473 Ga0495582_0060879 Ga0495582_0060879_228_878 215
519 3300046473 Ga0495582_0210040 Ga0495582_0210040_411_1058 215
520 3300046476 Ga0495662_0029085 Ga0495662_0029085_1070_1720 215
521 3300046477 Ga0495664_0001056 Ga0495664_0001056_2360_3010 215
522 3300046477 Ga0495664_0134400 Ga0495664_0134400_486_1136 215
523 3300046500 Ga0495596_0023148 Ga0495596_0023148_648_1298 215
524 3300046506 Ga0495583_0002761 Ga0495583_0002761_1999_2649 215
525 3300046511 Ga0495608_0004535 Ga0495608_0004535_1491_2141 215
526 3300046512 Ga0495610_0002901 Ga0495610_0002901_12228_12878 215
527 3300046514 Ga0495618_0005997 Ga0495618_0005997_3681_4331 215
528 3300046514 Ga0495618_0040229 Ga0495618_0040229_2088_2738 215
529 3300046514 Ga0495618_0054741 Ga0495618_0054741_440_1090 215
530 3300046516 Ga0495628_0000239 Ga0495628_0000239_8436_9083 215
531 3300046516 Ga0495628_0014304 Ga0495628_0014304_5771_6421 215
532 3300046516 Ga0495628_0014998 Ga0495628_0014998_5713_6363 215
533 3300046516 Ga0495628_0026057 Ga0495628_0026057_1161_1811 215
534 3300046516 Ga0495628_0066259 Ga0495628_0066259_212_862 215
535 3300046516 Ga0495628_0093641 Ga0495628_0093641_1070_1720 215
536 3300046516 Ga0495628_0331982 Ga0495628_0331982_31_681 215
537 3300046517 Ga0495630_0012843 Ga0495630_0012843_1709_2359 215
538 3300046517 Ga0495630_0014371 Ga0495630_0014371_989_1639 215
539 3300046517 Ga0495630_0043128 Ga0495630_0043128_1629_2279 215
540 3300046517 Ga0495630_0057170 Ga0495630_0057170_1989_2639 215
541 3300046522 Ga0495643_0036642 Ga0495643_0036642_161_811 215
542 3300046524 Ga0495648_0002596 Ga0495648_0002596_9315_9962 215
543 3300046524 Ga0495648_0018361 Ga0495648_0018361_818_1468 215
544 3300046526 Ga0495666_0002176 Ga0495666_0002176_3967_4617 215
545 3300046526 Ga0495666_0004470 Ga0495666_0004470_1745_2395 215
546 3300046526 Ga0495666_0005695 Ga0495666_0005695_559_1209 215
547 3300046526 Ga0495666_0006738 Ga0495666_0006738_234_884 215
548 3300046529 Ga0495652_0031882 Ga0495652_0031882_2330_2980 215
549 3300046529 Ga0495652_0043233 Ga0495652_0043233_318_968 215
550 3300046529 Ga0495652_0458204 Ga0495652_0458204_112_762 215
551 3300046531 Ga0495665_0011506 Ga0495665_0011506_1253_1900 215
552 3300046531 Ga0495665_0110109 Ga0495665_0110109_771_1421 215
553 3300046531 Ga0495665_0319800 Ga0495665_0319800_113_763 215
554 3300046533 Ga0495640_0189870 Ga0495640_0189870_630_1280 215
555 3300046533 Ga0495640_0404861 Ga0495640_0404861_52_702 215
556 3300046535 Ga0495586_0009019 Ga0495586_0009019_1979_2629 215
557 3300046535 Ga0495586_0359169 Ga0495586_0359169_156_806 215
558 3300046536 Ga0495587_0001594 Ga0495587_0001594_348_998 215
559 3300046538 Ga0495609_0056925 Ga0495609_0056925_366_1016 215
560 3300046543 Ga0495645_0001599 Ga0495645_0001599_11353_12003 215
561 3300046543 Ga0495645_0382110 Ga0495645_0382110_69_719 215
562 3300046557 Ga0495622_0000022 Ga0495622_0000022_139409_140059 215
563 3300046559 Ga0495667_0225013 Ga0495667_0225013_269_919 215
564 3300046642 Ga0495634_0017905 Ga0495634_0017905_1580_2230 215
565 3300046642 Ga0495634_0030366 Ga0495634_0030366_1788_2438 215
566 3300046642 Ga0495634_0105391 Ga0495634_0105391_1080_1730 215
567 3300046648 Ga0495611_0014391 Ga0495611_0014391_921_1571 215
568 3300046660 Ga0495625_0150830 Ga0495625_0150830_173_823 215
569 3300046663 Ga0495635_0000808 Ga0495635_0000808_3487_4137 215
570 3300046663 Ga0495635_0012987 Ga0495635_0012987_4538_5188 215
571 3300046665 Ga0495661_0029761 Ga0495661_0029761_1228_1878 215
572 3300046674 Ga0495588_0120789 Ga0495588_0120789_595_1245 215
573 3300046675 Ga0495657_0006631 Ga0495657_0006631_6593_7243 215
574 3300046678 Ga0495599_0114953 Ga0495599_0114953_896_1546 215
575 3300046679 Ga0495623_0002630 Ga0495623_0002630_659_1309 215
576 3300046680 Ga0495646_0000952 Ga0495646_0000952_950_1600 215
577 3300046680 Ga0495646_0001837 Ga0495646_0001837_6489_7136 215
578 3300046680 Ga0495646_0005306 Ga0495646_0005306_3963_4613 215
579 3300046689 Ga0495613_0030037 Ga0495613_0030037_2566_3216 215
580 3300046689 Ga0495613_0055461 Ga0495613_0055461_2203_2850 215
581 3300046690 Ga0495624_0000059 Ga0495624_0000059_13697_14347 215
582 3300046690 Ga0495624_0000062 Ga0495624_0000062_28004_28651 215
583 3300046690 Ga0495624_0003825 Ga0495624_0003825_9720_10370 215
584 3300046690 Ga0495624_0015100 Ga0495624_0015100_800_1450 215
585 3300046694 Ga0495649_0019755 Ga0495649_0019755_1297_1947 215
586 3300046809 Ga0495600_0000851 Ga0495600_0000851_5880_6530 215
587 3300047315 Ga0495581_0027177 Ga0495581_0027177_1731_2381 215
588 3300047315 Ga0495581_0046679 Ga0495581_0046679_977_1627 215
589 3300047317 Ga0495604_0003227 Ga0495604_0003227_984_1634 215
590 3300047317 Ga0495604_0070467 Ga0495604_0070467_825_1475 215
591 3300047317 Ga0495604_0095892 Ga0495604_0095892_1208_1858 215
592 3300047319 Ga0495674_0000180 Ga0495674_0000180_39267_39914 215
593 3300047319 Ga0495674_0027686 Ga0495674_0027686_3791_4441 215
594 3300047319 Ga0495674_0051948 Ga0495674_0051948_2017_2667 215
595 3300047319 Ga0495674_0057137 Ga0495674_0057137_749_1399 215
596 3300047319 Ga0495674_0171118 Ga0495674_0171118_987_1637 215
597 3300047320 Ga0495672_0034396 Ga0495672_0034396_1542_2192 215
598 3300047320 Ga0495672_0045383 Ga0495672_0045383_1090_1746 215
599 3300047321 Ga0495676_0033814 Ga0495676_0033814_52_702 215
600 3300047321 Ga0495676_0072679 Ga0495676_0072679_1417_2064 215
601 3300047322 Ga0495680_0019384 Ga0495680_0019384_3060_3710 215
602 3300047322 Ga0495680_0083084 Ga0495680_0083084_357_1007 215
603 3300047323 Ga0495683_0008827 Ga0495683_0008827_318_968 215
604 3300047323 Ga0495683_0016086 Ga0495683_0016086_1681_2331 215
605 3300047444 Ga0495675_0011811 Ga0495675_0011811_1676_2326 215
606 3300047444 Ga0495675_0044820 Ga0495675_0044820_1119_1769 215
607 3300047444 Ga0495675_0054610 Ga0495675_0054610_458_1108 215
608 3300047444 Ga0495675_0167352 Ga0495675_0167352_23_673 215
609 3300047446 Ga0495679_002634 Ga0495679_002634_7272_7922 215
610 3300047469 Ga0495673_0017387 Ga0495673_0017387_1595_2245 215
611 3300047469 Ga0495673_0086757 Ga0495673_0086757_87_743 215
612 3300047471 Ga0495684_0073997 Ga0495684_0073997_1918_2568 215
613 3300047472 Ga0495686_0021021 Ga0495686_0021021_173_823 215
614 3300047673 Ga0495593_0000061 Ga0495593_0000061_5427_6074 215
615 3300047673 Ga0495593_0011715 Ga0495593_0011715_2301_2951 215
616 3300047673 Ga0495593_0035425 Ga0495593_0035425_503_1153 215
617 3300048088 Ga0495602_0014244 Ga0495602_0014244_491_1141 215
618 3300048088 Ga0495602_0033590 Ga0495602_0033590_1429_2079 215
619 3300048088 Ga0495602_0053499 Ga0495602_0053499_781_1431 215
620 3300048088 Ga0495602_0075197 Ga0495602_0075197_1265_1915 215
621 3300048088 Ga0495602_0082088 Ga0495602_0082088_1558_2208 215
622 3300048088 Ga0495602_0102737 Ga0495602_0102737_363_1013 215
623 3300048088 Ga0495602_0116835 Ga0495602_0116835_155_805 215
624 3300048089 Ga0495614_0022859 Ga0495614_0022859_342_992 215
625 3300048089 Ga0495614_0030984 Ga0495614_0030984_1501_2151 215
626 3300048089 Ga0495614_0086643 Ga0495614_0086643_211_858 215
627 3300048089 Ga0495614_0168790 Ga0495614_0168790_40_690 215
628 3300048905 Ga0496102_0075415 Ga0496102_0075415_646_1296 215
629 3300048918 Ga0496115_0287273 Ga0496115_0287273_68_718 215
630 3300048920 Ga0496117_0163476 Ga0496117_0163476_488_1138 215
631 3300048921 Ga0496118_0000445 Ga0496118_0000445_48114_48761 215
632 3300048921 Ga0496118_0043282 Ga0496118_0043282_985_1635 215
633 3300048925 Ga0496122_0099892 Ga0496122_0099892_788_1438 215
634 3300048929 Ga0496126_0001268 Ga0496126_0001268_15735_16385 215
635 3300049460 Ga0495682_0013094 Ga0495682_0013094_1367_2017 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

192

248

0.97

PF00072

Response_reg

Response regulator receiver domain

49

161

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a5s-assembly1.cif.gz_AAA crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. 0.974 145 204
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9716 145 208
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9673 145 208
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9664 146 208
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9629 1 118
ID Description Score Start End Superfamily
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9629 1 118 3.40.50.2300
3cz5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9616 1 139 3.40.50.2300
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9582 143 210 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9571 149 205 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9537 143 210 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A536SDC8-F1-model_v4 Response regulator transcription factor 0.8669 3 157 GO:0000160
AF-A0A3N1ZY91-F1-model_v4 DNA-binding NarL/FixJ family response regulator 0.8557 1 144 GO:0000160
GO:0003677
AF-A0A534XNF7-F1-model_v4 Response regulator transcription factor 0.8507 2 156 GO:0000160
GO:0003677
AF-A0A536SDC8-F1-model_v4 Response regulator transcription factor 0.8358 3 157 GO:0000160
AF-A0A4U3AJ83-F1-model_v4 deleted 0.8221 1 157

Feature Viewer

pLDDT pTM Quality
91.29 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map