F471258
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 635 | 293 | 588 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10018442|Ga0163162_100184425 |
| Length | 260 |
| Sequence | MHHEFSVAFMAQCPCASFMPANLAGIFLSDARRSLRGAQRGTYPAMTRVLISDDHTLVRDGLRHILDSADGIEVAGEASDGATTIAMIREIPADVLVLDLSMPGRNGVELLKQIKDEKPALRVLILTMHAEQQYAVRAFKAGASGYLTKESASAELVAAVNKLASGGVYVSLAMAERLALSLYERGDDLPHQRLSDREFEVFRRIAGGETITQIAQALSVSAKTISTYKTRILDKMQMPHDAALVRYAVRQKLFEDDHET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 2 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 3 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 4 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 5 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 6 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 7 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 8 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 9 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 10 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 11 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 12 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 13 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 14 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 15 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 16 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 17 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 18 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 19 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 20 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 21 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 22 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 23 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 24 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 25 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 26 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 27 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 28 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 29 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 30 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 31 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 32 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 33 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 34 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 35 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 36 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 37 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 38 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 39 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 96 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 155 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 156 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 157 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 158 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 159 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 160 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 161 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 162 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 163 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 164 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 258 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 259 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 260 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 261 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 262 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 263 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 264 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 265 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 268 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 283 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 284 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 285 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 286 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 287 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 288 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 289 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 290 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 291 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 292 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 293 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.65 |
| Metatranscriptomes | 1.1 |
| Isolates | 7.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.83 |
| Nodule | 1.89 |
| Rhizoplane | 6.14 |
| Rhizosphere | 78.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10012722 | 3300001989 | Bacteria | 3085 |
| 2 | JGI24739J22299_10026164 | 3300001989 | Bacteria | 2049 |
| 3 | JGI24739J22299_10031933 | 3300001989 | Bacteria | 1816 |
| 4 | JGI24737J22298_10032965 | 3300001990 | Bacteria | 1611 |
| 5 | JGI24735J21928_10006689 | 3300002067 | Bacteria | 3784 |
| 6 | JGI24735J21928_10009537 | 3300002067 | Bacteria | 3113 |
| 7 | JGI24735J21928_10019398 | 3300002067 | Bacteria | 2090 |
| 8 | JGI25156J39149_1000356 | 3300002705 | Bacteria | 29641 |
| 9 | JGI25156J39149_1000856 | 3300002705 | Bacteria | 15160 |
| 10 | JGI25151J46595_10010761 | 3300003187 | Bacteria | 4233 |
| 11 | JGI25165J46597_1001118 | 3300003214 | Bacteria | 16924 |
| 12 | rootH2_10005359 | 3300003320 | Bacteria | 12606 |
| 13 | rootH2_10108596 | 3300003320 | Bacteria | 10417 |
| 14 | rootL2_10003788 | 3300003322 | Bacteria | 5631 |
| 15 | rootH1_10076393 | 3300003323 | Bacteria | 2762 |
| 16 | rootH1_10089848 | 3300003323 | Bacteria | 4992 |
| 17 | rootH1_10221373 | 3300003323 | Bacteria | 1877 |
| 18 | JGI25160J50197_1024162 | 3300003354 | Bacteria | 1731 |
| 19 | Ga0055533_1000072 | 3300003756 | Bacteria | 144571 |
| 20 | Ga0055532_1000013 | 3300003758 | Bacteria | 380677 |
| 21 | Ga0055532_1000434 | 3300003758 | Bacteria | 19777 |
| 22 | Ga0055527_1000010 | 3300003760 | Bacteria | 380677 |
| 23 | Ga0055527_1000153 | 3300003760 | Bacteria | 48693 |
| 24 | Ga0055535_1000010 | 3300003761 | Bacteria | 380677 |
| 25 | Ga0055535_1000316 | 3300003761 | Bacteria | 48693 |
| 26 | Ga0055542_1000016 | 3300003762 | Bacteria | 380677 |
| 27 | Ga0055542_1001996 | 3300003762 | Bacteria | 7873 |
| 28 | Ga0055529_1000012 | 3300003763 | Bacteria | 380677 |
| 29 | Ga0055526_1024025 | 3300003771 | Bacteria | 2010 |
| 30 | Ga0065165_1000040 | 3300005262 | Bacteria | 205767 |
| 31 | Ga0065712_10186121 | 3300005290 | Bacteria | 1169 |
| 32 | Ga0070658_10021856 | 3300005327 | Bacteria | 5129 |
| 33 | Ga0070670_100089804 | 3300005331 | Bacteria | 2641 |
| 34 | Ga0070660_100036558 | 3300005339 | Bacteria | 3720 |
| 35 | Ga0070660_100658236 | 3300005339 | Bacteria | 877 |
| 36 | Ga0070689_100362370 | 3300005340 | Bacteria | 1218 |
| 37 | Ga0070689_100819759 | 3300005340 | Bacteria | 819 |
| 38 | Ga0070661_100178432 | 3300005344 | Bacteria | 1615 |
| 39 | Ga0070668_100005466 | 3300005347 | Bacteria | 9432 |
| 40 | Ga0070675_100078523 | 3300005354 | Bacteria | 2749 |
| 41 | Ga0070673_100099144 | 3300005364 | Bacteria | 2396 |
| 42 | Ga0070659_100028345 | 3300005366 | Bacteria | 4323 |
| 43 | Ga0070667_100161251 | 3300005367 | Bacteria | 1975 |
| 44 | Ga0070714_100012222 | 3300005435 | Bacteria | 6847 |
| 45 | Ga0070663_100237218 | 3300005455 | Bacteria | 1438 |
| 46 | Ga0070662_100189570 | 3300005457 | Unclassified | 1625 |
| 47 | Ga0070662_100736792 | 3300005457 | Bacteria | 835 |
| 48 | Ga0070706_100766031 | 3300005467 | Bacteria | 894 |
| 49 | Ga0070698_100048197 | 3300005471 | Bacteria | 4354 |
| 50 | Ga0070697_100135410 | 3300005536 | Bacteria | 2068 |
| 51 | Ga0070697_100919077 | 3300005536 | Bacteria | 777 |
| 52 | Ga0068853_100052639 | 3300005539 | Bacteria | 3506 |
| 53 | Ga0070696_100316191 | 3300005546 | Bacteria | 1200 |
| 54 | Ga0070665_100026850 | 3300005548 | Bacteria | 5800 |
| 55 | Ga0070665_100226472 | 3300005548 | Bacteria | 1870 |
| 56 | Ga0068855_100149587 | 3300005563 | Bacteria | 2655 |
| 57 | Ga0068856_100432149 | 3300005614 | Bacteria | 1337 |
| 58 | Ga0068864_100343969 | 3300005618 | Bacteria | 1406 |
| 59 | Ga0068858_100077335 | 3300005842 | Bacteria | 3091 |
| 60 | Ga0068858_100857952 | 3300005842 | Bacteria | 887 |
| 61 | Ga0070717_10560174 | 3300006028 | Bacteria | 1035 |
| 62 | Ga0070716_100422458 | 3300006173 | Bacteria | 964 |
| 63 | Ga0097621_100004366 | 3300006237 | Bacteria | 9833 |
| 64 | Ga0075434_100110110 | 3300006871 | Bacteria | 2765 |
| 65 | Ga0068865_100445146 | 3300006881 | Bacteria | 1070 |
| 66 | Ga0075436_100064402 | 3300006914 | Bacteria | 2534 |
| 67 | Ga0105251_10000069 | 3300009011 | Bacteria | 98334 |
| 68 | Ga0105251_10005574 | 3300009011 | Bacteria | 8191 |
| 69 | Ga0105251_10049052 | 3300009011 | Bacteria | 2023 |
| 70 | Ga0105250_10093739 | 3300009092 | Bacteria | 1223 |
| 71 | Ga0105240_10017557 | 3300009093 | Bacteria | 9640 |
| 72 | Ga0105240_10034713 | 3300009093 | Bacteria | 6503 |
| 73 | Ga0105240_10096577 | 3300009093 | Bacteria | 3601 |
| 74 | Ga0105240_10121287 | 3300009093 | Bacteria | 3147 |
| 75 | Ga0105240_10163508 | 3300009093 | Bacteria | 2641 |
| 76 | Ga0105240_10200084 | 3300009093 | Bacteria | 2342 |
| 77 | Ga0105240_10218952 | 3300009093 | Bacteria | 2219 |
| 78 | Ga0105240_10701677 | 3300009093 | Bacteria | 1104 |
| 79 | Ga0105241_10789944 | 3300009174 | Unclassified | 874 |
| 80 | Ga0105242_10007665 | 3300009176 | Bacteria | 8307 |
| 81 | Ga0105248_10231170 | 3300009177 | Bacteria | 2082 |
| 82 | Ga0105237_10297839 | 3300009545 | Bacteria | 1616 |
| 83 | Ga0105238_10003214 | 3300009551 | Bacteria | 16317 |
| 84 | Ga0105238_10008459 | 3300009551 | Bacteria | 10303 |
| 85 | Ga0105238_10421317 | 3300009551 | Bacteria | 1330 |
| 86 | Ga0157371_10074243 | 3300013102 | Bacteria | 2409 |
| 87 | Ga0157370_10003155 | 3300013104 | Bacteria | 19532 |
| 88 | Ga0157370_10014496 | 3300013104 | Bacteria | 8057 |
| 89 | Ga0157370_10194965 | 3300013104 | Bacteria | 1880 |
| 90 | Ga0157370_10332212 | 3300013104 | Bacteria | 1401 |
| 91 | Ga0157369_10000145 | 3300013105 | Bacteria | 100895 |
| 92 | Ga0157369_10000293 | 3300013105 | Bacteria | 66670 |
| 93 | Ga0157369_10051315 | 3300013105 | Bacteria | 4464 |
| 94 | Ga0157369_10076466 | 3300013105 | Bacteria | 3588 |
| 95 | Ga0157369_10159418 | 3300013105 | Bacteria | 2382 |
| 96 | Ga0157374_10726532 | 3300013296 | Bacteria | 1007 |
| 97 | Ga0163162_10018442 | 3300013306 | Bacteria | 6838 |
| 98 | Ga0163162_10375633 | 3300013306 | Bacteria | 1554 |
| 99 | Ga0157380_10250481 | 3300014326 | Bacteria | 1603 |
| 100 | Ga0157380_10469252 | 3300014326 | Bacteria | 1214 |
| 101 | Ga0157376_10254357 | 3300014969 | Bacteria | 1642 |
| 102 | Ga0182007_10002791 | 3300015262 | Bacteria | 8509 |
| 103 | Ga0197907_10509736 | 3300020069 | Bacteria | 2233 |
| 104 | Ga0206356_11033659 | 3300020070 | Bacteria | 1415 |
| 105 | Ga0206355_1458904 | 3300020076 | Bacteria | 1533 |
| 106 | Ga0206350_10742459 | 3300020080 | Bacteria | 1931 |
| 107 | Ga0206354_11125356 | 3300020081 | Bacteria | 2927 |
| 108 | Ga0206353_10180509 | 3300020082 | Bacteria | 2692 |
| 109 | Ga0224712_10000027 | 3300022467 | Bacteria | 22074 |
| 110 | Ga0209674_100011 | 3300025226 | Bacteria | 997175 |
| 111 | Ga0209674_102961 | 3300025226 | Bacteria | 3326 |
| 112 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 113 | Ga0209672_100012 | 3300025228 | Bacteria | 795742 |
| 114 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 115 | Ga0209147_100007 | 3300025229 | Bacteria | 795684 |
| 116 | Ga0209563_100990 | 3300025230 | Bacteria | 8331 |
| 117 | Ga0207427_103698 | 3300025231 | Bacteria | 3013 |
| 118 | Ga0209258_100014 | 3300025242 | Bacteria | 720132 |
| 119 | Ga0209258_100042 | 3300025242 | Bacteria | 380729 |
| 120 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 121 | Ga0209148_1000287 | 3300025254 | Bacteria | 75762 |
| 122 | Ga0209759_1000028 | 3300025256 | Bacteria | 298755 |
| 123 | Ga0209759_1000051 | 3300025256 | Bacteria | 214016 |
| 124 | Ga0209233_1000033 | 3300025261 | Bacteria | 596094 |
| 125 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 126 | Ga0209455_1000664 | 3300025272 | Bacteria | 20829 |
| 127 | Ga0209455_1000720 | 3300025272 | Bacteria | 19165 |
| 128 | Ga0209130_1004156 | 3300025284 | Bacteria | 5672 |
| 129 | Ga0209025_1001263 | 3300025294 | Bacteria | 34922 |
| 130 | Ga0209025_1002150 | 3300025294 | Bacteria | 22035 |
| 131 | Ga0209564_1008013 | 3300025295 | Bacteria | 5303 |
| 132 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 133 | Ga0207426_1002029 | 3300025302 | Bacteria | 14200 |
| 134 | Ga0207696_1055691 | 3300025711 | Bacteria | 1121 |
| 135 | Ga0207713_1001033 | 3300025735 | Bacteria | 24198 |
| 136 | Ga0207713_1024904 | 3300025735 | Bacteria | 2776 |
| 137 | Ga0207647_10024398 | 3300025904 | Bacteria | 3987 |
| 138 | Ga0207647_10063461 | 3300025904 | Bacteria | 2246 |
| 139 | Ga0207705_10005089 | 3300025909 | Bacteria | 9856 |
| 140 | Ga0207695_10017601 | 3300025913 | Bacteria | 8305 |
| 141 | Ga0207695_10225491 | 3300025913 | Bacteria | 1780 |
| 142 | Ga0207695_10251676 | 3300025913 | Bacteria | 1666 |
| 143 | Ga0207657_10195860 | 3300025919 | Bacteria | 1628 |
| 144 | Ga0207694_10018489 | 3300025924 | Bacteria | 5267 |
| 145 | Ga0207694_10242101 | 3300025924 | Bacteria | 1474 |
| 146 | Ga0207694_10368702 | 3300025924 | Bacteria | 1191 |
| 147 | Ga0207694_10409052 | 3300025924 | Bacteria | 1129 |
| 148 | Ga0207650_10096584 | 3300025925 | Bacteria | 2267 |
| 149 | Ga0207659_10061563 | 3300025926 | Bacteria | 2705 |
| 150 | Ga0207664_10190855 | 3300025929 | Bacteria | 1763 |
| 151 | Ga0207690_10010816 | 3300025932 | Bacteria | 5437 |
| 152 | Ga0207706_10083641 | 3300025933 | Unclassified | 2806 |
| 153 | Ga0207706_10707761 | 3300025933 | Bacteria | 860 |
| 154 | Ga0207686_10012545 | 3300025934 | Bacteria | 4661 |
| 155 | Ga0207709_10620641 | 3300025935 | Bacteria | 858 |
| 156 | Ga0207704_10115259 | 3300025938 | Bacteria | 1826 |
| 157 | Ga0207691_10175879 | 3300025940 | Bacteria | 1872 |
| 158 | Ga0207711_10292136 | 3300025941 | Bacteria | 1502 |
| 159 | Ga0207667_10006817 | 3300025949 | Bacteria | 13803 |
| 160 | Ga0207668_10020162 | 3300025972 | Bacteria | 4230 |
| 161 | Ga0207658_10242497 | 3300025986 | Bacteria | 1528 |
| 162 | Ga0207703_10167636 | 3300026035 | Bacteria | 1929 |
| 163 | Ga0207639_10000006 | 3300026041 | Bacteria | 544415 |
| 164 | Ga0207639_10911050 | 3300026041 | Bacteria | 822 |
| 165 | Ga0207702_10565599 | 3300026078 | Bacteria | 1113 |
| 166 | Ga0207648_10223395 | 3300026089 | Bacteria | 1674 |
| 167 | Ga0207676_10258049 | 3300026095 | Bacteria | 1572 |
| 168 | Ga0268266_10018312 | 3300028379 | Bacteria | 5970 |
| 169 | Ga0265319_1029842 | 3300028563 | Bacteria | 1912 |
| 170 | Ga0307515_10078871 | 3300028794 | Bacteria | 4323 |
| 171 | Ga0265338_10000159 | 3300028800 | Bacteria | 123495 |
| 172 | Ga0265338_10003994 | 3300028800 | Bacteria | 20275 |
| 173 | Ga0265342_10104752 | 3300031712 | Bacteria | 1607 |
| 174 | Ga0373932_0000074 | 3300035112 | Bacteria | 25250 |
| 175 | Ga0373932_0000318 | 3300035112 | Bacteria | 14684 |
| 176 | Ga0373953_0054236 | 3300035117 | Bacteria | 1626 |
| 177 | Ga0373933_0217228 | 3300035724 | Bacteria | 1226 |
| 178 | Ga0373937_0037938 | 3300036401 | Bacteria | 4391 |
| 179 | Ga0373925_0538364 | 3300037068 | Bacteria | 960 |
| 180 | Ga0395899_0000005 | 3300037312 | Bacteria | 772966 |
| 181 | Ga0395899_0133072 | 3300037312 | Bacteria | 1774 |
| 182 | Ga0395900_0000003 | 3300037418 | Bacteria | 587648 |
| 183 | Ga0395900_0000053 | 3300037418 | Bacteria | 221135 |
| 184 | Ga0395900_0001448 | 3300037418 | Bacteria | 28301 |
| 185 | Ga0395900_0012574 | 3300037418 | Bacteria | 8662 |
| 186 | Ga0395900_0048919 | 3300037418 | Bacteria | 4354 |
| 187 | Ga0395900_0071313 | 3300037418 | Bacteria | 3571 |
| 188 | Ga0395900_0072560 | 3300037418 | Bacteria | 3539 |
| 189 | Ga0395900_0101776 | 3300037418 | Bacteria | 2951 |
| 190 | Ga0395898_0000003 | 3300037466 | Bacteria | 772986 |
| 191 | Ga0395898_0001273 | 3300037466 | Bacteria | 37246 |
| 192 | Ga0395898_0071913 | 3300037466 | Bacteria | 3342 |
| 193 | Ga0395898_0186246 | 3300037466 | Bacteria | 1983 |
| 194 | Ga0395905_0000035 | 3300037471 | Bacteria | 272014 |
| 195 | Ga0395901_0000004 | 3300038443 | Bacteria | 657361 |
| 196 | Ga0395901_0000042 | 3300038443 | Bacteria | 201819 |
| 197 | Ga0395901_0000130 | 3300038443 | Bacteria | 97728 |
| 198 | Ga0395901_0036096 | 3300038443 | Bacteria | 5107 |
| 199 | Ga0395901_0608523 | 3300038443 | Bacteria | 1101 |
| 200 | Ga0451577_0122113 | 3300042876 | Bacteria | 2334 |
| 201 | Ga0466969_0001183 | 3300044656 | Bacteria | 14087 |
| 202 | Ga0466969_0004417 | 3300044656 | Bacteria | 7479 |
| 203 | Ga0466973_0008737 | 3300044659 | Bacteria | 9211 |
| 204 | Ga0466965_0020294 | 3300044683 | Bacteria | 3193 |
| 205 | Ga0466965_0048170 | 3300044683 | Bacteria | 2111 |
| 206 | Ga0466966_0000029 | 3300044684 | Bacteria | 104527 |
| 207 | Ga0466966_0004888 | 3300044684 | Bacteria | 8806 |
| 208 | Ga0466966_0017051 | 3300044684 | Bacteria | 4803 |
| 209 | Ga0466966_0051786 | 3300044684 | Bacteria | 2609 |
| 210 | Ga0466961_0001351 | 3300044693 | Bacteria | 15111 |
| 211 | Ga0466961_0003113 | 3300044693 | Bacteria | 10330 |
| 212 | Ga0466961_0011759 | 3300044693 | Bacteria | 5593 |
| 213 | Ga0466961_0022028 | 3300044693 | Bacteria | 4101 |
| 214 | Ga0466961_0057733 | 3300044693 | Bacteria | 2470 |
| 215 | Ga0466961_0180873 | 3300044693 | Bacteria | 1309 |
| 216 | Ga0466963_0000211 | 3300044694 | Bacteria | 24901 |
| 217 | Ga0466963_0000725 | 3300044694 | Bacteria | 16157 |
| 218 | Ga0466963_0009541 | 3300044694 | Bacteria | 5845 |
| 219 | Ga0466963_0019497 | 3300044694 | Bacteria | 4256 |
| 220 | Ga0466964_0041026 | 3300044706 | Bacteria | 1870 |
| 221 | Ga0466971_0003180 | 3300044719 | Bacteria | 7007 |
| 222 | Ga0466971_0018269 | 3300044719 | Bacteria | 3105 |
| 223 | Ga0466971_0021399 | 3300044719 | Bacteria | 2878 |
| 224 | Ga0466971_0166041 | 3300044719 | Bacteria | 1034 |
| 225 | Ga0466968_0016888 | 3300044735 | Bacteria | 2910 |
| 226 | Ga0466970_0019110 | 3300044765 | Bacteria | 3551 |
| 227 | Ga0466970_0052199 | 3300044765 | Bacteria | 2182 |
| 228 | Ga0466957_0015354 | 3300044842 | Bacteria | 4473 |
| 229 | Ga0466957_0016207 | 3300044842 | Bacteria | 4358 |
| 230 | Ga0466957_0034079 | 3300044842 | Bacteria | 3055 |
| 231 | Ga0466957_0037843 | 3300044842 | Bacteria | 2905 |
| 232 | Ga0466957_0337906 | 3300044842 | Bacteria | 1019 |
| 233 | Ga0466959_0015408 | 3300045049 | Bacteria | 5568 |
| 234 | Ga0466959_0355426 | 3300045049 | Bacteria | 998 |
| 235 | Ga0466958_0012260 | 3300045836 | Bacteria | 4852 |
| 236 | Ga0466958_0048288 | 3300045836 | Bacteria | 2572 |
| 237 | Ga0466958_0053025 | 3300045836 | Bacteria | 2459 |
| 238 | Ga0495592_0065657 | 3300046454 | Bacteria | 2656 |
| 239 | Ga0495592_0200674 | 3300046454 | Bacteria | 1346 |
| 240 | Ga0495603_0002093 | 3300046455 | Bacteria | 11739 |
| 241 | Ga0495603_0047427 | 3300046455 | Bacteria | 2558 |
| 242 | Ga0495603_0084085 | 3300046455 | Bacteria | 1863 |
| 243 | Ga0495590_0007124 | 3300046457 | Bacteria | 4327 |
| 244 | Ga0495590_0073213 | 3300046457 | Bacteria | 1204 |
| 245 | Ga0495629_0000224 | 3300046459 | Bacteria | 50510 |
| 246 | Ga0495629_0000249 | 3300046459 | Bacteria | 46689 |
| 247 | Ga0495629_0001627 | 3300046459 | Bacteria | 17647 |
| 248 | Ga0495629_0001671 | 3300046459 | Bacteria | 17413 |
| 249 | Ga0495629_0001695 | 3300046459 | Bacteria | 17311 |
| 250 | Ga0495629_0010138 | 3300046459 | Bacteria | 6872 |
| 251 | Ga0495629_0038919 | 3300046459 | Bacteria | 3348 |
| 252 | Ga0495629_0165957 | 3300046459 | Bacteria | 1533 |
| 253 | Ga0495641_0023325 | 3300046461 | Bacteria | 3077 |
| 254 | Ga0495641_0118837 | 3300046461 | Bacteria | 1179 |
| 255 | Ga0495651_0094787 | 3300046462 | Bacteria | 2233 |
| 256 | Ga0495651_0103105 | 3300046462 | Bacteria | 2120 |
| 257 | Ga0495651_0103184 | 3300046462 | Bacteria | 2119 |
| 258 | Ga0495651_0350213 | 3300046462 | Bacteria | 976 |
| 259 | Ga0495651_0424151 | 3300046462 | Bacteria | 864 |
| 260 | Ga0495653_0000942 | 3300046463 | Bacteria | 22393 |
| 261 | Ga0495653_0001591 | 3300046463 | Bacteria | 17839 |
| 262 | Ga0495653_0001903 | 3300046463 | Bacteria | 16451 |
| 263 | Ga0495653_0005724 | 3300046463 | Bacteria | 10161 |
| 264 | Ga0495653_0021842 | 3300046463 | Bacteria | 5179 |
| 265 | Ga0495653_0028865 | 3300046463 | Bacteria | 4435 |
| 266 | Ga0495653_0052357 | 3300046463 | Bacteria | 3128 |
| 267 | Ga0495653_0053827 | 3300046463 | Bacteria | 3078 |
| 268 | Ga0495653_0098115 | 3300046463 | Bacteria | 2128 |
| 269 | Ga0495653_0141106 | 3300046463 | Bacteria | 1694 |
| 270 | Ga0495650_0001852 | 3300046471 | Bacteria | 18928 |
| 271 | Ga0495650_0003687 | 3300046471 | Bacteria | 10978 |
| 272 | Ga0495580_0000355 | 3300046472 | Bacteria | 37382 |
| 273 | Ga0495580_0001105 | 3300046472 | Bacteria | 23679 |
| 274 | Ga0495580_0002219 | 3300046472 | Bacteria | 16996 |
| 275 | Ga0495580_0002335 | 3300046472 | Bacteria | 16559 |
| 276 | Ga0495580_0011077 | 3300046472 | Bacteria | 6989 |
| 277 | Ga0495580_0042306 | 3300046472 | Bacteria | 3246 |
| 278 | Ga0495580_0131331 | 3300046472 | Bacteria | 1737 |
| 279 | Ga0495580_0215990 | 3300046472 | Bacteria | 1318 |
| 280 | Ga0495580_0372097 | 3300046472 | Bacteria | 966 |
| 281 | Ga0495582_0004443 | 3300046473 | Bacteria | 7889 |
| 282 | Ga0495582_0005945 | 3300046473 | Bacteria | 6805 |
| 283 | Ga0495582_0057919 | 3300046473 | Bacteria | 2136 |
| 284 | Ga0495582_0060879 | 3300046473 | Bacteria | 2083 |
| 285 | Ga0495582_0210040 | 3300046473 | Bacteria | 1112 |
| 286 | Ga0495605_0022344 | 3300046474 | Bacteria | 3342 |
| 287 | Ga0495605_0058470 | 3300046474 | Bacteria | 1853 |
| 288 | Ga0495605_0058847 | 3300046474 | Bacteria | 1846 |
| 289 | Ga0495639_0143893 | 3300046475 | Bacteria | 1147 |
| 290 | Ga0495662_0029085 | 3300046476 | Bacteria | 2668 |
| 291 | Ga0495662_0101983 | 3300046476 | Bacteria | 1404 |
| 292 | Ga0495664_0001056 | 3300046477 | Bacteria | 14231 |
| 293 | Ga0495664_0001152 | 3300046477 | Bacteria | 13732 |
| 294 | Ga0495664_0012627 | 3300046477 | Bacteria | 4786 |
| 295 | Ga0495664_0043690 | 3300046477 | Bacteria | 2655 |
| 296 | Ga0495664_0134400 | 3300046477 | Bacteria | 1498 |
| 297 | Ga0495596_0023148 | 3300046500 | Bacteria | 2522 |
| 298 | Ga0495607_0065134 | 3300046501 | Bacteria | 2056 |
| 299 | Ga0495583_0002761 | 3300046506 | Bacteria | 14497 |
| 300 | Ga0495583_0037118 | 3300046506 | Bacteria | 2312 |
| 301 | Ga0495606_0045942 | 3300046507 | Bacteria | 2890 |
| 302 | Ga0495608_0004535 | 3300046511 | Bacteria | 9923 |
| 303 | Ga0495610_0002901 | 3300046512 | Bacteria | 13874 |
| 304 | Ga0495616_0048759 | 3300046513 | Bacteria | 2126 |
| 305 | Ga0495616_0094322 | 3300046513 | Bacteria | 1412 |
| 306 | Ga0495618_0005997 | 3300046514 | Bacteria | 7384 |
| 307 | Ga0495618_0040229 | 3300046514 | Bacteria | 2941 |
| 308 | Ga0495618_0054741 | 3300046514 | Bacteria | 2525 |
| 309 | Ga0495620_0021272 | 3300046515 | Bacteria | 3152 |
| 310 | Ga0495628_0000239 | 3300046516 | Bacteria | 48349 |
| 311 | Ga0495628_0009868 | 3300046516 | Bacteria | 8133 |
| 312 | Ga0495628_0014304 | 3300046516 | Bacteria | 6657 |
| 313 | Ga0495628_0014998 | 3300046516 | Bacteria | 6475 |
| 314 | Ga0495628_0026057 | 3300046516 | Bacteria | 4773 |
| 315 | Ga0495628_0041436 | 3300046516 | Bacteria | 3676 |
| 316 | Ga0495628_0066259 | 3300046516 | Bacteria | 2823 |
| 317 | Ga0495628_0085025 | 3300046516 | Bacteria | 2454 |
| 318 | Ga0495628_0093641 | 3300046516 | Bacteria | 2323 |
| 319 | Ga0495628_0331982 | 3300046516 | Bacteria | 1120 |
| 320 | Ga0495630_0009125 | 3300046517 | Bacteria | 7133 |
| 321 | Ga0495630_0012843 | 3300046517 | Bacteria | 6087 |
| 322 | Ga0495630_0014371 | 3300046517 | Bacteria | 5767 |
| 323 | Ga0495630_0043128 | 3300046517 | Bacteria | 3369 |
| 324 | Ga0495630_0050641 | 3300046517 | Bacteria | 3108 |
| 325 | Ga0495630_0057170 | 3300046517 | Bacteria | 2923 |
| 326 | Ga0495643_0036642 | 3300046522 | Bacteria | 2694 |
| 327 | Ga0495648_0002596 | 3300046524 | Bacteria | 16534 |
| 328 | Ga0495648_0009339 | 3300046524 | Bacteria | 7618 |
| 329 | Ga0495648_0018361 | 3300046524 | Bacteria | 4952 |
| 330 | Ga0495666_0002176 | 3300046526 | Bacteria | 9753 |
| 331 | Ga0495666_0004470 | 3300046526 | Bacteria | 7065 |
| 332 | Ga0495666_0005695 | 3300046526 | Bacteria | 6281 |
| 333 | Ga0495666_0006738 | 3300046526 | Bacteria | 5776 |
| 334 | Ga0495642_0069287 | 3300046528 | Bacteria | 1473 |
| 335 | Ga0495642_0202616 | 3300046528 | Bacteria | 865 |
| 336 | Ga0495652_0021043 | 3300046529 | Bacteria | 5798 |
| 337 | Ga0495652_0031882 | 3300046529 | Bacteria | 4612 |
| 338 | Ga0495652_0043233 | 3300046529 | Bacteria | 3882 |
| 339 | Ga0495652_0148059 | 3300046529 | Bacteria | 1838 |
| 340 | Ga0495652_0390646 | 3300046529 | Bacteria | 987 |
| 341 | Ga0495652_0458204 | 3300046529 | Bacteria | 891 |
| 342 | Ga0495665_0000183 | 3300046531 | Bacteria | 31950 |
| 343 | Ga0495665_0004733 | 3300046531 | Bacteria | 7349 |
| 344 | Ga0495665_0007911 | 3300046531 | Bacteria | 5761 |
| 345 | Ga0495665_0011506 | 3300046531 | Bacteria | 4790 |
| 346 | Ga0495665_0031381 | 3300046531 | Bacteria | 2844 |
| 347 | Ga0495665_0110109 | 3300046531 | Bacteria | 1444 |
| 348 | Ga0495665_0255698 | 3300046531 | Bacteria | 901 |
| 349 | Ga0495665_0319800 | 3300046531 | Bacteria | 792 |
| 350 | Ga0495640_0189870 | 3300046533 | Bacteria | 1306 |
| 351 | Ga0495640_0404861 | 3300046533 | Bacteria | 837 |
| 352 | Ga0495586_0009019 | 3300046535 | Bacteria | 5305 |
| 353 | Ga0495586_0030326 | 3300046535 | Bacteria | 2894 |
| 354 | Ga0495586_0138721 | 3300046535 | Bacteria | 1364 |
| 355 | Ga0495586_0359169 | 3300046535 | Bacteria | 837 |
| 356 | Ga0495587_0001594 | 3300046536 | Bacteria | 15112 |
| 357 | Ga0495609_0056925 | 3300046538 | Bacteria | 1732 |
| 358 | Ga0495597_0039318 | 3300046542 | Bacteria | 2118 |
| 359 | Ga0495645_0000899 | 3300046543 | Bacteria | 20250 |
| 360 | Ga0495645_0001599 | 3300046543 | Bacteria | 15330 |
| 361 | Ga0495645_0009829 | 3300046543 | Bacteria | 6692 |
| 362 | Ga0495645_0051526 | 3300046543 | Bacteria | 2995 |
| 363 | Ga0495645_0059668 | 3300046543 | Bacteria | 2765 |
| 364 | Ga0495645_0382110 | 3300046543 | Bacteria | 901 |
| 365 | Ga0495622_0000022 | 3300046557 | Bacteria | 161180 |
| 366 | Ga0495667_0025442 | 3300046559 | Bacteria | 3988 |
| 367 | Ga0495667_0225013 | 3300046559 | Bacteria | 1197 |
| 368 | Ga0495634_0017905 | 3300046642 | Bacteria | 5049 |
| 369 | Ga0495634_0030366 | 3300046642 | Bacteria | 3732 |
| 370 | Ga0495634_0105391 | 3300046642 | Bacteria | 1818 |
| 371 | Ga0495611_0014391 | 3300046648 | Bacteria | 3379 |
| 372 | Ga0495625_0150830 | 3300046660 | Bacteria | 1563 |
| 373 | Ga0495625_0180373 | 3300046660 | Bacteria | 1405 |
| 374 | Ga0495625_0494241 | 3300046660 | Bacteria | 749 |
| 375 | Ga0495635_0000808 | 3300046663 | Bacteria | 20488 |
| 376 | Ga0495635_0002163 | 3300046663 | Bacteria | 13350 |
| 377 | Ga0495635_0003916 | 3300046663 | Bacteria | 10349 |
| 378 | Ga0495635_0012987 | 3300046663 | Bacteria | 5830 |
| 379 | Ga0495661_0029761 | 3300046665 | Bacteria | 3482 |
| 380 | Ga0495588_0120789 | 3300046674 | Bacteria | 1381 |
| 381 | Ga0495588_0297683 | 3300046674 | Bacteria | 849 |
| 382 | Ga0495657_0006631 | 3300046675 | Bacteria | 9042 |
| 383 | Ga0495599_0003822 | 3300046678 | Bacteria | 8843 |
| 384 | Ga0495599_0005137 | 3300046678 | Bacteria | 7799 |
| 385 | Ga0495599_0044124 | 3300046678 | Bacteria | 2797 |
| 386 | Ga0495599_0059666 | 3300046678 | Bacteria | 2386 |
| 387 | Ga0495599_0114953 | 3300046678 | Bacteria | 1674 |
| 388 | Ga0495623_0000736 | 3300046679 | Bacteria | 21957 |
| 389 | Ga0495623_0002295 | 3300046679 | Bacteria | 12744 |
| 390 | Ga0495623_0002630 | 3300046679 | Bacteria | 11848 |
| 391 | Ga0495623_0006339 | 3300046679 | Bacteria | 7689 |
| 392 | Ga0495623_0078842 | 3300046679 | Bacteria | 2041 |
| 393 | Ga0495623_0196215 | 3300046679 | Bacteria | 1163 |
| 394 | Ga0495646_0000952 | 3300046680 | Bacteria | 16519 |
| 395 | Ga0495646_0001837 | 3300046680 | Bacteria | 12754 |
| 396 | Ga0495646_0004629 | 3300046680 | Bacteria | 8657 |
| 397 | Ga0495646_0005306 | 3300046680 | Bacteria | 8137 |
| 398 | Ga0495646_0011233 | 3300046680 | Bacteria | 5686 |
| 399 | Ga0495646_0055330 | 3300046680 | Bacteria | 2383 |
| 400 | Ga0495646_0078843 | 3300046680 | Bacteria | 1924 |
| 401 | Ga0495647_0067083 | 3300046681 | Bacteria | 1428 |
| 402 | Ga0495669_0074780 | 3300046684 | Bacteria | 1549 |
| 403 | Ga0495613_0010901 | 3300046689 | Bacteria | 6749 |
| 404 | Ga0495613_0030037 | 3300046689 | Bacteria | 4037 |
| 405 | Ga0495613_0055461 | 3300046689 | Bacteria | 2912 |
| 406 | Ga0495624_0000059 | 3300046690 | Bacteria | 70115 |
| 407 | Ga0495624_0000062 | 3300046690 | Bacteria | 67917 |
| 408 | Ga0495624_0000471 | 3300046690 | Bacteria | 31497 |
| 409 | Ga0495624_0003825 | 3300046690 | Bacteria | 11126 |
| 410 | Ga0495624_0015100 | 3300046690 | Bacteria | 5225 |
| 411 | Ga0495624_0067674 | 3300046690 | Bacteria | 2227 |
| 412 | Ga0495624_0071563 | 3300046690 | Bacteria | 2157 |
| 413 | Ga0495624_0197765 | 3300046690 | Bacteria | 1222 |
| 414 | Ga0495671_0122403 | 3300046692 | Bacteria | 1269 |
| 415 | Ga0495649_0019755 | 3300046694 | Bacteria | 3783 |
| 416 | Ga0495649_0091398 | 3300046694 | Bacteria | 1622 |
| 417 | Ga0495649_0132237 | 3300046694 | Bacteria | 1316 |
| 418 | Ga0495589_0017177 | 3300046794 | Bacteria | 3715 |
| 419 | Ga0495589_0024409 | 3300046794 | Bacteria | 3073 |
| 420 | Ga0495589_0199734 | 3300046794 | Bacteria | 944 |
| 421 | Ga0495600_0000367 | 3300046809 | Bacteria | 23668 |
| 422 | Ga0495600_0000851 | 3300046809 | Bacteria | 16267 |
| 423 | Ga0495600_0027629 | 3300046809 | Bacteria | 3667 |
| 424 | Ga0495600_0031310 | 3300046809 | Bacteria | 3446 |
| 425 | Ga0495600_0068240 | 3300046809 | Bacteria | 2324 |
| 426 | Ga0495600_0363358 | 3300046809 | Bacteria | 905 |
| 427 | Ga0495581_0027177 | 3300047315 | Bacteria | 3318 |
| 428 | Ga0495581_0046679 | 3300047315 | Bacteria | 2503 |
| 429 | Ga0495604_0000600 | 3300047317 | Bacteria | 31084 |
| 430 | Ga0495604_0003227 | 3300047317 | Bacteria | 13038 |
| 431 | Ga0495604_0043220 | 3300047317 | Bacteria | 3529 |
| 432 | Ga0495604_0052308 | 3300047317 | Bacteria | 3164 |
| 433 | Ga0495604_0070467 | 3300047317 | Bacteria | 2647 |
| 434 | Ga0495604_0095892 | 3300047317 | Bacteria | 2190 |
| 435 | Ga0495674_0000180 | 3300047319 | Bacteria | 49901 |
| 436 | Ga0495674_0010758 | 3300047319 | Bacteria | 8654 |
| 437 | Ga0495674_0014155 | 3300047319 | Bacteria | 7472 |
| 438 | Ga0495674_0018159 | 3300047319 | Bacteria | 6547 |
| 439 | Ga0495674_0027686 | 3300047319 | Bacteria | 5176 |
| 440 | Ga0495674_0035900 | 3300047319 | Bacteria | 4468 |
| 441 | Ga0495674_0042527 | 3300047319 | Bacteria | 4051 |
| 442 | Ga0495674_0046132 | 3300047319 | Bacteria | 3868 |
| 443 | Ga0495674_0051948 | 3300047319 | Bacteria | 3611 |
| 444 | Ga0495674_0057137 | 3300047319 | Bacteria | 3415 |
| 445 | Ga0495674_0074799 | 3300047319 | Bacteria | 2916 |
| 446 | Ga0495674_0114257 | 3300047319 | Bacteria | 2286 |
| 447 | Ga0495674_0171118 | 3300047319 | Bacteria | 1812 |
| 448 | Ga0495674_0180777 | 3300047319 | Bacteria | 1756 |
| 449 | Ga0495674_0461849 | 3300047319 | Bacteria | 1019 |
| 450 | Ga0495672_0001083 | 3300047320 | Bacteria | 27678 |
| 451 | Ga0495672_0034396 | 3300047320 | Bacteria | 3131 |
| 452 | Ga0495672_0045383 | 3300047320 | Bacteria | 2629 |
| 453 | Ga0495672_0064763 | 3300047320 | Bacteria | 2091 |
| 454 | Ga0495672_0067791 | 3300047320 | Bacteria | 2031 |
| 455 | Ga0495676_0033814 | 3300047321 | Bacteria | 4297 |
| 456 | Ga0495676_0072679 | 3300047321 | Bacteria | 2640 |
| 457 | Ga0495680_0002137 | 3300047322 | Bacteria | 20525 |
| 458 | Ga0495680_0002605 | 3300047322 | Bacteria | 18345 |
| 459 | Ga0495680_0019384 | 3300047322 | Bacteria | 5741 |
| 460 | Ga0495680_0076643 | 3300047322 | Bacteria | 2535 |
| 461 | Ga0495680_0083084 | 3300047322 | Bacteria | 2415 |
| 462 | Ga0495683_0008827 | 3300047323 | Bacteria | 5376 |
| 463 | Ga0495683_0016086 | 3300047323 | Bacteria | 3884 |
| 464 | Ga0495683_0054521 | 3300047323 | Bacteria | 1992 |
| 465 | Ga0495683_0072886 | 3300047323 | Bacteria | 1684 |
| 466 | Ga0495683_0088942 | 3300047323 | Bacteria | 1498 |
| 467 | Ga0495687_035325 | 3300047443 | Bacteria | 2248 |
| 468 | Ga0495687_119178 | 3300047443 | Bacteria | 955 |
| 469 | Ga0495675_0005440 | 3300047444 | Bacteria | 7767 |
| 470 | Ga0495675_0011811 | 3300047444 | Bacteria | 5486 |
| 471 | Ga0495675_0026476 | 3300047444 | Bacteria | 3698 |
| 472 | Ga0495675_0044820 | 3300047444 | Bacteria | 2817 |
| 473 | Ga0495675_0054610 | 3300047444 | Bacteria | 2534 |
| 474 | Ga0495675_0064299 | 3300047444 | Bacteria | 2321 |
| 475 | Ga0495675_0122618 | 3300047444 | Unclassified | 1618 |
| 476 | Ga0495675_0167352 | 3300047444 | Bacteria | 1351 |
| 477 | Ga0495679_002634 | 3300047446 | Bacteria | 9011 |
| 478 | Ga0495673_0017387 | 3300047469 | Bacteria | 3655 |
| 479 | Ga0495673_0028169 | 3300047469 | Bacteria | 2663 |
| 480 | Ga0495673_0067250 | 3300047469 | Bacteria | 1517 |
| 481 | Ga0495673_0086757 | 3300047469 | Bacteria | 1286 |
| 482 | Ga0495684_0073997 | 3300047471 | Bacteria | 2588 |
| 483 | Ga0495686_0000045 | 3300047472 | Bacteria | 284761 |
| 484 | Ga0495686_0021021 | 3300047472 | Bacteria | 4345 |
| 485 | Ga0495593_0000061 | 3300047673 | Bacteria | 45310 |
| 486 | Ga0495593_0003026 | 3300047673 | Bacteria | 10129 |
| 487 | Ga0495593_0011715 | 3300047673 | Bacteria | 5031 |
| 488 | Ga0495593_0020589 | 3300047673 | Bacteria | 3693 |
| 489 | Ga0495593_0035425 | 3300047673 | Bacteria | 2710 |
| 490 | Ga0495602_0001650 | 3300048088 | Bacteria | 22204 |
| 491 | Ga0495602_0013840 | 3300048088 | Bacteria | 8224 |
| 492 | Ga0495602_0014244 | 3300048088 | Bacteria | 8079 |
| 493 | Ga0495602_0033590 | 3300048088 | Bacteria | 4810 |
| 494 | Ga0495602_0047318 | 3300048088 | Bacteria | 3876 |
| 495 | Ga0495602_0053499 | 3300048088 | Bacteria | 3575 |
| 496 | Ga0495602_0075197 | 3300048088 | Bacteria | 2867 |
| 497 | Ga0495602_0082088 | 3300048088 | Bacteria | 2706 |
| 498 | Ga0495602_0102737 | 3300048088 | Bacteria | 2341 |
| 499 | Ga0495602_0116835 | 3300048088 | Bacteria | 2155 |
| 500 | Ga0495602_0127889 | 3300048088 | Bacteria | 2032 |
| 501 | Ga0495614_0022859 | 3300048089 | Bacteria | 2695 |
| 502 | Ga0495614_0030984 | 3300048089 | Bacteria | 2302 |
| 503 | Ga0495614_0086643 | 3300048089 | Bacteria | 1360 |
| 504 | Ga0495614_0092154 | 3300048089 | Bacteria | 1319 |
| 505 | Ga0495614_0168790 | 3300048089 | Bacteria | 981 |
| 506 | Ga0495614_0365067 | 3300048089 | Unclassified | 674 |
| 507 | Ga0495626_0026084 | 3300048091 | Bacteria | 2852 |
| 508 | Ga0495626_0117718 | 3300048091 | Bacteria | 1145 |
| 509 | Ga0496100_0000245 | 3300048903 | Bacteria | 28407 |
| 510 | Ga0496100_0015927 | 3300048903 | Bacteria | 4402 |
| 511 | Ga0496101_0000198 | 3300048904 | Bacteria | 46691 |
| 512 | Ga0496101_0006933 | 3300048904 | Bacteria | 7316 |
| 513 | Ga0496101_0007248 | 3300048904 | Bacteria | 7175 |
| 514 | Ga0496101_0190054 | 3300048904 | Bacteria | 1584 |
| 515 | Ga0496102_0000181 | 3300048905 | Bacteria | 85605 |
| 516 | Ga0496102_0075415 | 3300048905 | Bacteria | 3101 |
| 517 | Ga0496102_0364181 | 3300048905 | Bacteria | 1361 |
| 518 | Ga0496103_0000566 | 3300048906 | Bacteria | 29345 |
| 519 | Ga0496103_0009180 | 3300048906 | Bacteria | 5855 |
| 520 | Ga0496103_0223056 | 3300048906 | Bacteria | 1212 |
| 521 | Ga0496104_0082671 | 3300048907 | Bacteria | 3062 |
| 522 | Ga0496104_0134425 | 3300048907 | Bacteria | 2376 |
| 523 | Ga0496104_0265311 | 3300048907 | Bacteria | 1630 |
| 524 | Ga0496105_0092138 | 3300048908 | Bacteria | 2502 |
| 525 | Ga0496105_0133488 | 3300048908 | Bacteria | 2045 |
| 526 | Ga0496106_0000114 | 3300048909 | Bacteria | 61763 |
| 527 | Ga0496106_0011348 | 3300048909 | Bacteria | 6594 |
| 528 | Ga0496106_0046792 | 3300048909 | Bacteria | 3254 |
| 529 | Ga0496107_0029436 | 3300048910 | Bacteria | 3906 |
| 530 | Ga0496109_0082344 | 3300048912 | Bacteria | 2966 |
| 531 | Ga0496109_0120766 | 3300048912 | Bacteria | 2441 |
| 532 | Ga0496109_0408996 | 3300048912 | Bacteria | 1282 |
| 533 | Ga0496110_0024154 | 3300048913 | Bacteria | 5177 |
| 534 | Ga0496110_0038154 | 3300048913 | Bacteria | 4179 |
| 535 | Ga0496110_0282073 | 3300048913 | Bacteria | 1513 |
| 536 | Ga0496111_0012304 | 3300048914 | Bacteria | 5789 |
| 537 | Ga0496111_0034302 | 3300048914 | Bacteria | 3623 |
| 538 | Ga0496112_0017107 | 3300048915 | Bacteria | 6807 |
| 539 | Ga0496113_0000678 | 3300048916 | Bacteria | 17322 |
| 540 | Ga0496113_0000987 | 3300048916 | Bacteria | 15205 |
| 541 | Ga0496113_0309882 | 3300048916 | Bacteria | 1264 |
| 542 | Ga0496113_0767956 | 3300048916 | Bacteria | 767 |
| 543 | Ga0496114_0163423 | 3300048917 | Bacteria | 1937 |
| 544 | Ga0496115_0287273 | 3300048918 | Bacteria | 1350 |
| 545 | Ga0496115_0529307 | 3300048918 | Bacteria | 944 |
| 546 | Ga0496116_0188418 | 3300048919 | Bacteria | 1095 |
| 547 | Ga0496117_0000263 | 3300048920 | Bacteria | 99186 |
| 548 | Ga0496117_0007003 | 3300048920 | Bacteria | 11173 |
| 549 | Ga0496117_0163476 | 3300048920 | Bacteria | 1301 |
| 550 | Ga0496118_0000135 | 3300048921 | Bacteria | 130330 |
| 551 | Ga0496118_0000445 | 3300048921 | Bacteria | 68593 |
| 552 | Ga0496118_0026663 | 3300048921 | Bacteria | 4914 |
| 553 | Ga0496118_0043282 | 3300048921 | Bacteria | 3542 |
| 554 | Ga0496119_0111221 | 3300048922 | Bacteria | 1520 |
| 555 | Ga0496120_0059149 | 3300048923 | Bacteria | 2149 |
| 556 | Ga0496121_0000598 | 3300048924 | Bacteria | 67841 |
| 557 | Ga0496121_0002013 | 3300048924 | Bacteria | 32276 |
| 558 | Ga0496121_0004016 | 3300048924 | Bacteria | 20243 |
| 559 | Ga0496121_0004080 | 3300048924 | Bacteria | 20059 |
| 560 | Ga0496121_0015631 | 3300048924 | Bacteria | 7924 |
| 561 | Ga0496121_0043172 | 3300048924 | Bacteria | 3909 |
| 562 | Ga0496122_0012744 | 3300048925 | Bacteria | 8321 |
| 563 | Ga0496122_0099892 | 3300048925 | Bacteria | 1944 |
| 564 | Ga0496123_0038090 | 3300048926 | Bacteria | 3385 |
| 565 | Ga0496124_0030824 | 3300048927 | Bacteria | 4752 |
| 566 | Ga0496125_0008075 | 3300048928 | Bacteria | 11095 |
| 567 | Ga0496126_0000596 | 3300048929 | Bacteria | 68201 |
| 568 | Ga0496126_0001268 | 3300048929 | Bacteria | 40643 |
| 569 | Ga0496126_0032701 | 3300048929 | Bacteria | 4898 |
| 570 | Ga0496126_0139194 | 3300048929 | Bacteria | 2091 |
| 571 | Ga0495678_136246 | 3300049459 | Bacteria | 808 |
| 572 | Ga0495682_0009467 | 3300049460 | Bacteria | 3800 |
| 573 | Ga0495682_0013094 | 3300049460 | Bacteria | 3162 |
| 574 | Ga0501033_0001436 | 3300049570 | Bacteria | 21146 |
| 575 | Ga0501034_0047771 | 3300049571 | Bacteria | 4321 |
| 576 | Ga0501037_0155973 | 3300049573 | Bacteria | 1629 |
| 577 | Ga0501038_0001368 | 3300049574 | Bacteria | 22255 |
| 578 | Ga0501043_0102243 | 3300049579 | Bacteria | 2253 |
| 579 | Ga0501047_0172856 | 3300049581 | Unclassified | 2029 |
| 580 | Ga0501069_0091503 | 3300049585 | Bacteria | 1720 |
| 581 | Ga0501070_0004312 | 3300049586 | Bacteria | 12224 |
| 582 | Ga0501074_0031407 | 3300049590 | Bacteria | 3847 |
| 583 | Ga0501035_0013592 | 3300049822 | Bacteria | 7511 |
| 584 | nmdc:mga0n895_627571_c1 | 3300050512 | Bacteria | 1075 |
| 585 | nmdc:mga08x19_121684_c1 | 3300050514 | Bacteria | 1750 |
| 586 | Ga0466962_0000189 | 3300061719 | Bacteria | 25707 |
| 587 | Ga0466962_0004375 | 3300061719 | Bacteria | 6775 |
| 588 | Ga0466962_0019412 | 3300061719 | Bacteria | 3266 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005366 | Ga0070659_100028345 | Ga0070659_1000283452 | 182 |
| 2 | 3300046690 | Ga0495624_0067674 | Ga0495624_0067674_1512_2189 | 201 |
| 3 | 3300046809 | Ga0495600_0000367 | Ga0495600_0000367_10018_10695 | 201 |
| 4 | 3300046459 | Ga0495629_0001671 | Ga0495629_0001671_6129_6752 | 203 |
| 5 | 3300046463 | Ga0495653_0001591 | Ga0495653_0001591_10652_11275 | 203 |
| 6 | 3300046473 | Ga0495582_0057919 | Ga0495582_0057919_197_820 | 203 |
| 7 | 3300046524 | Ga0495648_0009339 | Ga0495648_0009339_1519_2142 | 203 |
| 8 | 3300046529 | Ga0495652_0148059 | Ga0495652_0148059_616_1239 | 203 |
| 9 | 3300046531 | Ga0495665_0004733 | Ga0495665_0004733_3166_3789 | 203 |
| 10 | 3300046690 | Ga0495624_0000062 | Ga0495624_0000062_10690_11313 | 203 |
| 11 | 3300047673 | Ga0495593_0003026 | Ga0495593_0003026_8281_8904 | 203 |
| 12 | 3300048089 | Ga0495614_0365067 | Ga0495614_0365067_11_634 | 203 |
| 13 | 3300005340 | Ga0070689_100819759 | Ga0070689_1008197591 | 205 |
| 14 | 3300005546 | Ga0070696_100316191 | Ga0070696_1003161912 | 205 |
| 15 | 3300035112 | Ga0373932_0000074 | Ga0373932_0000074_17964_18590 | 205 |
| 16 | 3300042876 | Ga0451577_0122113 | Ga0451577_0122113_233_856 | 205 |
| 17 | 3300006871 | Ga0075434_100110110 | Ga0075434_1001101102 | 206 |
| 18 | 3300050512 | nmdc:mga0n895_627571_c1 | nmdc:mga0n895_627571_c1_14_649 | 206 |
| 19 | 3300006881 | Ga0068865_100445146 | Ga0068865_1004451462 | 208 |
| 20 | 3300046474 | Ga0495605_0058847 | Ga0495605_0058847_1092_1721 | 208 |
| 21 | iso_pu_bacteria | 2599185239 | 2599735763 | 208 |
| 22 | iso_pu_bacteria | 2816332253 | 2817259118 | 208 |
| 23 | iso_pu_bacteria | 2816332256 | 2817280464 | 208 |
| 24 | iso_pu_bacteria | 2816332286 | 2817452345 | 208 |
| 25 | iso_pu_bacteria | 2818991452 | 2819630197 | 208 |
| 26 | iso_pu_bacteria | 2928170801 | 2928173837 | 208 |
| 27 | iso_pu_bacteria | 641736154 | 642420579 | 208 |
| 28 | iso_pu_bacteria | 8020807995 | 8020808958 | 208 |
| 29 | iso_pu_bacteria | 8021120328 | 8021121256 | 208 |
| 30 | iso_pu_bacteria | 8040167225 | 8040167865 | 208 |
| 31 | iso_pu_bacteria | 8040173305 | 8040173542 | 208 |
| 32 | 3300005340 | Ga0070689_100362370 | Ga0070689_1003623702 | 209 |
| 33 | 3300005435 | Ga0070714_100012222 | Ga0070714_1000122222 | 209 |
| 34 | 3300005457 | Ga0070662_100189570 | Ga0070662_1001895702 | 209 |
| 35 | 3300005457 | Ga0070662_100736792 | Ga0070662_1007367921 | 209 |
| 36 | 3300005467 | Ga0070706_100766031 | Ga0070706_1007660311 | 209 |
| 37 | 3300005536 | Ga0070697_100135410 | Ga0070697_1001354103 | 209 |
| 38 | 3300005536 | Ga0070697_100919077 | Ga0070697_1009190771 | 209 |
| 39 | 3300005539 | Ga0068853_100052639 | Ga0068853_1000526393 | 209 |
| 40 | 3300005614 | Ga0068856_100432149 | Ga0068856_1004321493 | 209 |
| 41 | 3300006173 | Ga0070716_100422458 | Ga0070716_1004224581 | 209 |
| 42 | 3300006914 | Ga0075436_100064402 | Ga0075436_1000644023 | 209 |
| 43 | 3300009093 | Ga0105240_10034713 | Ga0105240_100347135 | 209 |
| 44 | 3300009093 | Ga0105240_10163508 | Ga0105240_101635082 | 209 |
| 45 | 3300009174 | Ga0105241_10789944 | Ga0105241_107899441 | 209 |
| 46 | 3300013104 | Ga0157370_10014496 | Ga0157370_1001449610 | 209 |
| 47 | 3300014326 | Ga0157380_10250481 | Ga0157380_102504812 | 209 |
| 48 | 3300025913 | Ga0207695_10017601 | Ga0207695_100176018 | 209 |
| 49 | 3300025929 | Ga0207664_10190855 | Ga0207664_101908552 | 209 |
| 50 | 3300025932 | Ga0207690_10010816 | Ga0207690_100108162 | 209 |
| 51 | 3300025933 | Ga0207706_10083641 | Ga0207706_100836413 | 209 |
| 52 | 3300025933 | Ga0207706_10707761 | Ga0207706_107077611 | 209 |
| 53 | 3300026041 | Ga0207639_10000006 | Ga0207639_1000000662 | 209 |
| 54 | 3300026078 | Ga0207702_10565599 | Ga0207702_105655992 | 209 |
| 55 | 3300037418 | Ga0395900_0012574 | Ga0395900_0012574_3750_4385 | 209 |
| 56 | 3300037418 | Ga0395900_0101776 | Ga0395900_0101776_827_1462 | 209 |
| 57 | 3300038443 | Ga0395901_0608523 | Ga0395901_0608523_177_812 | 209 |
| 58 | 3300044683 | Ga0466965_0020294 | Ga0466965_0020294_2187_2876 | 209 |
| 59 | 3300048912 | Ga0496109_0082344 | Ga0496109_0082344_1622_2263 | 209 |
| 60 | 3300049570 | Ga0501033_0001436 | Ga0501033_0001436_10678_11313 | 209 |
| 61 | 3300049571 | Ga0501034_0047771 | Ga0501034_0047771_777_1412 | 209 |
| 62 | 3300049573 | Ga0501037_0155973 | Ga0501037_0155973_22_657 | 209 |
| 63 | 3300049574 | Ga0501038_0001368 | Ga0501038_0001368_13373_14005 | 209 |
| 64 | 3300049579 | Ga0501043_0102243 | Ga0501043_0102243_840_1475 | 209 |
| 65 | 3300049581 | Ga0501047_0172856 | Ga0501047_0172856_262_897 | 209 |
| 66 | 3300050514 | nmdc:mga08x19_121684_c1 | nmdc:mga08x19_121684_c1_256_888 | 209 |
| 67 | iso_pu_bacteria | 2513237166 | 2514051151 | 209 |
| 68 | iso_pu_bacteria | 642555112 | 642592916 | 209 |
| 69 | 3300028794 | Ga0307515_10078871 | Ga0307515_100788714 | 210 |
| 70 | 3300035112 | Ga0373932_0000318 | Ga0373932_0000318_1123_1755 | 210 |
| 71 | iso_pu_bacteria | 2513237082 | 2513557678 | 210 |
| 72 | iso_pu_bacteria | 2513237166 | 2514047146 | 210 |
| 73 | iso_pu_bacteria | 2513237166 | 2514052542 | 210 |
| 74 | iso_pu_bacteria | 2515154122 | 2515683505 | 210 |
| 75 | iso_pu_bacteria | 2562617112 | 2563060843 | 210 |
| 76 | iso_pu_bacteria | 2562617112 | 2563062633 | 210 |
| 77 | iso_pu_bacteria | 2711768613 | 2713476869 | 210 |
| 78 | iso_pu_bacteria | 2711768613 | 2713480257 | 210 |
| 79 | iso_pu_bacteria | 2808606384 | 2808969732 | 210 |
| 80 | iso_pu_bacteria | 2808606390 | 2809004624 | 210 |
| 81 | iso_pu_bacteria | 2808606391 | 2809011437 | 210 |
| 82 | iso_pu_bacteria | 2856287931 | 2856288975 | 210 |
| 83 | iso_pu_bacteria | 2857357740 | 2857363746 | 210 |
| 84 | iso_pu_bacteria | 2858688981 | 2858693905 | 210 |
| 85 | iso_pu_bacteria | 2902682994 | 2902684942 | 210 |
| 86 | iso_pu_bacteria | 2921643360 | 2921643912 | 210 |
| 87 | iso_pu_bacteria | 642555112 | 642597523 | 210 |
| 88 | iso_pu_bacteria | 642555112 | 642598696 | 210 |
| 89 | iso_pu_bacteria | 8020945358 | 8020949302 | 210 |
| 90 | iso_pu_bacteria | 8039098773 | 8039101248 | 210 |
| 91 | 3300005290 | Ga0065712_10186121 | Ga0065712_101861211 | 211 |
| 92 | 3300005331 | Ga0070670_100089804 | Ga0070670_1000898043 | 211 |
| 93 | 3300005347 | Ga0070668_100005466 | Ga0070668_10000546611 | 211 |
| 94 | 3300005354 | Ga0070675_100078523 | Ga0070675_1000785234 | 211 |
| 95 | 3300005364 | Ga0070673_100099144 | Ga0070673_1000991442 | 211 |
| 96 | 3300005471 | Ga0070698_100048197 | Ga0070698_1000481972 | 211 |
| 97 | 3300005548 | Ga0070665_100026850 | Ga0070665_1000268504 | 211 |
| 98 | 3300005618 | Ga0068864_100343969 | Ga0068864_1003439692 | 211 |
| 99 | 3300005842 | Ga0068858_100077335 | Ga0068858_1000773353 | 211 |
| 100 | 3300005842 | Ga0068858_100857952 | Ga0068858_1008579522 | 211 |
| 101 | 3300006028 | Ga0070717_10560174 | Ga0070717_105601742 | 211 |
| 102 | 3300006237 | Ga0097621_100004366 | Ga0097621_1000043666 | 211 |
| 103 | 3300009176 | Ga0105242_10007665 | Ga0105242_100076652 | 211 |
| 104 | 3300009177 | Ga0105248_10231170 | Ga0105248_102311704 | 211 |
| 105 | 3300013296 | Ga0157374_10726532 | Ga0157374_107265321 | 211 |
| 106 | 3300013306 | Ga0163162_10375633 | Ga0163162_103756332 | 211 |
| 107 | 3300014969 | Ga0157376_10254357 | Ga0157376_102543572 | 211 |
| 108 | 3300025925 | Ga0207650_10096584 | Ga0207650_100965842 | 211 |
| 109 | 3300025926 | Ga0207659_10061563 | Ga0207659_100615634 | 211 |
| 110 | 3300025934 | Ga0207686_10012545 | Ga0207686_100125455 | 211 |
| 111 | 3300025935 | Ga0207709_10620641 | Ga0207709_106206411 | 211 |
| 112 | 3300025938 | Ga0207704_10115259 | Ga0207704_101152592 | 211 |
| 113 | 3300025940 | Ga0207691_10175879 | Ga0207691_101758793 | 211 |
| 114 | 3300025941 | Ga0207711_10292136 | Ga0207711_102921362 | 211 |
| 115 | 3300025972 | Ga0207668_10020162 | Ga0207668_100201622 | 211 |
| 116 | 3300026089 | Ga0207648_10223395 | Ga0207648_102233951 | 211 |
| 117 | 3300026095 | Ga0207676_10258049 | Ga0207676_102580492 | 211 |
| 118 | 3300028379 | Ga0268266_10018312 | Ga0268266_100183126 | 211 |
| 119 | 3300046457 | Ga0495590_0007124 | Ga0495590_0007124_3660_4301 | 211 |
| 120 | 3300046507 | Ga0495606_0045942 | Ga0495606_0045942_963_1604 | 211 |
| 121 | 3300046515 | Ga0495620_0021272 | Ga0495620_0021272_813_1454 | 211 |
| 122 | 3300046528 | Ga0495642_0069287 | Ga0495642_0069287_116_757 | 211 |
| 123 | 3300046542 | Ga0495597_0039318 | Ga0495597_0039318_246_887 | 211 |
| 124 | 3300046694 | Ga0495649_0132237 | Ga0495649_0132237_465_1106 | 211 |
| 125 | 3300046794 | Ga0495589_0199734 | Ga0495589_0199734_12_653 | 211 |
| 126 | 3300047323 | Ga0495683_0072886 | Ga0495683_0072886_948_1589 | 211 |
| 127 | 3300048904 | Ga0496101_0006933 | Ga0496101_0006933_2237_2878 | 211 |
| 128 | 3300048906 | Ga0496103_0009180 | Ga0496103_0009180_1792_2433 | 211 |
| 129 | 3300048907 | Ga0496104_0134425 | Ga0496104_0134425_36_677 | 211 |
| 130 | 3300048909 | Ga0496106_0011348 | Ga0496106_0011348_1911_2552 | 211 |
| 131 | 3300048910 | Ga0496107_0029436 | Ga0496107_0029436_2114_2755 | 211 |
| 132 | 3300048912 | Ga0496109_0120766 | Ga0496109_0120766_14_655 | 211 |
| 133 | 3300048913 | Ga0496110_0038154 | Ga0496110_0038154_2327_2968 | 211 |
| 134 | 3300048914 | Ga0496111_0012304 | Ga0496111_0012304_2428_3069 | 211 |
| 135 | 3300048915 | Ga0496112_0017107 | Ga0496112_0017107_2832_3473 | 211 |
| 136 | 3300048916 | Ga0496113_0309882 | Ga0496113_0309882_328_969 | 211 |
| 137 | 3300048920 | Ga0496117_0007003 | Ga0496117_0007003_6388_7029 | 211 |
| 138 | 3300048921 | Ga0496118_0026663 | Ga0496118_0026663_3715_4356 | 211 |
| 139 | 3300048922 | Ga0496119_0111221 | Ga0496119_0111221_351_992 | 211 |
| 140 | 3300048924 | Ga0496121_0043172 | Ga0496121_0043172_2135_2776 | 211 |
| 141 | 3300048925 | Ga0496122_0012744 | Ga0496122_0012744_2085_2726 | 211 |
| 142 | 3300048926 | Ga0496123_0038090 | Ga0496123_0038090_406_1047 | 211 |
| 143 | 3300048927 | Ga0496124_0030824 | Ga0496124_0030824_456_1097 | 211 |
| 144 | 3300048928 | Ga0496125_0008075 | Ga0496125_0008075_8788_9429 | 211 |
| 145 | iso_pu_bacteria | 2512047030 | 2512345995 | 211 |
| 146 | iso_pu_bacteria | 2818991450 | 2819623000 | 211 |
| 147 | iso_pu_bacteria | 2900634093 | 2900639878 | 211 |
| 148 | iso_pu_bacteria | 2904483920 | 2904485967 | 211 |
| 149 | iso_pu_bacteria | 2928108538 | 2928114964 | 211 |
| 150 | iso_pu_bacteria | 2928135762 | 2928140982 | 211 |
| 151 | iso_pu_bacteria | 2928503688 | 2928507126 | 211 |
| 152 | iso_pu_bacteria | 2990703756 | 2990710607 | 211 |
| 153 | iso_pu_bacteria | 641736151 | 642425086 | 211 |
| 154 | iso_pu_bacteria | 642555113 | 642617369 | 211 |
| 155 | iso_pu_bacteria | 8055301274 | 8055307086 | 211 |
| 156 | 3300003758 | Ga0055532_1000434 | Ga0055532_10004343 | 212 |
| 157 | 3300003760 | Ga0055527_1000153 | Ga0055527_10001539 | 212 |
| 158 | 3300003761 | Ga0055535_1000316 | Ga0055535_10003169 | 212 |
| 159 | 3300003762 | Ga0055542_1001996 | Ga0055542_10019963 | 212 |
| 160 | 3300009093 | Ga0105240_10017557 | Ga0105240_100175578 | 212 |
| 161 | 3300009545 | Ga0105237_10297839 | Ga0105237_102978392 | 212 |
| 162 | 3300009551 | Ga0105238_10008459 | Ga0105238_100084599 | 212 |
| 163 | 3300013104 | Ga0157370_10194965 | Ga0157370_101949652 | 212 |
| 164 | 3300025226 | Ga0209674_102961 | Ga0209674_1029612 | 212 |
| 165 | 3300025228 | Ga0209672_100012 | Ga0209672_100012113 | 212 |
| 166 | 3300025229 | Ga0209147_100007 | Ga0209147_100007659 | 212 |
| 167 | 3300025242 | Ga0209258_100014 | Ga0209258_10001444 | 212 |
| 168 | 3300025254 | Ga0209148_1000287 | Ga0209148_100028739 | 212 |
| 169 | 3300025272 | Ga0209455_1000720 | Ga0209455_10007209 | 212 |
| 170 | 3300035117 | Ga0373953_0054236 | Ga0373953_0054236_573_1232 | 212 |
| 171 | 3300035724 | Ga0373933_0217228 | Ga0373933_0217228_124_783 | 212 |
| 172 | 3300036401 | Ga0373937_0037938 | Ga0373937_0037938_2691_3350 | 212 |
| 173 | 3300037068 | Ga0373925_0538364 | Ga0373925_0538364_160_819 | 212 |
| 174 | 3300046472 | Ga0495580_0372097 | Ga0495580_0372097_233_892 | 212 |
| 175 | 3300046475 | Ga0495639_0143893 | Ga0495639_0143893_52_711 | 212 |
| 176 | 3300046531 | Ga0495665_0031381 | Ga0495665_0031381_1230_1874 | 212 |
| 177 | 3300046531 | Ga0495665_0255698 | Ga0495665_0255698_40_681 | 212 |
| 178 | 3300046535 | Ga0495586_0138721 | Ga0495586_0138721_538_1197 | 212 |
| 179 | 3300046678 | Ga0495599_0003822 | Ga0495599_0003822_5413_6051 | 212 |
| 180 | 3300046679 | Ga0495623_0000736 | Ga0495623_0000736_11641_12279 | 212 |
| 181 | 3300046681 | Ga0495647_0067083 | Ga0495647_0067083_27_686 | 212 |
| 182 | 3300046809 | Ga0495600_0363358 | Ga0495600_0363358_108_746 | 212 |
| 183 | 3300047317 | Ga0495604_0000600 | Ga0495604_0000600_11153_11791 | 212 |
| 184 | 3300047319 | Ga0495674_0046132 | Ga0495674_0046132_1797_2438 | 212 |
| 185 | 3300047320 | Ga0495672_0001083 | Ga0495672_0001083_12884_13525 | 212 |
| 186 | 3300047444 | Ga0495675_0026476 | Ga0495675_0026476_739_1377 | 212 |
| 187 | 3300047472 | Ga0495686_0000045 | Ga0495686_0000045_74137_74778 | 212 |
| 188 | 3300048088 | Ga0495602_0013840 | Ga0495602_0013840_4542_5180 | 212 |
| 189 | 3300049585 | Ga0501069_0091503 | Ga0501069_0091503_685_1341 | 212 |
| 190 | 3300049586 | Ga0501070_0004312 | Ga0501070_0004312_1390_2046 | 212 |
| 191 | 3300049590 | Ga0501074_0031407 | Ga0501074_0031407_2244_2900 | 212 |
| 192 | 3300003322 | rootL2_10003788 | rootL2_100037886 | 213 |
| 193 | 3300009093 | Ga0105240_10200084 | Ga0105240_102000842 | 213 |
| 194 | 3300013105 | Ga0157369_10051315 | Ga0157369_100513156 | 213 |
| 195 | 3300037418 | Ga0395900_0001448 | Ga0395900_0001448_22077_22724 | 213 |
| 196 | 3300044683 | Ga0466965_0048170 | Ga0466965_0048170_1246_1938 | 213 |
| 197 | 3300044684 | Ga0466966_0051786 | Ga0466966_0051786_206_901 | 213 |
| 198 | 3300044693 | Ga0466961_0022028 | Ga0466961_0022028_2500_3192 | 213 |
| 199 | 3300044693 | Ga0466961_0057733 | Ga0466961_0057733_1101_1796 | 213 |
| 200 | 3300044694 | Ga0466963_0000725 | Ga0466963_0000725_12497_13192 | 213 |
| 201 | 3300044719 | Ga0466971_0166041 | Ga0466971_0166041_141_836 | 213 |
| 202 | 3300044842 | Ga0466957_0037843 | Ga0466957_0037843_641_1336 | 213 |
| 203 | 3300045836 | Ga0466958_0048288 | Ga0466958_0048288_1390_2085 | 213 |
| 204 | 3300046459 | Ga0495629_0038919 | Ga0495629_0038919_437_1084 | 213 |
| 205 | 3300046462 | Ga0495651_0350213 | Ga0495651_0350213_15_662 | 213 |
| 206 | 3300046463 | Ga0495653_0005724 | Ga0495653_0005724_6783_7430 | 213 |
| 207 | 3300046463 | Ga0495653_0141106 | Ga0495653_0141106_757_1404 | 213 |
| 208 | 3300046472 | Ga0495580_0042306 | Ga0495580_0042306_129_773 | 213 |
| 209 | 3300046477 | Ga0495664_0043690 | Ga0495664_0043690_443_1090 | 213 |
| 210 | 3300046516 | Ga0495628_0085025 | Ga0495628_0085025_1064_1711 | 213 |
| 211 | 3300046517 | Ga0495630_0009125 | Ga0495630_0009125_5030_5677 | 213 |
| 212 | 3300046529 | Ga0495652_0021043 | Ga0495652_0021043_744_1391 | 213 |
| 213 | 3300046531 | Ga0495665_0000183 | Ga0495665_0000183_20828_21475 | 213 |
| 214 | 3300046535 | Ga0495586_0030326 | Ga0495586_0030326_171_818 | 213 |
| 215 | 3300046543 | Ga0495645_0051526 | Ga0495645_0051526_2216_2863 | 213 |
| 216 | 3300046663 | Ga0495635_0003916 | Ga0495635_0003916_3429_4076 | 213 |
| 217 | 3300046678 | Ga0495599_0044124 | Ga0495599_0044124_326_973 | 213 |
| 218 | 3300046679 | Ga0495623_0002295 | Ga0495623_0002295_1432_2079 | 213 |
| 219 | 3300046680 | Ga0495646_0011233 | Ga0495646_0011233_279_926 | 213 |
| 220 | 3300046690 | Ga0495624_0000471 | Ga0495624_0000471_10502_11149 | 213 |
| 221 | 3300046809 | Ga0495600_0031310 | Ga0495600_0031310_755_1402 | 213 |
| 222 | 3300047319 | Ga0495674_0014155 | Ga0495674_0014155_4663_5307 | 213 |
| 223 | 3300047319 | Ga0495674_0042527 | Ga0495674_0042527_1153_1800 | 213 |
| 224 | 3300047322 | Ga0495680_0002605 | Ga0495680_0002605_6633_7280 | 213 |
| 225 | 3300047444 | Ga0495675_0064299 | Ga0495675_0064299_1177_1824 | 213 |
| 226 | 3300047673 | Ga0495593_0020589 | Ga0495593_0020589_594_1241 | 213 |
| 227 | 3300048088 | Ga0495602_0001650 | Ga0495602_0001650_10540_11187 | 213 |
| 228 | 3300048904 | Ga0496101_0007248 | Ga0496101_0007248_3621_4268 | 213 |
| 229 | 3300048906 | Ga0496103_0223056 | Ga0496103_0223056_60_707 | 213 |
| 230 | 3300048907 | Ga0496104_0265311 | Ga0496104_0265311_572_1219 | 213 |
| 231 | 3300048912 | Ga0496109_0408996 | Ga0496109_0408996_57_704 | 213 |
| 232 | 3300061719 | Ga0466962_0000189 | Ga0466962_0000189_18158_18853 | 213 |
| 233 | iso_pu_bacteria | 2904434214 | 2904437375 | 213 |
| 234 | 3300001989 | JGI24739J22299_10026164 | JGI24739J22299_100261642 | 214 |
| 235 | 3300001990 | JGI24737J22298_10032965 | JGI24737J22298_100329652 | 214 |
| 236 | 3300002067 | JGI24735J21928_10006689 | JGI24735J21928_100066892 | 214 |
| 237 | 3300002067 | JGI24735J21928_10009537 | JGI24735J21928_100095372 | 214 |
| 238 | 3300003187 | JGI25151J46595_10010761 | JGI25151J46595_100107616 | 214 |
| 239 | 3300003320 | rootH2_10005359 | rootH2_1000535910 | 214 |
| 240 | 3300003320 | rootH2_10108596 | rootH2_1010859613 | 214 |
| 241 | 3300003323 | rootH1_10076393 | rootH1_100763932 | 214 |
| 242 | 3300003323 | rootH1_10089848 | rootH1_100898483 | 214 |
| 243 | 3300003323 | rootH1_10221373 | rootH1_102213734 | 214 |
| 244 | 3300003354 | JGI25160J50197_1024162 | JGI25160J50197_10241622 | 214 |
| 245 | 3300003771 | Ga0055526_1024025 | Ga0055526_10240253 | 214 |
| 246 | 3300005262 | Ga0065165_1000040 | Ga0065165_1000040136 | 214 |
| 247 | 3300005327 | Ga0070658_10021856 | Ga0070658_100218564 | 214 |
| 248 | 3300005339 | Ga0070660_100036558 | Ga0070660_1000365581 | 214 |
| 249 | 3300005339 | Ga0070660_100658236 | Ga0070660_1006582361 | 214 |
| 250 | 3300005344 | Ga0070661_100178432 | Ga0070661_1001784321 | 214 |
| 251 | 3300005455 | Ga0070663_100237218 | Ga0070663_1002372182 | 214 |
| 252 | 3300005548 | Ga0070665_100226472 | Ga0070665_1002264722 | 214 |
| 253 | 3300005563 | Ga0068855_100149587 | Ga0068855_1001495872 | 214 |
| 254 | 3300009011 | Ga0105251_10005574 | Ga0105251_1000557411 | 214 |
| 255 | 3300009092 | Ga0105250_10093739 | Ga0105250_100937392 | 214 |
| 256 | 3300009093 | Ga0105240_10096577 | Ga0105240_100965772 | 214 |
| 257 | 3300009093 | Ga0105240_10121287 | Ga0105240_101212874 | 214 |
| 258 | 3300009551 | Ga0105238_10003214 | Ga0105238_100032148 | 214 |
| 259 | 3300009551 | Ga0105238_10421317 | Ga0105238_104213172 | 214 |
| 260 | 3300013102 | Ga0157371_10074243 | Ga0157371_100742434 | 214 |
| 261 | 3300013104 | Ga0157370_10003155 | Ga0157370_1000315514 | 214 |
| 262 | 3300013104 | Ga0157370_10332212 | Ga0157370_103322122 | 214 |
| 263 | 3300013105 | Ga0157369_10000145 | Ga0157369_1000014560 | 214 |
| 264 | 3300013105 | Ga0157369_10000293 | Ga0157369_1000029338 | 214 |
| 265 | 3300013306 | Ga0163162_10018442 | Ga0163162_100184425 | 214 |
| 266 | 3300014326 | Ga0157380_10469252 | Ga0157380_104692522 | 214 |
| 267 | 3300020069 | Ga0197907_10509736 | Ga0197907_105097361 | 214 |
| 268 | 3300020070 | Ga0206356_11033659 | Ga0206356_110336592 | 214 |
| 269 | 3300020076 | Ga0206355_1458904 | Ga0206355_14589042 | 214 |
| 270 | 3300020080 | Ga0206350_10742459 | Ga0206350_107424593 | 214 |
| 271 | 3300020081 | Ga0206354_11125356 | Ga0206354_111253563 | 214 |
| 272 | 3300020082 | Ga0206353_10180509 | Ga0206353_101805092 | 214 |
| 273 | 3300022467 | Ga0224712_10000027 | Ga0224712_100000274 | 214 |
| 274 | 3300025272 | Ga0209455_1000664 | Ga0209455_100066417 | 214 |
| 275 | 3300025284 | Ga0209130_1004156 | Ga0209130_10041565 | 214 |
| 276 | 3300025294 | Ga0209025_1001263 | Ga0209025_100126328 | 214 |
| 277 | 3300025294 | Ga0209025_1002150 | Ga0209025_100215012 | 214 |
| 278 | 3300025295 | Ga0209564_1008013 | Ga0209564_10080135 | 214 |
| 279 | 3300025302 | Ga0207426_1000004 | Ga0207426_1000004814 | 214 |
| 280 | 3300025302 | Ga0207426_1002029 | Ga0207426_10020296 | 214 |
| 281 | 3300025711 | Ga0207696_1055691 | Ga0207696_10556912 | 214 |
| 282 | 3300025735 | Ga0207713_1024904 | Ga0207713_10249042 | 214 |
| 283 | 3300025904 | Ga0207647_10024398 | Ga0207647_100243982 | 214 |
| 284 | 3300025909 | Ga0207705_10005089 | Ga0207705_100050897 | 214 |
| 285 | 3300025913 | Ga0207695_10225491 | Ga0207695_102254912 | 214 |
| 286 | 3300025919 | Ga0207657_10195860 | Ga0207657_101958601 | 214 |
| 287 | 3300025924 | Ga0207694_10018489 | Ga0207694_100184894 | 214 |
| 288 | 3300025924 | Ga0207694_10368702 | Ga0207694_103687022 | 214 |
| 289 | 3300025924 | Ga0207694_10409052 | Ga0207694_104090522 | 214 |
| 290 | 3300025949 | Ga0207667_10006817 | Ga0207667_1000681712 | 214 |
| 291 | 3300025986 | Ga0207658_10242497 | Ga0207658_102424972 | 214 |
| 292 | 3300026035 | Ga0207703_10167636 | Ga0207703_101676362 | 214 |
| 293 | 3300026041 | Ga0207639_10911050 | Ga0207639_109110501 | 214 |
| 294 | 3300028800 | Ga0265338_10000159 | Ga0265338_1000015917 | 214 |
| 295 | 3300028800 | Ga0265338_10003994 | Ga0265338_1000399411 | 214 |
| 296 | 3300037312 | Ga0395899_0000005 | Ga0395899_0000005_385638_386285 | 214 |
| 297 | 3300037312 | Ga0395899_0133072 | Ga0395899_0133072_944_1591 | 214 |
| 298 | 3300037418 | Ga0395900_0000003 | Ga0395900_0000003_386682_387329 | 214 |
| 299 | 3300037418 | Ga0395900_0000053 | Ga0395900_0000053_121333_121980 | 214 |
| 300 | 3300037418 | Ga0395900_0048919 | Ga0395900_0048919_1422_2069 | 214 |
| 301 | 3300037418 | Ga0395900_0071313 | Ga0395900_0071313_1973_2620 | 214 |
| 302 | 3300037418 | Ga0395900_0072560 | Ga0395900_0072560_87_734 | 214 |
| 303 | 3300037466 | Ga0395898_0000003 | Ga0395898_0000003_385658_386305 | 214 |
| 304 | 3300037466 | Ga0395898_0001273 | Ga0395898_0001273_1806_2453 | 214 |
| 305 | 3300037466 | Ga0395898_0071913 | Ga0395898_0071913_1489_2136 | 214 |
| 306 | 3300037466 | Ga0395898_0186246 | Ga0395898_0186246_78_725 | 214 |
| 307 | 3300037471 | Ga0395905_0000035 | Ga0395905_0000035_52606_53253 | 214 |
| 308 | 3300038443 | Ga0395901_0000004 | Ga0395901_0000004_50441_51088 | 214 |
| 309 | 3300038443 | Ga0395901_0000042 | Ga0395901_0000042_73824_74471 | 214 |
| 310 | 3300038443 | Ga0395901_0036096 | Ga0395901_0036096_4383_5030 | 214 |
| 311 | 3300044656 | Ga0466969_0001183 | Ga0466969_0001183_2468_3115 | 214 |
| 312 | 3300044656 | Ga0466969_0004417 | Ga0466969_0004417_6799_7446 | 214 |
| 313 | 3300044659 | Ga0466973_0008737 | Ga0466973_0008737_6829_7476 | 214 |
| 314 | 3300044684 | Ga0466966_0000029 | Ga0466966_0000029_81996_82643 | 214 |
| 315 | 3300044684 | Ga0466966_0004888 | Ga0466966_0004888_5519_6166 | 214 |
| 316 | 3300044684 | Ga0466966_0017051 | Ga0466966_0017051_802_1449 | 214 |
| 317 | 3300044693 | Ga0466961_0001351 | Ga0466961_0001351_6130_6777 | 214 |
| 318 | 3300044693 | Ga0466961_0003113 | Ga0466961_0003113_3088_3735 | 214 |
| 319 | 3300044693 | Ga0466961_0011759 | Ga0466961_0011759_888_1535 | 214 |
| 320 | 3300044693 | Ga0466961_0180873 | Ga0466961_0180873_230_877 | 214 |
| 321 | 3300044694 | Ga0466963_0000211 | Ga0466963_0000211_1198_1845 | 214 |
| 322 | 3300044694 | Ga0466963_0009541 | Ga0466963_0009541_3671_4318 | 214 |
| 323 | 3300044694 | Ga0466963_0019497 | Ga0466963_0019497_663_1310 | 214 |
| 324 | 3300044706 | Ga0466964_0041026 | Ga0466964_0041026_651_1298 | 214 |
| 325 | 3300044719 | Ga0466971_0003180 | Ga0466971_0003180_2991_3638 | 214 |
| 326 | 3300044719 | Ga0466971_0018269 | Ga0466971_0018269_1382_2029 | 214 |
| 327 | 3300044719 | Ga0466971_0021399 | Ga0466971_0021399_1071_1718 | 214 |
| 328 | 3300044735 | Ga0466968_0016888 | Ga0466968_0016888_1921_2568 | 214 |
| 329 | 3300044765 | Ga0466970_0019110 | Ga0466970_0019110_1707_2354 | 214 |
| 330 | 3300044765 | Ga0466970_0052199 | Ga0466970_0052199_1373_2020 | 214 |
| 331 | 3300044842 | Ga0466957_0015354 | Ga0466957_0015354_103_750 | 214 |
| 332 | 3300044842 | Ga0466957_0016207 | Ga0466957_0016207_1309_1956 | 214 |
| 333 | 3300044842 | Ga0466957_0034079 | Ga0466957_0034079_1089_1736 | 214 |
| 334 | 3300044842 | Ga0466957_0337906 | Ga0466957_0337906_167_814 | 214 |
| 335 | 3300045049 | Ga0466959_0015408 | Ga0466959_0015408_4861_5529 | 214 |
| 336 | 3300045049 | Ga0466959_0355426 | Ga0466959_0355426_248_895 | 214 |
| 337 | 3300045836 | Ga0466958_0012260 | Ga0466958_0012260_1102_1749 | 214 |
| 338 | 3300045836 | Ga0466958_0053025 | Ga0466958_0053025_1319_1966 | 214 |
| 339 | 3300046454 | Ga0495592_0065657 | Ga0495592_0065657_612_1262 | 214 |
| 340 | 3300046455 | Ga0495603_0002093 | Ga0495603_0002093_7961_8608 | 214 |
| 341 | 3300046455 | Ga0495603_0047427 | Ga0495603_0047427_1488_2147 | 214 |
| 342 | 3300046457 | Ga0495590_0073213 | Ga0495590_0073213_227_874 | 214 |
| 343 | 3300046459 | Ga0495629_0001627 | Ga0495629_0001627_9476_10126 | 214 |
| 344 | 3300046459 | Ga0495629_0010138 | Ga0495629_0010138_20_673 | 214 |
| 345 | 3300046459 | Ga0495629_0165957 | Ga0495629_0165957_826_1476 | 214 |
| 346 | 3300046462 | Ga0495651_0424151 | Ga0495651_0424151_177_827 | 214 |
| 347 | 3300046463 | Ga0495653_0028865 | Ga0495653_0028865_1355_2008 | 214 |
| 348 | 3300046471 | Ga0495650_0001852 | Ga0495650_0001852_7563_8213 | 214 |
| 349 | 3300046472 | Ga0495580_0011077 | Ga0495580_0011077_4480_5130 | 214 |
| 350 | 3300046472 | Ga0495580_0215990 | Ga0495580_0215990_658_1305 | 214 |
| 351 | 3300046474 | Ga0495605_0022344 | Ga0495605_0022344_439_1086 | 214 |
| 352 | 3300046474 | Ga0495605_0058470 | Ga0495605_0058470_814_1473 | 214 |
| 353 | 3300046476 | Ga0495662_0101983 | Ga0495662_0101983_28_681 | 214 |
| 354 | 3300046477 | Ga0495664_0001152 | Ga0495664_0001152_5449_6099 | 214 |
| 355 | 3300046477 | Ga0495664_0012627 | Ga0495664_0012627_933_1583 | 214 |
| 356 | 3300046501 | Ga0495607_0065134 | Ga0495607_0065134_598_1248 | 214 |
| 357 | 3300046506 | Ga0495583_0037118 | Ga0495583_0037118_1088_1735 | 214 |
| 358 | 3300046513 | Ga0495616_0048759 | Ga0495616_0048759_576_1223 | 214 |
| 359 | 3300046513 | Ga0495616_0094322 | Ga0495616_0094322_470_1129 | 214 |
| 360 | 3300046516 | Ga0495628_0009868 | Ga0495628_0009868_5250_5906 | 214 |
| 361 | 3300046516 | Ga0495628_0041436 | Ga0495628_0041436_2075_2725 | 214 |
| 362 | 3300046517 | Ga0495630_0050641 | Ga0495630_0050641_2230_2883 | 214 |
| 363 | 3300046528 | Ga0495642_0202616 | Ga0495642_0202616_109_756 | 214 |
| 364 | 3300046529 | Ga0495652_0390646 | Ga0495652_0390646_298_951 | 214 |
| 365 | 3300046531 | Ga0495665_0007911 | Ga0495665_0007911_1515_2168 | 214 |
| 366 | 3300046543 | Ga0495645_0000899 | Ga0495645_0000899_8670_9320 | 214 |
| 367 | 3300046543 | Ga0495645_0009829 | Ga0495645_0009829_5109_5759 | 214 |
| 368 | 3300046543 | Ga0495645_0059668 | Ga0495645_0059668_17_667 | 214 |
| 369 | 3300046559 | Ga0495667_0025442 | Ga0495667_0025442_2984_3634 | 214 |
| 370 | 3300046660 | Ga0495625_0180373 | Ga0495625_0180373_719_1378 | 214 |
| 371 | 3300046660 | Ga0495625_0494241 | Ga0495625_0494241_63_710 | 214 |
| 372 | 3300046663 | Ga0495635_0002163 | Ga0495635_0002163_11189_11842 | 214 |
| 373 | 3300046674 | Ga0495588_0297683 | Ga0495588_0297683_84_734 | 214 |
| 374 | 3300046678 | Ga0495599_0005137 | Ga0495599_0005137_6323_7087 | 214 |
| 375 | 3300046678 | Ga0495599_0059666 | Ga0495599_0059666_557_1207 | 214 |
| 376 | 3300046679 | Ga0495623_0006339 | Ga0495623_0006339_5648_6301 | 214 |
| 377 | 3300046679 | Ga0495623_0078842 | Ga0495623_0078842_817_1467 | 214 |
| 378 | 3300046679 | Ga0495623_0196215 | Ga0495623_0196215_333_983 | 214 |
| 379 | 3300046680 | Ga0495646_0004629 | Ga0495646_0004629_941_1597 | 214 |
| 380 | 3300046680 | Ga0495646_0055330 | Ga0495646_0055330_997_1647 | 214 |
| 381 | 3300046680 | Ga0495646_0078843 | Ga0495646_0078843_1201_1854 | 214 |
| 382 | 3300046684 | Ga0495669_0074780 | Ga0495669_0074780_71_718 | 214 |
| 383 | 3300046689 | Ga0495613_0010901 | Ga0495613_0010901_6025_6675 | 214 |
| 384 | 3300046690 | Ga0495624_0071563 | Ga0495624_0071563_418_1071 | 214 |
| 385 | 3300046690 | Ga0495624_0197765 | Ga0495624_0197765_285_935 | 214 |
| 386 | 3300046692 | Ga0495671_0122403 | Ga0495671_0122403_80_730 | 214 |
| 387 | 3300046694 | Ga0495649_0091398 | Ga0495649_0091398_892_1551 | 214 |
| 388 | 3300046794 | Ga0495589_0017177 | Ga0495589_0017177_3005_3655 | 214 |
| 389 | 3300046794 | Ga0495589_0024409 | Ga0495589_0024409_117_764 | 214 |
| 390 | 3300046809 | Ga0495600_0027629 | Ga0495600_0027629_1167_1817 | 214 |
| 391 | 3300046809 | Ga0495600_0068240 | Ga0495600_0068240_632_1282 | 214 |
| 392 | 3300047317 | Ga0495604_0043220 | Ga0495604_0043220_2128_2781 | 214 |
| 393 | 3300047317 | Ga0495604_0052308 | Ga0495604_0052308_1674_2324 | 214 |
| 394 | 3300047319 | Ga0495674_0010758 | Ga0495674_0010758_3557_4216 | 214 |
| 395 | 3300047319 | Ga0495674_0018159 | Ga0495674_0018159_1857_2504 | 214 |
| 396 | 3300047319 | Ga0495674_0035900 | Ga0495674_0035900_3499_4146 | 214 |
| 397 | 3300047319 | Ga0495674_0074799 | Ga0495674_0074799_885_1535 | 214 |
| 398 | 3300047319 | Ga0495674_0114257 | Ga0495674_0114257_776_1423 | 214 |
| 399 | 3300047319 | Ga0495674_0180777 | Ga0495674_0180777_730_1383 | 214 |
| 400 | 3300047319 | Ga0495674_0461849 | Ga0495674_0461849_180_830 | 214 |
| 401 | 3300047320 | Ga0495672_0064763 | Ga0495672_0064763_1311_1958 | 214 |
| 402 | 3300047320 | Ga0495672_0067791 | Ga0495672_0067791_618_1265 | 214 |
| 403 | 3300047322 | Ga0495680_0002137 | Ga0495680_0002137_2476_3129 | 214 |
| 404 | 3300047322 | Ga0495680_0076643 | Ga0495680_0076643_1282_1932 | 214 |
| 405 | 3300047323 | Ga0495683_0054521 | Ga0495683_0054521_261_908 | 214 |
| 406 | 3300047323 | Ga0495683_0088942 | Ga0495683_0088942_226_885 | 214 |
| 407 | 3300047443 | Ga0495687_035325 | Ga0495687_035325_980_1627 | 214 |
| 408 | 3300047443 | Ga0495687_119178 | Ga0495687_119178_259_918 | 214 |
| 409 | 3300047444 | Ga0495675_0005440 | Ga0495675_0005440_663_1313 | 214 |
| 410 | 3300047444 | Ga0495675_0122618 | Ga0495675_0122618_841_1497 | 214 |
| 411 | 3300047469 | Ga0495673_0028169 | Ga0495673_0028169_587_1234 | 214 |
| 412 | 3300047469 | Ga0495673_0067250 | Ga0495673_0067250_664_1323 | 214 |
| 413 | 3300048088 | Ga0495602_0047318 | Ga0495602_0047318_1540_2304 | 214 |
| 414 | 3300048088 | Ga0495602_0127889 | Ga0495602_0127889_16_666 | 214 |
| 415 | 3300048089 | Ga0495614_0092154 | Ga0495614_0092154_637_1290 | 214 |
| 416 | 3300048091 | Ga0495626_0026084 | Ga0495626_0026084_794_1441 | 214 |
| 417 | 3300048091 | Ga0495626_0117718 | Ga0495626_0117718_376_1035 | 214 |
| 418 | 3300048903 | Ga0496100_0000245 | Ga0496100_0000245_10048_10695 | 214 |
| 419 | 3300048903 | Ga0496100_0015927 | Ga0496100_0015927_2492_3139 | 214 |
| 420 | 3300048904 | Ga0496101_0000198 | Ga0496101_0000198_20192_20839 | 214 |
| 421 | 3300048904 | Ga0496101_0190054 | Ga0496101_0190054_913_1560 | 214 |
| 422 | 3300048905 | Ga0496102_0000181 | Ga0496102_0000181_63931_64578 | 214 |
| 423 | 3300048905 | Ga0496102_0364181 | Ga0496102_0364181_13_672 | 214 |
| 424 | 3300048906 | Ga0496103_0000566 | Ga0496103_0000566_13310_13957 | 214 |
| 425 | 3300048907 | Ga0496104_0082671 | Ga0496104_0082671_1332_1979 | 214 |
| 426 | 3300048908 | Ga0496105_0092138 | Ga0496105_0092138_1332_1979 | 214 |
| 427 | 3300048908 | Ga0496105_0133488 | Ga0496105_0133488_761_1420 | 214 |
| 428 | 3300048909 | Ga0496106_0000114 | Ga0496106_0000114_36769_37416 | 214 |
| 429 | 3300048909 | Ga0496106_0046792 | Ga0496106_0046792_179_826 | 214 |
| 430 | 3300048913 | Ga0496110_0024154 | Ga0496110_0024154_3282_3932 | 214 |
| 431 | 3300048913 | Ga0496110_0282073 | Ga0496110_0282073_591_1238 | 214 |
| 432 | 3300048914 | Ga0496111_0034302 | Ga0496111_0034302_544_1194 | 214 |
| 433 | 3300048916 | Ga0496113_0000678 | Ga0496113_0000678_6188_6835 | 214 |
| 434 | 3300048916 | Ga0496113_0000987 | Ga0496113_0000987_755_1402 | 214 |
| 435 | 3300048916 | Ga0496113_0767956 | Ga0496113_0767956_94_741 | 214 |
| 436 | 3300048917 | Ga0496114_0163423 | Ga0496114_0163423_929_1579 | 214 |
| 437 | 3300048918 | Ga0496115_0529307 | Ga0496115_0529307_52_711 | 214 |
| 438 | 3300048919 | Ga0496116_0188418 | Ga0496116_0188418_345_992 | 214 |
| 439 | 3300048920 | Ga0496117_0000263 | Ga0496117_0000263_29630_30277 | 214 |
| 440 | 3300048921 | Ga0496118_0000135 | Ga0496118_0000135_13329_13976 | 214 |
| 441 | 3300048923 | Ga0496120_0059149 | Ga0496120_0059149_1364_2011 | 214 |
| 442 | 3300048924 | Ga0496121_0000598 | Ga0496121_0000598_34108_34755 | 214 |
| 443 | 3300048924 | Ga0496121_0002013 | Ga0496121_0002013_14702_15349 | 214 |
| 444 | 3300048924 | Ga0496121_0004016 | Ga0496121_0004016_9638_10285 | 214 |
| 445 | 3300048924 | Ga0496121_0004080 | Ga0496121_0004080_19188_19835 | 214 |
| 446 | 3300048924 | Ga0496121_0015631 | Ga0496121_0015631_606_1265 | 214 |
| 447 | 3300048929 | Ga0496126_0000596 | Ga0496126_0000596_33922_34569 | 214 |
| 448 | 3300048929 | Ga0496126_0032701 | Ga0496126_0032701_3306_3953 | 214 |
| 449 | 3300048929 | Ga0496126_0139194 | Ga0496126_0139194_343_990 | 214 |
| 450 | 3300049459 | Ga0495678_136246 | Ga0495678_136246_85_744 | 214 |
| 451 | 3300049460 | Ga0495682_0009467 | Ga0495682_0009467_322_969 | 214 |
| 452 | 3300049822 | Ga0501035_0013592 | Ga0501035_0013592_4506_5153 | 214 |
| 453 | 3300061719 | Ga0466962_0004375 | Ga0466962_0004375_2354_3001 | 214 |
| 454 | 3300061719 | Ga0466962_0019412 | Ga0466962_0019412_923_1570 | 214 |
| 455 | iso_pu_bacteria | 2921643360 | 2921645331 | 214 |
| 456 | 3300001989 | JGI24739J22299_10012722 | JGI24739J22299_100127224 | 215 |
| 457 | 3300001989 | JGI24739J22299_10031933 | JGI24739J22299_100319333 | 215 |
| 458 | 3300002067 | JGI24735J21928_10019398 | JGI24735J21928_100193982 | 215 |
| 459 | 3300002705 | JGI25156J39149_1000356 | JGI25156J39149_10003566 | 215 |
| 460 | 3300002705 | JGI25156J39149_1000856 | JGI25156J39149_100085613 | 215 |
| 461 | 3300003214 | JGI25165J46597_1001118 | JGI25165J46597_10011188 | 215 |
| 462 | 3300003756 | Ga0055533_1000072 | Ga0055533_100007276 | 215 |
| 463 | 3300003758 | Ga0055532_1000013 | Ga0055532_1000013141 | 215 |
| 464 | 3300003760 | Ga0055527_1000010 | Ga0055527_1000010228 | 215 |
| 465 | 3300003761 | Ga0055535_1000010 | Ga0055535_1000010141 | 215 |
| 466 | 3300003762 | Ga0055542_1000016 | Ga0055542_1000016141 | 215 |
| 467 | 3300003763 | Ga0055529_1000012 | Ga0055529_1000012141 | 215 |
| 468 | 3300005367 | Ga0070667_100161251 | Ga0070667_1001612512 | 215 |
| 469 | 3300009011 | Ga0105251_10000069 | Ga0105251_1000006973 | 215 |
| 470 | 3300009011 | Ga0105251_10049052 | Ga0105251_100490523 | 215 |
| 471 | 3300009093 | Ga0105240_10218952 | Ga0105240_102189522 | 215 |
| 472 | 3300009093 | Ga0105240_10701677 | Ga0105240_107016772 | 215 |
| 473 | 3300013105 | Ga0157369_10076466 | Ga0157369_100764663 | 215 |
| 474 | 3300013105 | Ga0157369_10159418 | Ga0157369_101594182 | 215 |
| 475 | 3300015262 | Ga0182007_10002791 | Ga0182007_100027919 | 215 |
| 476 | 3300025226 | Ga0209674_100011 | Ga0209674_100011227 | 215 |
| 477 | 3300025228 | Ga0209672_100002 | Ga0209672_100002222 | 215 |
| 478 | 3300025229 | Ga0209147_100003 | Ga0209147_100003222 | 215 |
| 479 | 3300025230 | Ga0209563_100990 | Ga0209563_1009907 | 215 |
| 480 | 3300025231 | Ga0207427_103698 | Ga0207427_1036984 | 215 |
| 481 | 3300025242 | Ga0209258_100042 | Ga0209258_100042138 | 215 |
| 482 | 3300025254 | Ga0209148_1000006 | Ga0209148_1000006222 | 215 |
| 483 | 3300025256 | Ga0209759_1000028 | Ga0209759_100002834 | 215 |
| 484 | 3300025256 | Ga0209759_1000051 | Ga0209759_100005196 | 215 |
| 485 | 3300025261 | Ga0209233_1000033 | Ga0209233_1000033322 | 215 |
| 486 | 3300025272 | Ga0209455_1000003 | Ga0209455_1000003222 | 215 |
| 487 | 3300025735 | Ga0207713_1001033 | Ga0207713_10010339 | 215 |
| 488 | 3300025904 | Ga0207647_10063461 | Ga0207647_100634611 | 215 |
| 489 | 3300025913 | Ga0207695_10251676 | Ga0207695_102516763 | 215 |
| 490 | 3300025924 | Ga0207694_10242101 | Ga0207694_102421012 | 215 |
| 491 | 3300028563 | Ga0265319_1029842 | Ga0265319_10298422 | 215 |
| 492 | 3300031712 | Ga0265342_10104752 | Ga0265342_101047522 | 215 |
| 493 | 3300038443 | Ga0395901_0000130 | Ga0395901_0000130_1858_2511 | 215 |
| 494 | 3300046454 | Ga0495592_0200674 | Ga0495592_0200674_664_1314 | 215 |
| 495 | 3300046455 | Ga0495603_0084085 | Ga0495603_0084085_800_1450 | 215 |
| 496 | 3300046459 | Ga0495629_0000224 | Ga0495629_0000224_10597_11244 | 215 |
| 497 | 3300046459 | Ga0495629_0000249 | Ga0495629_0000249_17487_18137 | 215 |
| 498 | 3300046459 | Ga0495629_0001695 | Ga0495629_0001695_11214_11864 | 215 |
| 499 | 3300046461 | Ga0495641_0023325 | Ga0495641_0023325_1474_2124 | 215 |
| 500 | 3300046461 | Ga0495641_0118837 | Ga0495641_0118837_113_763 | 215 |
| 501 | 3300046462 | Ga0495651_0094787 | Ga0495651_0094787_739_1389 | 215 |
| 502 | 3300046462 | Ga0495651_0103105 | Ga0495651_0103105_696_1343 | 215 |
| 503 | 3300046462 | Ga0495651_0103184 | Ga0495651_0103184_44_694 | 215 |
| 504 | 3300046463 | Ga0495653_0000942 | Ga0495653_0000942_8089_8736 | 215 |
| 505 | 3300046463 | Ga0495653_0001903 | Ga0495653_0001903_15097_15747 | 215 |
| 506 | 3300046463 | Ga0495653_0021842 | Ga0495653_0021842_503_1153 | 215 |
| 507 | 3300046463 | Ga0495653_0052357 | Ga0495653_0052357_1924_2574 | 215 |
| 508 | 3300046463 | Ga0495653_0053827 | Ga0495653_0053827_2106_2756 | 215 |
| 509 | 3300046463 | Ga0495653_0098115 | Ga0495653_0098115_1377_2027 | 215 |
| 510 | 3300046471 | Ga0495650_0003687 | Ga0495650_0003687_4273_4923 | 215 |
| 511 | 3300046472 | Ga0495580_0000355 | Ga0495580_0000355_26556_27206 | 215 |
| 512 | 3300046472 | Ga0495580_0001105 | Ga0495580_0001105_20490_21140 | 215 |
| 513 | 3300046472 | Ga0495580_0002219 | Ga0495580_0002219_9988_10635 | 215 |
| 514 | 3300046472 | Ga0495580_0002335 | Ga0495580_0002335_11238_11888 | 215 |
| 515 | 3300046472 | Ga0495580_0131331 | Ga0495580_0131331_267_917 | 215 |
| 516 | 3300046473 | Ga0495582_0004443 | Ga0495582_0004443_1935_2585 | 215 |
| 517 | 3300046473 | Ga0495582_0005945 | Ga0495582_0005945_3328_3978 | 215 |
| 518 | 3300046473 | Ga0495582_0060879 | Ga0495582_0060879_228_878 | 215 |
| 519 | 3300046473 | Ga0495582_0210040 | Ga0495582_0210040_411_1058 | 215 |
| 520 | 3300046476 | Ga0495662_0029085 | Ga0495662_0029085_1070_1720 | 215 |
| 521 | 3300046477 | Ga0495664_0001056 | Ga0495664_0001056_2360_3010 | 215 |
| 522 | 3300046477 | Ga0495664_0134400 | Ga0495664_0134400_486_1136 | 215 |
| 523 | 3300046500 | Ga0495596_0023148 | Ga0495596_0023148_648_1298 | 215 |
| 524 | 3300046506 | Ga0495583_0002761 | Ga0495583_0002761_1999_2649 | 215 |
| 525 | 3300046511 | Ga0495608_0004535 | Ga0495608_0004535_1491_2141 | 215 |
| 526 | 3300046512 | Ga0495610_0002901 | Ga0495610_0002901_12228_12878 | 215 |
| 527 | 3300046514 | Ga0495618_0005997 | Ga0495618_0005997_3681_4331 | 215 |
| 528 | 3300046514 | Ga0495618_0040229 | Ga0495618_0040229_2088_2738 | 215 |
| 529 | 3300046514 | Ga0495618_0054741 | Ga0495618_0054741_440_1090 | 215 |
| 530 | 3300046516 | Ga0495628_0000239 | Ga0495628_0000239_8436_9083 | 215 |
| 531 | 3300046516 | Ga0495628_0014304 | Ga0495628_0014304_5771_6421 | 215 |
| 532 | 3300046516 | Ga0495628_0014998 | Ga0495628_0014998_5713_6363 | 215 |
| 533 | 3300046516 | Ga0495628_0026057 | Ga0495628_0026057_1161_1811 | 215 |
| 534 | 3300046516 | Ga0495628_0066259 | Ga0495628_0066259_212_862 | 215 |
| 535 | 3300046516 | Ga0495628_0093641 | Ga0495628_0093641_1070_1720 | 215 |
| 536 | 3300046516 | Ga0495628_0331982 | Ga0495628_0331982_31_681 | 215 |
| 537 | 3300046517 | Ga0495630_0012843 | Ga0495630_0012843_1709_2359 | 215 |
| 538 | 3300046517 | Ga0495630_0014371 | Ga0495630_0014371_989_1639 | 215 |
| 539 | 3300046517 | Ga0495630_0043128 | Ga0495630_0043128_1629_2279 | 215 |
| 540 | 3300046517 | Ga0495630_0057170 | Ga0495630_0057170_1989_2639 | 215 |
| 541 | 3300046522 | Ga0495643_0036642 | Ga0495643_0036642_161_811 | 215 |
| 542 | 3300046524 | Ga0495648_0002596 | Ga0495648_0002596_9315_9962 | 215 |
| 543 | 3300046524 | Ga0495648_0018361 | Ga0495648_0018361_818_1468 | 215 |
| 544 | 3300046526 | Ga0495666_0002176 | Ga0495666_0002176_3967_4617 | 215 |
| 545 | 3300046526 | Ga0495666_0004470 | Ga0495666_0004470_1745_2395 | 215 |
| 546 | 3300046526 | Ga0495666_0005695 | Ga0495666_0005695_559_1209 | 215 |
| 547 | 3300046526 | Ga0495666_0006738 | Ga0495666_0006738_234_884 | 215 |
| 548 | 3300046529 | Ga0495652_0031882 | Ga0495652_0031882_2330_2980 | 215 |
| 549 | 3300046529 | Ga0495652_0043233 | Ga0495652_0043233_318_968 | 215 |
| 550 | 3300046529 | Ga0495652_0458204 | Ga0495652_0458204_112_762 | 215 |
| 551 | 3300046531 | Ga0495665_0011506 | Ga0495665_0011506_1253_1900 | 215 |
| 552 | 3300046531 | Ga0495665_0110109 | Ga0495665_0110109_771_1421 | 215 |
| 553 | 3300046531 | Ga0495665_0319800 | Ga0495665_0319800_113_763 | 215 |
| 554 | 3300046533 | Ga0495640_0189870 | Ga0495640_0189870_630_1280 | 215 |
| 555 | 3300046533 | Ga0495640_0404861 | Ga0495640_0404861_52_702 | 215 |
| 556 | 3300046535 | Ga0495586_0009019 | Ga0495586_0009019_1979_2629 | 215 |
| 557 | 3300046535 | Ga0495586_0359169 | Ga0495586_0359169_156_806 | 215 |
| 558 | 3300046536 | Ga0495587_0001594 | Ga0495587_0001594_348_998 | 215 |
| 559 | 3300046538 | Ga0495609_0056925 | Ga0495609_0056925_366_1016 | 215 |
| 560 | 3300046543 | Ga0495645_0001599 | Ga0495645_0001599_11353_12003 | 215 |
| 561 | 3300046543 | Ga0495645_0382110 | Ga0495645_0382110_69_719 | 215 |
| 562 | 3300046557 | Ga0495622_0000022 | Ga0495622_0000022_139409_140059 | 215 |
| 563 | 3300046559 | Ga0495667_0225013 | Ga0495667_0225013_269_919 | 215 |
| 564 | 3300046642 | Ga0495634_0017905 | Ga0495634_0017905_1580_2230 | 215 |
| 565 | 3300046642 | Ga0495634_0030366 | Ga0495634_0030366_1788_2438 | 215 |
| 566 | 3300046642 | Ga0495634_0105391 | Ga0495634_0105391_1080_1730 | 215 |
| 567 | 3300046648 | Ga0495611_0014391 | Ga0495611_0014391_921_1571 | 215 |
| 568 | 3300046660 | Ga0495625_0150830 | Ga0495625_0150830_173_823 | 215 |
| 569 | 3300046663 | Ga0495635_0000808 | Ga0495635_0000808_3487_4137 | 215 |
| 570 | 3300046663 | Ga0495635_0012987 | Ga0495635_0012987_4538_5188 | 215 |
| 571 | 3300046665 | Ga0495661_0029761 | Ga0495661_0029761_1228_1878 | 215 |
| 572 | 3300046674 | Ga0495588_0120789 | Ga0495588_0120789_595_1245 | 215 |
| 573 | 3300046675 | Ga0495657_0006631 | Ga0495657_0006631_6593_7243 | 215 |
| 574 | 3300046678 | Ga0495599_0114953 | Ga0495599_0114953_896_1546 | 215 |
| 575 | 3300046679 | Ga0495623_0002630 | Ga0495623_0002630_659_1309 | 215 |
| 576 | 3300046680 | Ga0495646_0000952 | Ga0495646_0000952_950_1600 | 215 |
| 577 | 3300046680 | Ga0495646_0001837 | Ga0495646_0001837_6489_7136 | 215 |
| 578 | 3300046680 | Ga0495646_0005306 | Ga0495646_0005306_3963_4613 | 215 |
| 579 | 3300046689 | Ga0495613_0030037 | Ga0495613_0030037_2566_3216 | 215 |
| 580 | 3300046689 | Ga0495613_0055461 | Ga0495613_0055461_2203_2850 | 215 |
| 581 | 3300046690 | Ga0495624_0000059 | Ga0495624_0000059_13697_14347 | 215 |
| 582 | 3300046690 | Ga0495624_0000062 | Ga0495624_0000062_28004_28651 | 215 |
| 583 | 3300046690 | Ga0495624_0003825 | Ga0495624_0003825_9720_10370 | 215 |
| 584 | 3300046690 | Ga0495624_0015100 | Ga0495624_0015100_800_1450 | 215 |
| 585 | 3300046694 | Ga0495649_0019755 | Ga0495649_0019755_1297_1947 | 215 |
| 586 | 3300046809 | Ga0495600_0000851 | Ga0495600_0000851_5880_6530 | 215 |
| 587 | 3300047315 | Ga0495581_0027177 | Ga0495581_0027177_1731_2381 | 215 |
| 588 | 3300047315 | Ga0495581_0046679 | Ga0495581_0046679_977_1627 | 215 |
| 589 | 3300047317 | Ga0495604_0003227 | Ga0495604_0003227_984_1634 | 215 |
| 590 | 3300047317 | Ga0495604_0070467 | Ga0495604_0070467_825_1475 | 215 |
| 591 | 3300047317 | Ga0495604_0095892 | Ga0495604_0095892_1208_1858 | 215 |
| 592 | 3300047319 | Ga0495674_0000180 | Ga0495674_0000180_39267_39914 | 215 |
| 593 | 3300047319 | Ga0495674_0027686 | Ga0495674_0027686_3791_4441 | 215 |
| 594 | 3300047319 | Ga0495674_0051948 | Ga0495674_0051948_2017_2667 | 215 |
| 595 | 3300047319 | Ga0495674_0057137 | Ga0495674_0057137_749_1399 | 215 |
| 596 | 3300047319 | Ga0495674_0171118 | Ga0495674_0171118_987_1637 | 215 |
| 597 | 3300047320 | Ga0495672_0034396 | Ga0495672_0034396_1542_2192 | 215 |
| 598 | 3300047320 | Ga0495672_0045383 | Ga0495672_0045383_1090_1746 | 215 |
| 599 | 3300047321 | Ga0495676_0033814 | Ga0495676_0033814_52_702 | 215 |
| 600 | 3300047321 | Ga0495676_0072679 | Ga0495676_0072679_1417_2064 | 215 |
| 601 | 3300047322 | Ga0495680_0019384 | Ga0495680_0019384_3060_3710 | 215 |
| 602 | 3300047322 | Ga0495680_0083084 | Ga0495680_0083084_357_1007 | 215 |
| 603 | 3300047323 | Ga0495683_0008827 | Ga0495683_0008827_318_968 | 215 |
| 604 | 3300047323 | Ga0495683_0016086 | Ga0495683_0016086_1681_2331 | 215 |
| 605 | 3300047444 | Ga0495675_0011811 | Ga0495675_0011811_1676_2326 | 215 |
| 606 | 3300047444 | Ga0495675_0044820 | Ga0495675_0044820_1119_1769 | 215 |
| 607 | 3300047444 | Ga0495675_0054610 | Ga0495675_0054610_458_1108 | 215 |
| 608 | 3300047444 | Ga0495675_0167352 | Ga0495675_0167352_23_673 | 215 |
| 609 | 3300047446 | Ga0495679_002634 | Ga0495679_002634_7272_7922 | 215 |
| 610 | 3300047469 | Ga0495673_0017387 | Ga0495673_0017387_1595_2245 | 215 |
| 611 | 3300047469 | Ga0495673_0086757 | Ga0495673_0086757_87_743 | 215 |
| 612 | 3300047471 | Ga0495684_0073997 | Ga0495684_0073997_1918_2568 | 215 |
| 613 | 3300047472 | Ga0495686_0021021 | Ga0495686_0021021_173_823 | 215 |
| 614 | 3300047673 | Ga0495593_0000061 | Ga0495593_0000061_5427_6074 | 215 |
| 615 | 3300047673 | Ga0495593_0011715 | Ga0495593_0011715_2301_2951 | 215 |
| 616 | 3300047673 | Ga0495593_0035425 | Ga0495593_0035425_503_1153 | 215 |
| 617 | 3300048088 | Ga0495602_0014244 | Ga0495602_0014244_491_1141 | 215 |
| 618 | 3300048088 | Ga0495602_0033590 | Ga0495602_0033590_1429_2079 | 215 |
| 619 | 3300048088 | Ga0495602_0053499 | Ga0495602_0053499_781_1431 | 215 |
| 620 | 3300048088 | Ga0495602_0075197 | Ga0495602_0075197_1265_1915 | 215 |
| 621 | 3300048088 | Ga0495602_0082088 | Ga0495602_0082088_1558_2208 | 215 |
| 622 | 3300048088 | Ga0495602_0102737 | Ga0495602_0102737_363_1013 | 215 |
| 623 | 3300048088 | Ga0495602_0116835 | Ga0495602_0116835_155_805 | 215 |
| 624 | 3300048089 | Ga0495614_0022859 | Ga0495614_0022859_342_992 | 215 |
| 625 | 3300048089 | Ga0495614_0030984 | Ga0495614_0030984_1501_2151 | 215 |
| 626 | 3300048089 | Ga0495614_0086643 | Ga0495614_0086643_211_858 | 215 |
| 627 | 3300048089 | Ga0495614_0168790 | Ga0495614_0168790_40_690 | 215 |
| 628 | 3300048905 | Ga0496102_0075415 | Ga0496102_0075415_646_1296 | 215 |
| 629 | 3300048918 | Ga0496115_0287273 | Ga0496115_0287273_68_718 | 215 |
| 630 | 3300048920 | Ga0496117_0163476 | Ga0496117_0163476_488_1138 | 215 |
| 631 | 3300048921 | Ga0496118_0000445 | Ga0496118_0000445_48114_48761 | 215 |
| 632 | 3300048921 | Ga0496118_0043282 | Ga0496118_0043282_985_1635 | 215 |
| 633 | 3300048925 | Ga0496122_0099892 | Ga0496122_0099892_788_1438 | 215 |
| 634 | 3300048929 | Ga0496126_0001268 | Ga0496126_0001268_15735_16385 | 215 |
| 635 | 3300049460 | Ga0495682_0013094 | Ga0495682_0013094_1367_2017 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a5s-assembly1.cif.gz_AAA | crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. | 0.974 | 145 | 204 |
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9716 | 145 | 208 |
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9673 | 145 | 208 |
| 4wul-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.9664 | 146 | 208 |
| 6ekh-assembly1.cif.gz_Y | crystal structure of activated chey from methanoccocus maripaludis | 0.9629 | 1 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ekhY00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9629 | 1 | 118 | 3.40.50.2300 |
| 3cz5B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9616 | 1 | 139 | 3.40.50.2300 |
| 4if4B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9582 | 143 | 210 | 1.10.10.10 |
| 1zn2A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9571 | 149 | 205 | 1.10.10.10 |
| 4if4D02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9537 | 143 | 210 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536SDC8-F1-model_v4 | Response regulator transcription factor | 0.8669 | 3 | 157 |
GO:0000160
|
| AF-A0A3N1ZY91-F1-model_v4 | DNA-binding NarL/FixJ family response regulator | 0.8557 | 1 | 144 |
GO:0000160
GO:0003677 |
| AF-A0A534XNF7-F1-model_v4 | Response regulator transcription factor | 0.8507 | 2 | 156 |
GO:0000160
GO:0003677 |
| AF-A0A536SDC8-F1-model_v4 | Response regulator transcription factor | 0.8358 | 3 | 157 |
GO:0000160
|
| AF-A0A4U3AJ83-F1-model_v4 | deleted | 0.8221 | 1 | 157 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar