F471046

General Info

Members Datasets Scaffolds Average Seq Length
633 494 341 327

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10012458|JGI25153J46596_100124582
Length 364
Sequence MIEIIESGPFNTVQDLGRPGYRDIGVSASGAMDPLAVRIGNILVGNDEDAAAIEVQTFPFSLRFERRVVFAVTGADGNPDLDGSELLPWCAYLAEPGQVLGLKQPPRLARXYXALGGGLDIPVVMGSQSTSLRGGFGGNAGRPLAKGDXIAVGEDAEMVMLPASGLAVVEPAVALRDVFPATVDGALPIRALPAGEHDLFAGDGEAFWSQTWRISSRSDRTGYRLSGEPITPTASIEMRSHGVVPGVIQVPPGGEPIVQMSDANTAGGYPKIAGVIECDLWRLGQARIGARLNFVRSTHAEARTVEQAVARYVEDVRQTSRMVKRALKAMAXCVSPXRPXKGGTDEDRSEFRHGRRIWSLPAVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
12 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
17 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
18 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
19 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
20 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
21 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
22 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
23 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
24 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
25 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
26 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
27 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
28 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
29 2516143018 Ensifer sp. BR816 Isolate Nodule
30 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
31 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
32 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
33 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
34 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
35 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
36 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
37 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
38 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
39 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
40 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
41 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
42 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
43 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
44 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
45 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
46 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
47 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
48 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
49 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
50 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
51 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
52 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
53 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
54 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
55 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
56 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
57 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
58 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
59 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
60 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
61 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
62 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
63 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
64 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
65 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
66 2643221568 Rhizobium sp. Root564 Isolate Unclassified
67 2643221582 Rhizobium sp. Root651 Isolate Unclassified
68 2643221693 Rhizobium sp. Root491 Isolate Unclassified
69 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
70 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
71 2718217882 Rhizobium sp. N741 Isolate Nodule
72 2718217927 Rhizobium sp. N324 Isolate Nodule
73 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
74 2718218009 Rhizobium sp. N561 Isolate Nodule
75 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
76 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
77 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
78 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
79 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
80 2718218363 Rhizobium sp. N113 Isolate Nodule
81 2718218365 Rhizobium sp. N731 Isolate Nodule
82 2718218366 Rhizobium sp. N621 Isolate Nodule
83 2718218423 Rhizobium sp. N941 Isolate Nodule
84 2721755514 Rhizobium sp. N6212 Isolate Nodule
85 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
86 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
87 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
88 2721755809 Rhizobium sp. N541 Isolate Nodule
89 2721755810 Rhizobium sp. N871 Isolate Nodule
90 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
91 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
92 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
93 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
94 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
95 2728369365 Rhizobium sp. N1341 Isolate Nodule
96 2728369397 Rhizobium sp. N1314 Isolate Nodule
97 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
98 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
99 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
100 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
101 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
102 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
103 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
104 2791355256 Rhizobium sp. M10 Isolate Nodule
105 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
106 2791355260 Rhizobium sp. L9 Isolate Nodule
107 2791355261 Rhizobium sp. J15 Isolate Nodule
108 2791355262 Rhizobium sp. M1 Isolate Nodule
109 2791355263 Rhizobium chutanense C5 Isolate Nodule
110 2791355264 Rhizobium sp. S9 Isolate Nodule
111 2791355265 Rhizobium sp. H4 Isolate Nodule
112 2791355266 Rhizobium sp. L43 Isolate Nodule
113 2791355267 Rhizobium sp. L18 Isolate Nodule
114 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
115 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
116 2802429633 Rhizobium anhuiense J3 Isolate Nodule
117 2802429634 Rhizobium anhuiense S10 Isolate Nodule
118 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
119 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
120 2802429637 Rhizobium anhuiense C15 Isolate Nodule
121 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
122 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
123 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
124 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
125 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
126 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
127 2838061910 Rhizobium phaseoli L15 Isolate Nodule
128 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
129 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
130 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
131 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
132 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
133 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
134 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
135 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
136 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
137 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
138 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
139 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
140 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
141 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
142 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
143 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
144 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
145 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
146 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
147 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
148 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
149 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
150 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
151 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
152 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
153 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
154 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
155 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
156 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
157 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
158 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
159 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
160 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
161 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
162 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
163 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
164 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
165 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
166 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
167 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
168 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
169 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
170 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
171 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
172 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
173 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
174 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
175 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
176 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
177 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
178 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
179 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
180 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
181 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
182 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
183 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
184 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
185 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
186 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
187 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
188 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
189 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
190 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
191 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
192 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
193 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
194 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
195 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
196 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
197 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
198 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
199 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
200 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
201 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
202 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
203 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
204 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
205 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
206 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
207 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
208 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
209 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
210 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
211 2876601092 Pantoea endophytica 596 Isolate Unclassified
212 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
213 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
214 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
215 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
216 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
217 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
218 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
219 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
220 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
221 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
222 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
223 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
224 2919150387 Rahnella aceris 1817 Isolate Unclassified
225 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
226 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
227 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
228 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
229 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
230 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
231 2927143783 Rahnella sp. 2050 Isolate Unclassified
232 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
233 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
234 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
235 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
236 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
237 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
238 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
239 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
240 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
241 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
242 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
243 2936381700 Rhizobium chutanense C16 Isolate Unclassified
244 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
245 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
246 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
247 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
248 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
249 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
250 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
251 2996887358 Rhizobium sp. R711 Isolate Nodule
252 2996893221 Rhizobium sp. R635 Isolate Nodule
253 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
254 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
255 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
256 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
257 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
258 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
259 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
260 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
261 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
262 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
263 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
264 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
265 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
266 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
267 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
268 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
269 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
270 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
271 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
272 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
273 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
274 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
275 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
276 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
277 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
278 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
279 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
280 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
281 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
282 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
283 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
284 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
285 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
286 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
287 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
288 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
289 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
290 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
291 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
292 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
293 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
294 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
295 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
296 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
297 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
298 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
299 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
300 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
301 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
302 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
303 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
304 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
305 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
306 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
307 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
308 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
309 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
310 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
311 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
312 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
313 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
314 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
315 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
316 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
317 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
318 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
319 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
324 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
325 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
326 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
329 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
330 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
331 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
332 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
333 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
335 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
336 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
337 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
339 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
340 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
350 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
352 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
354 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
355 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
356 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
357 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
358 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
359 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
360 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
361 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
362 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
363 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
364 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
365 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
366 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
367 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
368 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
369 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
370 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
371 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
372 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
373 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
374 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
375 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
376 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
377 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
378 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
379 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
380 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
381 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
382 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
383 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
384 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
385 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
386 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
387 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
388 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
389 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
390 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
391 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
392 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
393 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
394 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
395 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
396 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
397 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
398 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
399 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
400 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
401 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
402 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
403 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
404 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
405 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
406 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
407 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
408 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
409 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
410 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
411 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
412 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
413 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
414 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
418 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
425 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
426 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
430 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
431 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
432 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
433 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
434 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
435 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
436 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
437 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
438 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
439 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
440 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
441 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
442 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
443 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
444 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
445 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
446 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
447 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
448 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
449 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
450 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
451 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
452 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
453 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
454 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
455 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
456 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
457 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
458 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
459 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
460 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
461 8005258706 Rhizobium sp. R693 Isolate Nodule
462 8005275841 Rhizobium sp. N4311 Isolate Nodule
463 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
464 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
465 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
466 8005321885 Rhizobium sp. R72 Isolate Nodule
467 8005382845 Rhizobium sp. R634 Isolate Nodule
468 8005395548 Rhizobium sp. R339 Isolate Nodule
469 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
470 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
471 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
472 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
473 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
474 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
475 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
476 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
477 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
478 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
479 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
480 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
481 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
482 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
483 8018176218 Rhizobium sp. N122 Isolate Nodule
484 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
485 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
486 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
487 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
488 8024501048 Rhizobium sp. H4 Isolate Nodule
489 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
490 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
491 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
492 8056382006 Rhizobium croatiense 13T Isolate Nodule
493 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
494 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.87
Metatranscriptomes 0
Isolates 46.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 19.12
Nodule 32.07
Rhizoplane 1.42
Rhizosphere 29.54
Stem 0
Stem Tuber 0.32
Unclassified 17.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3441810 2162886007 Bacteria 1461
2 JGI25162J39368_1000441 3300002737 Bacteria 33362
3 JGI25163J39215_1000118 3300002771 Bacteria 33381
4 JGI25164J39214_1000302 3300002772 Bacteria 33358
5 JGI25152J39213_1015727 3300002773 Bacteria 1483
6 JGI25159J45721_1000012 3300002987 Bacteria 149808
7 JGI25151J46595_10000853 3300003187 Bacteria 24238
8 JGI25406J46586_10001001 3300003203 Bacteria 13251
9 JGI25153J46596_10002995 3300003215 Bacteria 9558
10 JGI25153J46596_10012458 3300003215 Bacteria 3667
11 rootL2_10070558 3300003322 Bacteria 2625
12 JGI25160J50197_1000042 3300003354 Bacteria 149808
13 JGI25160J50197_1000384 3300003354 Bacteria 28677
14 JGI25161J50226_1000560 3300003374 Bacteria 15800
15 JGI25161J50226_1002732 3300003374 Bacteria 4362
16 Ga0055538_1000217 3300003751 Bacteria 33362
17 Ga0055539_1000259 3300003752 Bacteria 33362
18 Ga0055533_1000250 3300003756 Bacteria 33362
19 Ga0055525_1000347 3300003759 Bacteria 33362
20 Ga0055526_1001933 3300003771 Bacteria 14330
21 Ga0055526_1004619 3300003771 Bacteria 8203
22 Ga0055528_1001032 3300003790 Bacteria 18415
23 Ga0055540_1000066 3300003792 Bacteria 122947
24 Ga0055540_1007775 3300003792 Bacteria 3979
25 Ga0055531_10008278 3300003794 Bacteria 5524
26 Ga0055541_1000156 3300003841 Bacteria 33362
27 Ga0055543_1000123 3300004625 Bacteria 64977
28 Ga0055543_1000671 3300004625 Bacteria 17852
29 Ga0065165_1000960 3300005262 Bacteria 36197
30 Ga0065165_1031809 3300005262 Bacteria 1662
31 Ga0065704_10001785 3300005289 Bacteria 6578
32 Ga0070670_100279478 3300005331 Bacteria 1458
33 Ga0068868_100143872 3300005338 Bacteria 1959
34 Ga0070668_100119865 3300005347 Bacteria 2102
35 Ga0070709_10000273 3300005434 Bacteria 33081
36 Ga0068867_100033091 3300005459 Bacteria 3742
37 Ga0070665_100028220 3300005548 Bacteria 5652
38 Ga0068855_100028498 3300005563 Bacteria 6680
39 Ga0068857_100355558 3300005577 Bacteria 1357
40 Ga0068854_100012849 3300005578 Bacteria 5484
41 Ga0068859_100151964 3300005617 Bacteria 2391
42 Ga0068863_100204565 3300005841 Bacteria 1900
43 Ga0081539_10005289 3300005985 Bacteria 13296
44 Ga0075365_10004874 3300006038 Bacteria 7168
45 Ga0075364_10000163 3300006051 Bacteria 29585
46 Ga0075364_10005140 3300006051 Bacteria 7586
47 Ga0075364_10172846 3300006051 Bacteria 1460
48 Ga0075367_10044204 3300006178 Bacteria 2609
49 Ga0075367_10072463 3300006178 Bacteria 2074
50 Ga0075366_10000903 3300006195 Bacteria 14366
51 Ga0075366_10162500 3300006195 Bacteria 1353
52 Ga0075370_10000487 3300006353 Bacteria 14976
53 Ga0075370_10010939 3300006353 Bacteria 4757
54 Ga0075370_10035549 3300006353 Bacteria 2796
55 Ga0097620_100151953 3300006931 Bacteria 2391
56 Ga0079104_1000014 3300006946 Bacteria 337362
57 Ga0099826_10000063 3300006948 Bacteria 61637
58 Ga0105251_10004091 3300009011 Bacteria 10214
59 Ga0105244_10007879 3300009036 Bacteria 6718
60 Ga0105244_10011951 3300009036 Bacteria 5167
61 Ga0105244_10129383 3300009036 Unclassified 1219
62 Ga0105250_10000017 3300009092 Bacteria 255998
63 Ga0105250_10000100 3300009092 Bacteria 77155
64 Ga0105250_10004578 3300009092 Bacteria 6339
65 Ga0105250_10012283 3300009092 Bacteria 3538
66 Ga0105245_10018869 3300009098 Bacteria 6035
67 Ga0105245_10319496 3300009098 Bacteria 1529
68 Ga0105243_10019553 3300009148 Bacteria 5135
69 Ga0105237_10315444 3300009545 Bacteria 1567
70 Ga0123341_1000005 3300009765 Bacteria 150422
71 Ga0123342_1018270 3300009766 Bacteria 5625
72 Ga0105246_10030787 3300011119 Bacteria 3546
73 Ga0105246_10081628 3300011119 Bacteria 2305
74 Ga0157373_10002688 3300013100 Bacteria 13476
75 Ga0157373_10030689 3300013100 Bacteria 3867
76 Ga0157371_10000187 3300013102 Bacteria 91186
77 Ga0157371_10000626 3300013102 Bacteria 41946
78 Ga0157371_10002218 3300013102 Bacteria 18795
79 Ga0157370_10004979 3300013104 Bacteria 15037
80 Ga0157369_10032985 3300013105 Bacteria 5692
81 Ga0157369_10043692 3300013105 Bacteria 4883
82 Ga0171462_1015 3300013250 Bacteria 169578
83 Ga0157375_10832866 3300013308 Bacteria 1070
84 Ga0182006_1002039 3300015261 Bacteria 11337
85 Ga0214544_1000584 3300021320 Bacteria 68638
86 Ga0214544_1016021 3300021320 Bacteria 7464
87 Ga0214542_1003702 3300021321 Bacteria 30842
88 Ga0214543_1003409 3300021327 Bacteria 30837
89 Ga0209760_100179 3300025207 Bacteria 33431
90 Ga0209784_100001 3300025224 Bacteria 3600592
91 Ga0209566_100001 3300025225 Bacteria 3600765
92 Ga0209674_100002 3300025226 Bacteria 3600592
93 Ga0209563_100002 3300025230 Bacteria 2045675
94 Ga0207427_100032 3300025231 Bacteria 349939
95 Ga0209437_100001 3300025233 Bacteria 2045675
96 Ga0207425_1001731 3300025245 Bacteria 8620
97 Ga0209677_100002 3300025253 Bacteria 2045675
98 Ga0209148_1009465 3300025254 Bacteria 1896
99 Ga0209129_1000894 3300025258 Bacteria 18296
100 Ga0209233_1004558 3300025261 Bacteria 4694
101 Ga0209673_1000020 3300025273 Bacteria 430653
102 Ga0209673_1000462 3300025273 Bacteria 68568
103 Ga0209673_1000607 3300025273 Bacteria 55095
104 Ga0209130_1000075 3300025284 Bacteria 171698
105 Ga0209130_1020248 3300025284 Bacteria 1526
106 Ga0209675_1027718 3300025291 Bacteria 1388
107 Ga0209676_1011176 3300025292 Bacteria 3649
108 Ga0209025_1000081 3300025294 Bacteria 265899
109 Ga0209025_1001974 3300025294 Bacteria 23554
110 Ga0209564_1001810 3300025295 Bacteria 19733
111 Ga0209564_1004282 3300025295 Bacteria 8846
112 Ga0209758_1000076 3300025297 Bacteria 270615
113 Ga0209758_1000341 3300025297 Bacteria 86460
114 Ga0209758_1001742 3300025297 Bacteria 24216
115 Ga0209758_1011155 3300025297 Bacteria 5246
116 Ga0209050_1005066 3300025298 Bacteria 8515
117 Ga0209256_1000175 3300025299 Bacteria 127671
118 Ga0209256_1000500 3300025299 Bacteria 57552
119 Ga0209256_1002281 3300025299 Bacteria 16192
120 Ga0209256_1004891 3300025299 Bacteria 8059
121 Ga0207426_1000163 3300025302 Bacteria 171698
122 Ga0207426_1000169 3300025302 Bacteria 164859
123 Ga0207426_1001062 3300025302 Bacteria 26022
124 Ga0209051_1000038 3300025303 Bacteria 320926
125 Ga0209051_1002584 3300025303 Bacteria 12746
126 Ga0209051_1003890 3300025303 Bacteria 9536
127 Ga0209257_1003097 3300025304 Bacteria 14917
128 Ga0209257_1015502 3300025304 Bacteria 3166
129 Ga0209257_1017591 3300025304 Bacteria 2805
130 Ga0209257_1037316 3300025304 Bacteria 1483
131 Ga0207696_1000013 3300025711 Bacteria 524881
132 Ga0207696_1000533 3300025711 Bacteria 31089
133 Ga0207696_1004144 3300025711 Bacteria 6339
134 Ga0207655_1008007 3300025728 Bacteria 6776
135 Ga0207655_1079928 3300025728 Unclassified 1183
136 Ga0207713_1006904 3300025735 Bacteria 6820
137 Ga0207645_10104491 3300025907 Bacteria 1829
138 Ga0207654_10121195 3300025911 Bacteria 1642
139 Ga0207667_10033161 3300025949 Bacteria 5555
140 Ga0207641_10193418 3300026088 Bacteria 1871
141 Ga0209281_1000032 3300027111 Bacteria 401727
142 Ga0209371_1000012 3300027312 Bacteria 748304
143 Ga0209371_1004217 3300027312 Bacteria 6395
144 Ga0209371_1009659 3300027312 Bacteria 3044
145 Ga0209282_1000511 3300027666 Bacteria 18837
146 Ga0268266_10043518 3300028379 Bacteria 3838
147 Ga0268266_10218072 3300028379 Bacteria 1752
148 Ga0307515_10000068 3300028794 Bacteria 242305
149 Ga0307515_10007397 3300028794 Bacteria 21714
150 Ga0307515_10037826 3300028794 Bacteria 7742
151 Ga0268256_1000013 3300030500 Bacteria 752103
152 Ga0268256_1003884 3300030500 Bacteria 6498
153 Ga0268256_1005243 3300030500 Bacteria 5139
154 Ga0307513_10007057 3300031456 Bacteria 14604
155 Ga0307516_10060407 3300031730 Bacteria 3683
156 Ga0395899_0002715 3300037312 Bacteria 14263
157 Ga0395900_0074588 3300037418 Bacteria 3487
158 Ga0395905_0089861 3300037471 Bacteria 2879
159 Ga0395901_0114716 3300038443 Bacteria 2829
160 Ga0439436_0001393 3300041404 Bacteria 6979
161 Ga0439436_0008513 3300041404 Bacteria 3155
162 Ga0439465_0004456 3300041413 Bacteria 4531
163 Ga0451847_0052262 3300041503 Bacteria 1472
164 Ga0451849_0175285 3300041505 Bacteria 1619
165 Ga0451843_0401027 3300041509 Bacteria 1274
166 Ga0439431_0034746 3300041997 Bacteria 1265
167 Ga0439456_042255 3300042013 Bacteria 989
168 Ga0450920_007657 3300042122 Bacteria 1962
169 Ga0450906_000341 3300042145 Bacteria 9497
170 Ga0450910_011684 3300042147 Bacteria 1262
171 Ga0450918_001311 3300042531 Bacteria 5021
172 Ga0450893_0009321 3300042532 Bacteria 1602
173 Ga0495617_031500 3300046452 Bacteria 1781
174 Ga0495591_000589 3300046458 Bacteria 27562
175 Ga0495638_0000373 3300046460 Bacteria 55670
176 Ga0495650_0000008 3300046471 Bacteria 688246
177 Ga0495650_0000090 3300046471 Bacteria 232897
178 Ga0495605_0091748 3300046474 Bacteria 1406
179 Ga0495605_0149196 3300046474 Bacteria 1044
180 Ga0495584_0009609 3300046491 Bacteria 4981
181 Ga0495585_0000072 3300046492 Bacteria 102939
182 Ga0495585_0006925 3300046492 Bacteria 6987
183 Ga0495585_0022694 3300046492 Bacteria 3602
184 Ga0495607_0009165 3300046501 Bacteria 6727
185 Ga0495607_0015986 3300046501 Bacteria 4850
186 Ga0495583_0018650 3300046506 Bacteria 3648
187 Ga0495583_0036477 3300046506 Bacteria 2339
188 Ga0495606_0001031 3300046507 Bacteria 40402
189 Ga0495610_0000202 3300046512 Bacteria 66436
190 Ga0495610_0036040 3300046512 Bacteria 2532
191 Ga0495616_0019644 3300046513 Bacteria 3685
192 Ga0495620_0005522 3300046515 Bacteria 7049
193 Ga0495620_0024401 3300046515 Bacteria 2876
194 Ga0495620_0034207 3300046515 Bacteria 2299
195 Ga0495620_0089377 3300046515 Bacteria 1237
196 Ga0495631_0011120 3300046518 Bacteria 4436
197 Ga0495631_0047312 3300046518 Bacteria 1889
198 Ga0495632_0051955 3300046519 Bacteria 2016
199 Ga0495643_0001110 3300046522 Bacteria 26795
200 Ga0495643_0088191 3300046522 Bacteria 1604
201 Ga0495648_0012409 3300046524 Bacteria 6361
202 Ga0495648_0017180 3300046524 Bacteria 5182
203 Ga0495648_0106318 3300046524 Bacteria 1537
204 Ga0495654_0000091 3300046530 Bacteria 101543
205 Ga0495597_0005290 3300046542 Bacteria 6854
206 Ga0495633_0010374 3300046558 Bacteria 5086
207 Ga0495633_0159160 3300046558 Bacteria 1042
208 Ga0495668_0008361 3300046616 Bacteria 6476
209 Ga0495611_0111358 3300046648 Bacteria 1274
210 Ga0495625_0008794 3300046660 Bacteria 8551
211 Ga0495625_0013022 3300046660 Bacteria 6707
212 Ga0495625_0058361 3300046660 Bacteria 2742
213 Ga0495625_0063291 3300046660 Bacteria 2612
214 Ga0495661_0000010 3300046665 Bacteria 284261
215 Ga0495613_0053943 3300046689 Bacteria 2956
216 Ga0495670_0120059 3300046691 Bacteria 1365
217 Ga0495671_0001667 3300046692 Bacteria 14528
218 Ga0495671_0007781 3300046692 Bacteria 6069
219 Ga0495671_0126537 3300046692 Bacteria 1246
220 Ga0495649_0002902 3300046694 Bacteria 11864
221 Ga0495649_0044589 3300046694 Bacteria 2421
222 Ga0495589_0004066 3300046794 Bacteria 7837
223 Ga0495589_0122668 3300046794 Bacteria 1251
224 Ga0495660_0000028 3300046810 Bacteria 244534
225 Ga0495660_0000247 3300046810 Bacteria 52182
226 Ga0495660_0034326 3300046810 Bacteria 2839
227 Ga0495672_0000003 3300047320 Bacteria 728845
228 Ga0495672_0007694 3300047320 Bacteria 8070
229 Ga0495672_0057811 3300047320 Bacteria 2251
230 Ga0495683_0060409 3300047323 Bacteria 1879
231 Ga0495683_0064235 3300047323 Bacteria 1812
232 Ga0495687_021804 3300047443 Bacteria 3088
233 Ga0495687_077444 3300047443 Bacteria 1313
234 Ga0495673_0000011 3300047469 Bacteria 674140
235 Ga0495681_0021257 3300047470 Bacteria 3500
236 Ga0495686_0004463 3300047472 Bacteria 11520
237 Ga0495686_0073594 3300047472 Bacteria 2098
238 Ga0495615_0006074 3300048090 Bacteria 2214
239 Ga0496101_0000097 3300048904 Bacteria 91033
240 Ga0496104_0014490 3300048907 Bacteria 7122
241 Ga0496113_0060479 3300048916 Bacteria 2856
242 Ga0496116_0007889 3300048919 Bacteria 9339
243 Ga0496116_0013873 3300048919 Bacteria 6466
244 Ga0496116_0093514 3300048919 Bacteria 1820
245 Ga0496116_0122953 3300048919 Bacteria 1497
246 Ga0496117_0000066 3300048920 Bacteria 253534
247 Ga0496117_0009038 3300048920 Bacteria 9367
248 Ga0496117_0013467 3300048920 Bacteria 7133
249 Ga0496117_0026935 3300048920 Bacteria 4488
250 Ga0496117_0029060 3300048920 Bacteria 4268
251 Ga0496118_0000477 3300048921 Bacteria 66433
252 Ga0496118_0001254 3300048921 Bacteria 38992
253 Ga0496118_0028332 3300048921 Bacteria 4719
254 Ga0496118_0045182 3300048921 Bacteria 3442
255 Ga0496118_0058925 3300048921 Bacteria 2864
256 Ga0496118_0084452 3300048921 Bacteria 2215
257 Ga0496118_0117731 3300048921 Bacteria 1742
258 Ga0496119_0010690 3300048922 Bacteria 7691
259 Ga0496119_0021111 3300048922 Bacteria 4719
260 Ga0496119_0050985 3300048922 Bacteria 2547
261 Ga0496120_0000068 3300048923 Bacteria 166108
262 Ga0496120_0000100 3300048923 Bacteria 143064
263 Ga0496120_0022442 3300048923 Bacteria 3970
264 Ga0496120_0075698 3300048923 Bacteria 1836
265 Ga0496121_0000005 3300048924 Bacteria 1034486
266 Ga0496121_0000615 3300048924 Bacteria 66351
267 Ga0496121_0019350 3300048924 Bacteria 6811
268 Ga0496121_0057834 3300048924 Bacteria 3211
269 Ga0496121_0126967 3300048924 Bacteria 1916
270 Ga0496122_0000057 3300048925 Bacteria 253452
271 Ga0496122_0001663 3300048925 Bacteria 34489
272 Ga0496122_0006592 3300048925 Bacteria 13251
273 Ga0496122_0021174 3300048925 Bacteria 5833
274 Ga0496123_0000096 3300048926 Bacteria 173914
275 Ga0496123_0001369 3300048926 Bacteria 34241
276 Ga0496123_0019416 3300048926 Bacteria 5357
277 Ga0496123_0022430 3300048926 Bacteria 4866
278 Ga0496123_0083065 3300048926 Bacteria 1938
279 Ga0496124_0000035 3300048927 Bacteria 318099
280 Ga0496124_0000092 3300048927 Bacteria 189213
281 Ga0496124_0000254 3300048927 Bacteria 103551
282 Ga0496124_0017817 3300048927 Bacteria 6677
283 Ga0496124_0112033 3300048927 Bacteria 2194
284 Ga0496124_0118288 3300048927 Bacteria 2121
285 Ga0496124_0209363 3300048927 Bacteria 1476
286 Ga0496125_0000034 3300048928 Bacteria 348231
287 Ga0496125_0000103 3300048928 Bacteria 201675
288 Ga0496125_0038672 3300048928 Bacteria 4124
289 Ga0496125_0054593 3300048928 Bacteria 3263
290 Ga0496126_0028598 3300048929 Bacteria 5310
291 Ga0496126_0041673 3300048929 Bacteria 4247
292 Ga0496126_0145173 3300048929 Bacteria 2039
293 Ga0495678_000198 3300049459 Bacteria 70659
294 Ga0495678_023616 3300049459 Bacteria 2669
295 Ga0495678_046726 3300049459 Bacteria 1699
296 Ga0495682_0000006 3300049460 Bacteria 316373
297 Ga0501033_0059875 3300049570 Bacteria 2811
298 Ga0501034_0027901 3300049571 Bacteria 5741
299 Ga0501038_0122979 3300049574 Bacteria 2138
300 Ga0501039_0113215 3300049575 Bacteria 2122
301 nmdc:mga03683_61867_c1 3300050489 Bacteria 1584
302 nmdc:mga03n38_451_c1 3300050490 Bacteria 10269
303 nmdc:mga03n38_59313_c1 3300050490 Bacteria 1736
304 nmdc:mga00v17_120062_c1 3300050491 Bacteria 1673
305 nmdc:mga00v17_14_c1 3300050491 Bacteria 126589
306 nmdc:mga00v17_17_c1 3300050491 Bacteria 121949
307 nmdc:mga00v17_659_c1 3300050491 Bacteria 19038
308 nmdc:mga0yw44_130029_c1 3300050492 Bacteria 1629
309 nmdc:mga0yw44_62_c1 3300050492 Bacteria 38741
310 nmdc:mga0k408_22477_c1 3300050493 Bacteria 3552
311 nmdc:mga0k408_5814_c1 3300050493 Bacteria 6569
312 nmdc:mga06z11_53976_c1 3300050494 Bacteria 2069
313 nmdc:mga06z11_57402_c1 3300050494 Bacteria 2017
314 nmdc:mga0sz30_2962_c2 3300050516 Bacteria 5278
315 nmdc:mga0sz30_769_c1 3300050516 Bacteria 11702
316 Ga0500610_0069523 3300053079 Bacteria 1836
317 Ga0500578_0082326 3300053086 Bacteria 2045
318 Ga0500560_001940 3300053107 Bacteria 3796
319 Ga0500594_0001030 3300053118 Bacteria 5964
320 Ga0500607_015621 3300053121 Bacteria 4369
321 Ga0500618_000852 3300053125 Bacteria 16400
322 Ga0500621_000004 3300053126 Bacteria 485792
323 Ga0500642_0149588 3300053130 Bacteria 1096
324 Ga0500658_0005712 3300053134 Bacteria 4632
325 Ga0500659_0002717 3300053135 Bacteria 10572
326 Ga0500561_0001124 3300053137 Bacteria 4326
327 Ga0500568_0000168 3300053139 Bacteria 56752
328 Ga0500573_0014914 3300053140 Bacteria 4399
329 Ga0500616_0000094 3300053153 Bacteria 181038
330 Ga0500616_0006913 3300053153 Bacteria 7316
331 Ga0500622_0000624 3300053156 Bacteria 31879
332 Ga0500622_0012937 3300053156 Bacteria 4507
333 Ga0500624_000608 3300053157 Bacteria 9781
334 Ga0500624_008136 3300053157 Bacteria 1461
335 Ga0500627_0106755 3300053158 Bacteria 1259
336 Ga0500634_0000008 3300053161 Bacteria 152203
337 Ga0500634_0001961 3300053161 Bacteria 8400
338 Ga0500634_0008641 3300053161 Bacteria 5100
339 Ga0500636_0001061 3300053177 Bacteria 14730
340 Ga0500636_0002411 3300053177 Bacteria 10343
341 Ga0500645_060126 3300053730 Bacteria 1100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2690316117 2692317803 278
2 3300002987 JGI25159J45721_1000012 JGI25159J45721_1000012140 287
3 3300003354 JGI25160J50197_1000042 JGI25160J50197_100004214 287
4 3300003374 JGI25161J50226_1000560 JGI25161J50226_10005606 287
5 3300004625 Ga0055543_1000123 Ga0055543_100012314 287
6 3300005262 Ga0065165_1000960 Ga0065165_100096014 287
7 3300025284 Ga0209130_1000075 Ga0209130_100007515 287
8 3300025294 Ga0209025_1001974 Ga0209025_100197423 287
9 3300025302 Ga0207426_1000163 Ga0207426_100016315 287
10 iso_pu_bacteria 2585427594 2585848002 292
11 3300025291 Ga0209675_1027718 Ga0209675_10277182 293
12 3300046558 Ga0495633_0159160 Ga0495633_0159160_95_991 294
13 3300046452 Ga0495617_031500 Ga0495617_031500_844_1746 296
14 3300047443 Ga0495687_077444 Ga0495687_077444_342_1244 296
15 3300042013 Ga0439456_042255 Ga0439456_042255_50_943 297
16 3300046474 Ga0495605_0149196 Ga0495605_0149196_50_952 297
17 3300046491 Ga0495584_0009609 Ga0495584_0009609_28_921 297
18 3300046515 Ga0495620_0089377 Ga0495620_0089377_317_1219 297
19 3300047472 Ga0495686_0073594 Ga0495686_0073594_1162_2064 297
20 3300048090 Ga0495615_0006074 Ga0495615_0006074_50_952 297
21 3300048927 Ga0496124_0209363 Ga0496124_0209363_49_951 297
22 3300049574 Ga0501038_0122979 Ga0501038_0122979_1206_2105 297
23 iso_pu_bacteria 2908669403 2908673775 310
24 3300003322 rootL2_10070558 rootL2_100705583 311
25 3300009092 Ga0105250_10000017 Ga0105250_1000001758 312
26 iso_pu_bacteria 3005710791 3005716985 312
27 iso_pu_bacteria 2904584206 2904586070 313
28 iso_pu_bacteria 2904589729 2904592117 313
29 iso_pu_bacteria 2904601388 2904601726 313
30 iso_pu_bacteria 2919079590 2919084819 313
31 iso_pu_bacteria 8019648815 8019656830 314
32 iso_pu_bacteria 8056967851 8056968501 314
33 iso_pu_bacteria 2854916844 2854920109 315
34 iso_pu_bacteria 8049293176 8049297659 315
35 iso_pu_bacteria 8054558443 8054560533 315
36 3300006195 Ga0075366_10000903 Ga0075366_100009033 316
37 3300041505 Ga0451849_0175285 Ga0451849_0175285_637_1596 316
38 3300050493 nmdc:mga0k408_5814_c1 nmdc:mga0k408_5814_c1_4717_5697 316
39 3300005563 Ga0068855_100028498 Ga0068855_1000284981 317
40 3300009036 Ga0105244_10129383 Ga0105244_101293832 317
41 3300009098 Ga0105245_10018869 Ga0105245_100188697 317
42 3300015261 Ga0182006_1002039 Ga0182006_100203911 317
43 3300025728 Ga0207655_1079928 Ga0207655_10799281 317
44 3300025911 Ga0207654_10121195 Ga0207654_101211952 317
45 3300025949 Ga0207667_10033161 Ga0207667_100331616 317
46 3300037312 Ga0395899_0002715 Ga0395899_0002715_7121_8110 317
47 3300037418 Ga0395900_0074588 Ga0395900_0074588_2102_3091 317
48 3300038443 Ga0395901_0114716 Ga0395901_0114716_446_1435 317
49 3300005331 Ga0070670_100279478 Ga0070670_1002794782 318
50 3300005338 Ga0068868_100143872 Ga0068868_1001438722 318
51 3300005434 Ga0070709_10000273 Ga0070709_1000027328 318
52 3300005578 Ga0068854_100012849 Ga0068854_1000128493 318
53 3300005617 Ga0068859_100151964 Ga0068859_1001519643 318
54 3300005841 Ga0068863_100204565 Ga0068863_1002045653 318
55 3300006178 Ga0075367_10044204 Ga0075367_100442041 318
56 3300006931 Ga0097620_100151953 Ga0097620_1001519533 318
57 3300009098 Ga0105245_10319496 Ga0105245_103194962 318
58 3300009545 Ga0105237_10315444 Ga0105237_103154442 318
59 3300025299 Ga0209256_1000175 Ga0209256_100017582 318
60 3300026088 Ga0207641_10193418 Ga0207641_101934182 318
61 3300028379 Ga0268266_10218072 Ga0268266_102180722 318
62 3300037471 Ga0395905_0089861 Ga0395905_0089861_817_1806 318
63 3300053130 Ga0500642_0149588 Ga0500642_0149588_113_1081 318
64 3300005459 Ga0068867_100033091 Ga0068867_1000330914 319
65 3300005577 Ga0068857_100355558 Ga0068857_1003555582 319
66 3300006195 Ga0075366_10162500 Ga0075366_101625002 319
67 3300006353 Ga0075370_10010939 Ga0075370_100109392 319
68 3300013250 Ga0171462_1015 Ga0171462_1015137 319
69 3300025907 Ga0207645_10104491 Ga0207645_101044913 319
70 3300031730 Ga0307516_10060407 Ga0307516_100604073 319
71 3300050493 nmdc:mga0k408_22477_c1 nmdc:mga0k408_22477_c1_1972_2961 319
72 3300053161 Ga0500634_0000008 Ga0500634_0000008_85256_86239 319
73 3300047320 Ga0495672_0007694 Ga0495672_0007694_3892_4914 320
74 iso_pu_bacteria 2513237094 2513644762 320
75 iso_pu_bacteria 2824600985 2824601048 320
76 iso_pu_bacteria 2856287931 2856288051 320
77 iso_pu_bacteria 2932794094 2932796067 320
78 iso_pu_bacteria 3005718088 3005722755 320
79 iso_pu_bacteria 2513237159 2513998260 321
80 iso_pu_bacteria 2582581306 2585268711 321
81 iso_pu_bacteria 2582581865 2585389356 321
82 iso_pu_bacteria 2842521101 2842523366 321
83 3300003203 JGI25406J46586_10001001 JGI25406J46586_100010017 322
84 3300005985 Ga0081539_10005289 Ga0081539_100052897 322
85 iso_pu_bacteria 2718218233 2720616803 322
86 iso_pu_bacteria 2718218235 2720628159 322
87 iso_pu_bacteria 2718218269 2720771739 322
88 iso_pu_bacteria 2721755685 2723571493 322
89 iso_pu_bacteria 2721755819 2724087288 322
90 iso_pu_bacteria 2721755822 2724100999 322
91 iso_pu_bacteria 2838068647 2838072506 322
92 iso_pu_bacteria 2842422224 2842426046 322
93 iso_pu_bacteria 2857357740 2857358327 322
94 iso_pu_bacteria 8005282627 8005287330 322
95 iso_pu_bacteria 8005626139 8005632029 322
96 3300021320 Ga0214544_1000584 Ga0214544_100058459 323
97 3300021321 Ga0214542_1003702 Ga0214542_100370218 323
98 3300021327 Ga0214543_1003409 Ga0214543_100340919 323
99 3300025297 Ga0209758_1011155 Ga0209758_10111554 323
100 3300053135 Ga0500659_0002717 Ga0500659_0002717_1933_2904 323
101 iso_pu_bacteria 2582581866 2585393488 323
102 iso_pu_bacteria 2718217927 2719389971 323
103 iso_pu_bacteria 2767802442 2770199354 323
104 iso_pu_bacteria 2775506902 2776268377 323
105 iso_pu_bacteria 2775506904 2776283204 323
106 iso_pu_bacteria 3003930520 3003935042 323
107 iso_pu_bacteria 8005275841 8005276095 323
108 iso_pu_bacteria 8005430974 8005435726 323
109 3300005347 Ga0070668_100119865 Ga0070668_1001198652 324
110 3300021320 Ga0214544_1016021 Ga0214544_10160218 324
111 3300046524 Ga0495648_0106318 Ga0495648_0106318_285_1262 324
112 3300046689 Ga0495613_0053943 Ga0495613_0053943_148_1125 324
113 iso_pu_bacteria 2509276021 2509390995 324
114 iso_pu_bacteria 2509276033 2509441843 324
115 iso_pu_bacteria 2510065019 2510137448 324
116 iso_pu_bacteria 2510461069 2510842114 324
117 iso_pu_bacteria 2510461076 2510893327 324
118 iso_pu_bacteria 2510917022 2511131669 324
119 iso_pu_bacteria 2510917026 2511168741 324
120 iso_pu_bacteria 2510917028 2511184228 324
121 iso_pu_bacteria 2510917030 2511193664 324
122 iso_pu_bacteria 2511231025 2511382425 324
123 iso_pu_bacteria 2511231035 2511433596 324
124 iso_pu_bacteria 2512047086 2512531371 324
125 iso_pu_bacteria 2513237084 2513572079 324
126 iso_pu_bacteria 2513237085 2513576002 324
127 iso_pu_bacteria 2513237093 2513633546 324
128 iso_pu_bacteria 2513237103 2513712158 324
129 iso_pu_bacteria 2513237138 2513871206 324
130 iso_pu_bacteria 2513237144 2513914371 324
131 iso_pu_bacteria 2513237146 2513923799 324
132 iso_pu_bacteria 2513237162 2514019222 324
133 iso_pu_bacteria 2515075009 2515109519 324
134 iso_pu_bacteria 2515154113 2515634288 324
135 iso_pu_bacteria 2515154114 2515641835 324
136 iso_pu_bacteria 2515154116 2515658893 324
137 iso_pu_bacteria 2515154134 2515742575 324
138 iso_pu_bacteria 2516143018 2516205881 324
139 iso_pu_bacteria 2516653077 2517042586 324
140 iso_pu_bacteria 2516653085 2517081461 324
141 iso_pu_bacteria 2517093000 2517100156 324
142 iso_pu_bacteria 2517287029 2517411233 324
143 iso_pu_bacteria 2529292951 2530648571 324
144 iso_pu_bacteria 2537561587 2537873031 324
145 iso_pu_bacteria 2554235003 2554245024 324
146 iso_pu_bacteria 2558860242 2559297145 324
147 iso_pu_bacteria 2558860983 2561468743 324
148 iso_pu_bacteria 2582581294 2585204676 324
149 iso_pu_bacteria 2582581298 2585221975 324
150 iso_pu_bacteria 2582581307 2585275143 324
151 iso_pu_bacteria 2582581315 2585324238 324
152 iso_pu_bacteria 2582581867 2585403000 324
153 iso_pu_bacteria 2585427526 2585526549 324
154 iso_pu_bacteria 2585427528 2585538855 324
155 iso_pu_bacteria 2585427529 2585545072 324
156 iso_pu_bacteria 2585427531 2585561143 324
157 iso_pu_bacteria 2585427590 2585820024 324
158 iso_pu_bacteria 2585427593 2585836806 324
159 iso_pu_bacteria 2585427608 2585899792 324
160 iso_pu_bacteria 2585427609 2585908265 324
161 iso_pu_bacteria 2585427633 2585992740 324
162 iso_pu_bacteria 2585427634 2586003402 324
163 iso_pu_bacteria 2585428125 2587983700 324
164 iso_pu_bacteria 2599185170 2599415830 324
165 iso_pu_bacteria 2599185352 2600194569 324
166 iso_pu_bacteria 2600255279 2601611448 324
167 iso_pu_bacteria 2600255308 2601748131 324
168 iso_pu_bacteria 2615840624 2616294293 324
169 iso_pu_bacteria 2615840698 2616555651 324
170 iso_pu_bacteria 2617270742 2617380914 324
171 iso_pu_bacteria 2643221568 2643857223 324
172 iso_pu_bacteria 2643221582 2643916777 324
173 iso_pu_bacteria 2643221693 2644520352 324
174 iso_pu_bacteria 2718217882 2719184229 324
175 iso_pu_bacteria 2718217997 2719669570 324
176 iso_pu_bacteria 2718218009 2719729802 324
177 iso_pu_bacteria 2718218199 2720494586 324
178 iso_pu_bacteria 2718218232 2720610923 324
179 iso_pu_bacteria 2718218363 2721144052 324
180 iso_pu_bacteria 2718218365 2721156740 324
181 iso_pu_bacteria 2718218366 2721161427 324
182 iso_pu_bacteria 2718218423 2721403610 324
183 iso_pu_bacteria 2721755514 2722837380 324
184 iso_pu_bacteria 2721755556 2723030993 324
185 iso_pu_bacteria 2721755684 2723563500 324
186 iso_pu_bacteria 2721755809 2724035186 324
187 iso_pu_bacteria 2721755810 2724040956 324
188 iso_pu_bacteria 2721755823 2724108240 324
189 iso_pu_bacteria 2724679232 2725946407 324
190 iso_pu_bacteria 2728369352 2730105459 324
191 iso_pu_bacteria 2728369365 2730162369 324
192 iso_pu_bacteria 2728369397 2730295501 324
193 iso_pu_bacteria 2738541333 2739034277 324
194 iso_pu_bacteria 2751185821 2753459721 324
195 iso_pu_bacteria 2765235942 2766068297 324
196 iso_pu_bacteria 2775507266 2778176921 324
197 iso_pu_bacteria 2791355256 2793295888 324
198 iso_pu_bacteria 2791355259 2793312827 324
199 iso_pu_bacteria 2791355260 2793323235 324
200 iso_pu_bacteria 2791355261 2793326808 324
201 iso_pu_bacteria 2791355262 2793334618 324
202 iso_pu_bacteria 2791355263 2793340663 324
203 iso_pu_bacteria 2791355264 2793348577 324
204 iso_pu_bacteria 2791355265 2793354201 324
205 iso_pu_bacteria 2791355266 2793361748 324
206 iso_pu_bacteria 2791355267 2793367263 324
207 iso_pu_bacteria 2802429605 2805929793 324
208 iso_pu_bacteria 2802429606 2805933143 324
209 iso_pu_bacteria 2802429633 2806043078 324
210 iso_pu_bacteria 2802429634 2806051030 324
211 iso_pu_bacteria 2802429635 2806057801 324
212 iso_pu_bacteria 2802429636 2806065482 324
213 iso_pu_bacteria 2802429637 2806075277 324
214 iso_pu_bacteria 2808606387 2808988898 324
215 iso_pu_bacteria 2821123053 2821128925 324
216 iso_pu_bacteria 2838016132 2838019635 324
217 iso_pu_bacteria 2838022645 2838027164 324
218 iso_pu_bacteria 2838035591 2838035948 324
219 iso_pu_bacteria 2838061910 2838066414 324
220 iso_pu_bacteria 2838661181 2838665036 324
221 iso_pu_bacteria 2838668709 2838669076 324
222 iso_pu_bacteria 2838675328 2838678406 324
223 iso_pu_bacteria 2838680041 2838686054 324
224 iso_pu_bacteria 2838686498 2838688479 324
225 iso_pu_bacteria 2838694306 2838700575 324
226 iso_pu_bacteria 2838701080 2838701264 324
227 iso_pu_bacteria 2838707686 2838713854 324
228 iso_pu_bacteria 2838714209 2838716686 324
229 iso_pu_bacteria 2838719591 2838722702 324
230 iso_pu_bacteria 2838724970 2838727437 324
231 iso_pu_bacteria 2838729681 2838734386 324
232 iso_pu_bacteria 2838736955 2838742241 324
233 iso_pu_bacteria 2838742623 2838746845 324
234 iso_pu_bacteria 2841840854 2841846097 324
235 iso_pu_bacteria 2841846520 2841849067 324
236 iso_pu_bacteria 2841851746 2841852220 324
237 iso_pu_bacteria 2841859092 2841861910 324
238 iso_pu_bacteria 2841864319 2841865668 324
239 iso_pu_bacteria 2842077413 2842082992 324
240 iso_pu_bacteria 2842110456 2842111690 324
241 iso_pu_bacteria 2842118031 2842124199 324
242 iso_pu_bacteria 2842124991 2842128184 324
243 iso_pu_bacteria 2842130223 2842133299 324
244 iso_pu_bacteria 2842140634 2842145801 324
245 iso_pu_bacteria 2842146304 2842146671 324
246 iso_pu_bacteria 2842152218 2842155292 324
247 iso_pu_bacteria 2842156927 2842158705 324
248 iso_pu_bacteria 2842163707 2842166125 324
249 iso_pu_bacteria 2842170452 2842173792 324
250 iso_pu_bacteria 2842175837 2842178913 324
251 iso_pu_bacteria 2842180545 2842182319 324
252 iso_pu_bacteria 2842187318 2842189794 324
253 iso_pu_bacteria 2842192696 2842193936 324
254 iso_pu_bacteria 2842198810 2842200638 324
255 iso_pu_bacteria 2842205361 2842208511 324
256 iso_pu_bacteria 2842211629 2842214108 324
257 iso_pu_bacteria 2842217011 2842222536 324
258 iso_pu_bacteria 2842224351 2842226828 324
259 iso_pu_bacteria 2842229732 2842234668 324
260 iso_pu_bacteria 2842237096 2842243267 324
261 iso_pu_bacteria 2842243621 2842248401 324
262 iso_pu_bacteria 2842250916 2842251099 324
263 iso_pu_bacteria 2842257432 2842262426 324
264 iso_pu_bacteria 2842271015 2842272571 324
265 iso_pu_bacteria 2842278818 2842282143 324
266 iso_pu_bacteria 2842285085 2842289172 324
267 iso_pu_bacteria 2842291075 2842297251 324
268 iso_pu_bacteria 2842304105 2842307988 324
269 iso_pu_bacteria 2842311132 2842313228 324
270 iso_pu_bacteria 2842317721 2842319350 324
271 iso_pu_bacteria 2842341865 2842345598 324
272 iso_pu_bacteria 2842363717 2842363895 324
273 iso_pu_bacteria 2842370503 2842376327 324
274 iso_pu_bacteria 2842377471 2842383645 324
275 iso_pu_bacteria 2842384541 2842390784 324
276 iso_pu_bacteria 2842402390 2842407378 324
277 iso_pu_bacteria 2842409023 2842413373 324
278 iso_pu_bacteria 2842415677 2842420016 324
279 iso_pu_bacteria 2842428310 2842430192 324
280 iso_pu_bacteria 2842441272 2842442856 324
281 iso_pu_bacteria 2842447887 2842452467 324
282 iso_pu_bacteria 2842462802 2842464444 324
283 iso_pu_bacteria 2842469257 2842471189 324
284 iso_pu_bacteria 2842489311 2842490689 324
285 iso_pu_bacteria 2842495871 2842498898 324
286 iso_pu_bacteria 2842509118 2842513323 324
287 iso_pu_bacteria 2842515876 2842517824 324
288 iso_pu_bacteria 2844454524 2844461469 324
289 iso_pu_bacteria 2847417321 2847423697 324
290 iso_pu_bacteria 2848992105 2848998783 324
291 iso_pu_bacteria 2854601825 2854601876 324
292 iso_pu_bacteria 2854896431 2854896895 324
293 iso_pu_bacteria 2855195626 2855199493 324
294 iso_pu_bacteria 2855872281 2855873026 324
295 iso_pu_bacteria 2857516855 2857520707 324
296 iso_pu_bacteria 2857531043 2857536418 324
297 iso_pu_bacteria 2876601092 2876605933 324
298 iso_pu_bacteria 2899792073 2899792997 324
299 iso_pu_bacteria 2899803654 2899805746 324
300 iso_pu_bacteria 2899845264 2899850579 324
301 iso_pu_bacteria 2913295892 2913298877 324
302 iso_pu_bacteria 2919100787 2919102522 324
303 iso_pu_bacteria 2919114240 2919116903 324
304 iso_pu_bacteria 2919166419 2919170367 324
305 iso_pu_bacteria 2919171160 2919177152 324
306 iso_pu_bacteria 2920760137 2920762614 324
307 iso_pu_bacteria 2923556063 2923559705 324
308 iso_pu_bacteria 2926754445 2926758416 324
309 iso_pu_bacteria 2926760298 2926764112 324
310 iso_pu_bacteria 2929138655 2929142588 324
311 iso_pu_bacteria 2933006813 2933009329 324
312 iso_pu_bacteria 2933011516 2933013453 324
313 iso_pu_bacteria 2933016740 2933020144 324
314 iso_pu_bacteria 2933570622 2933574438 324
315 iso_pu_bacteria 2933586486 2933590896 324
316 iso_pu_bacteria 2933594066 2933599213 324
317 iso_pu_bacteria 2935894831 2935900891 324
318 iso_pu_bacteria 2935901341 2935907611 324
319 iso_pu_bacteria 2936367885 2936370867 324
320 iso_pu_bacteria 2936381700 2936382553 324
321 iso_pu_bacteria 2969079654 2969083905 324
322 iso_pu_bacteria 2979089926 2979090790 324
323 iso_pu_bacteria 2979095461 2979096313 324
324 iso_pu_bacteria 2979100975 2979101590 324
325 iso_pu_bacteria 2984509177 2984510459 324
326 iso_pu_bacteria 2984518228 2984518835 324
327 iso_pu_bacteria 2984537506 2984538809 324
328 iso_pu_bacteria 2996887358 2996891440 324
329 iso_pu_bacteria 2996893221 2996896555 324
330 iso_pu_bacteria 639633055 639651024 324
331 iso_pu_bacteria 643692032 643822046 324
332 iso_pu_bacteria 650716007 650843571 324
333 iso_pu_bacteria 8003570095 8003573137 324
334 iso_pu_bacteria 8005258706 8005263991 324
335 iso_pu_bacteria 8005289223 8005289934 324
336 iso_pu_bacteria 8005307578 8005311534 324
337 iso_pu_bacteria 8005321885 8005325967 324
338 iso_pu_bacteria 8005382845 8005389369 324
339 iso_pu_bacteria 8005395548 8005396769 324
340 iso_pu_bacteria 8005460587 8005466218 324
341 iso_pu_bacteria 8005497431 8005503470 324
342 iso_pu_bacteria 8005556819 8005563258 324
343 iso_pu_bacteria 8005563573 8005564807 324
344 iso_pu_bacteria 8005570704 8005575929 324
345 iso_pu_bacteria 8005619151 8005625772 324
346 iso_pu_bacteria 8005668836 8005675348 324
347 iso_pu_bacteria 8005682033 8005688394 324
348 iso_pu_bacteria 8005695170 8005695313 324
349 iso_pu_bacteria 8016733728 8016737478 324
350 iso_pu_bacteria 8018127388 8018134608 324
351 iso_pu_bacteria 8018163183 8018169787 324
352 iso_pu_bacteria 8018176218 8018180680 324
353 iso_pu_bacteria 8019499862 8019502702 324
354 iso_pu_bacteria 8023680758 8023686051 324
355 iso_pu_bacteria 8024479707 8024485328 324
356 iso_pu_bacteria 8024501048 8024506992 324
357 iso_pu_bacteria 8056375014 8056381909 324
358 iso_pu_bacteria 8056382006 8056385439 324
359 iso_pu_bacteria 8057874678 8057876313 324
360 3300013308 Ga0157375_10832866 Ga0157375_108328661 325
361 3300027312 Ga0209371_1004217 Ga0209371_10042176 325
362 3300030500 Ga0268256_1003884 Ga0268256_10038846 325
363 3300046458 Ga0495591_000589 Ga0495591_000589_13010_13987 325
364 3300046474 Ga0495605_0091748 Ga0495605_0091748_36_1013 325
365 3300046492 Ga0495585_0000072 Ga0495585_0000072_28620_29597 325
366 3300046507 Ga0495606_0001031 Ga0495606_0001031_35904_36881 325
367 3300046530 Ga0495654_0000091 Ga0495654_0000091_70081_71058 325
368 3300046648 Ga0495611_0111358 Ga0495611_0111358_24_1001 325
369 3300046660 Ga0495625_0063291 Ga0495625_0063291_922_1911 325
370 3300046665 Ga0495661_0000010 Ga0495661_0000010_138948_139925 325
371 3300046794 Ga0495589_0004066 Ga0495589_0004066_4525_5502 325
372 3300046810 Ga0495660_0000247 Ga0495660_0000247_43117_44094 325
373 3300048927 Ga0496124_0000035 Ga0496124_0000035_237545_238522 325
374 3300053121 Ga0500607_015621 Ga0500607_015621_3081_4070 325
375 3300053125 Ga0500618_000852 Ga0500618_000852_15208_16185 325
376 3300053156 Ga0500622_0012937 Ga0500622_0012937_924_1925 325
377 3300053157 Ga0500624_008136 Ga0500624_008136_193_1182 325
378 3300053161 Ga0500634_0001961 Ga0500634_0001961_3757_4746 325
379 3300053177 Ga0500636_0002411 Ga0500636_0002411_5620_6621 325
380 3300041404 Ga0439436_0001393 Ga0439436_0001393_1999_2991 326
381 3300041413 Ga0439465_0004456 Ga0439465_0004456_3431_4423 326
382 3300042122 Ga0450920_007657 Ga0450920_007657_612_1604 326
383 3300042145 Ga0450906_000341 Ga0450906_000341_6181_7173 326
384 3300042147 Ga0450910_011684 Ga0450910_011684_30_1022 326
385 3300042531 Ga0450918_001311 Ga0450918_001311_494_1486 326
386 3300053177 Ga0500636_0001061 Ga0500636_0001061_10057_11049 326
387 3300025284 Ga0209130_1020248 Ga0209130_10202481 327
388 3300025302 Ga0207426_1001062 Ga0207426_100106228 327
389 3300028794 Ga0307515_10000068 Ga0307515_1000006856 327
390 3300028794 Ga0307515_10007397 Ga0307515_100073979 327
391 3300031456 Ga0307513_10007057 Ga0307513_1000705712 327
392 3300046460 Ga0495638_0000373 Ga0495638_0000373_29817_30812 327
393 3300046492 Ga0495585_0006925 Ga0495585_0006925_1163_2158 327
394 3300046506 Ga0495583_0018650 Ga0495583_0018650_1527_2522 327
395 3300046512 Ga0495610_0000202 Ga0495610_0000202_50962_51951 327
396 3300046513 Ga0495616_0019644 Ga0495616_0019644_2612_3607 327
397 3300046515 Ga0495620_0024401 Ga0495620_0024401_1069_2058 327
398 3300046515 Ga0495620_0034207 Ga0495620_0034207_1164_2159 327
399 3300046518 Ga0495631_0011120 Ga0495631_0011120_1779_2774 327
400 3300046519 Ga0495632_0051955 Ga0495632_0051955_927_1922 327
401 3300046522 Ga0495643_0088191 Ga0495643_0088191_374_1363 327
402 3300046616 Ga0495668_0008361 Ga0495668_0008361_1041_2036 327
403 3300046660 Ga0495625_0008794 Ga0495625_0008794_7109_8104 327
404 3300046692 Ga0495671_0126537 Ga0495671_0126537_79_1074 327
405 3300047320 Ga0495672_0057811 Ga0495672_0057811_1089_2084 327
406 3300047472 Ga0495686_0004463 Ga0495686_0004463_10098_11087 327
407 3300048919 Ga0496116_0013873 Ga0496116_0013873_4211_5200 327
408 3300048927 Ga0496124_0000254 Ga0496124_0000254_86396_87385 327
409 3300048927 Ga0496124_0017817 Ga0496124_0017817_2020_3009 327
410 3300049459 Ga0495678_023616 Ga0495678_023616_1543_2538 327
411 3300053079 Ga0500610_0069523 Ga0500610_0069523_727_1722 327
412 3300053118 Ga0500594_0001030 Ga0500594_0001030_2330_3325 327
413 3300053139 Ga0500568_0000168 Ga0500568_0000168_32316_33311 327
414 3300053140 Ga0500573_0014914 Ga0500573_0014914_1171_2166 327
415 3300053153 Ga0500616_0006913 Ga0500616_0006913_132_1127 327
416 3300053730 Ga0500645_060126 Ga0500645_060126_63_1058 327
417 3300002773 JGI25152J39213_1015727 JGI25152J39213_10157272 328
418 3300003187 JGI25151J46595_10000853 JGI25151J46595_100008539 328
419 3300003215 JGI25153J46596_10002995 JGI25153J46596_100029957 328
420 3300003215 JGI25153J46596_10012458 JGI25153J46596_100124582 328
421 3300003354 JGI25160J50197_1000384 JGI25160J50197_10003844 328
422 3300003374 JGI25161J50226_1002732 JGI25161J50226_10027324 328
423 3300003771 Ga0055526_1001933 Ga0055526_100193311 328
424 3300003771 Ga0055526_1004619 Ga0055526_10046194 328
425 3300003790 Ga0055528_1001032 Ga0055528_100103211 328
426 3300003792 Ga0055540_1000066 Ga0055540_100006657 328
427 3300003792 Ga0055540_1007775 Ga0055540_10077754 328
428 3300003794 Ga0055531_10008278 Ga0055531_100082787 328
429 3300004625 Ga0055543_1000671 Ga0055543_10006717 328
430 3300005262 Ga0065165_1031809 Ga0065165_10318091 328
431 3300005548 Ga0070665_100028220 Ga0070665_1000282203 328
432 3300006038 Ga0075365_10004874 Ga0075365_100048748 328
433 3300006051 Ga0075364_10000163 Ga0075364_1000016318 328
434 3300006051 Ga0075364_10005140 Ga0075364_100051401 328
435 3300006051 Ga0075364_10172846 Ga0075364_101728461 328
436 3300006178 Ga0075367_10072463 Ga0075367_100724632 328
437 3300006353 Ga0075370_10000487 Ga0075370_100004875 328
438 3300006353 Ga0075370_10035549 Ga0075370_100355494 328
439 3300006946 Ga0079104_1000014 Ga0079104_100001410 328
440 3300006948 Ga0099826_10000063 Ga0099826_1000006345 328
441 3300009011 Ga0105251_10004091 Ga0105251_100040917 328
442 3300009036 Ga0105244_10011951 Ga0105244_100119513 328
443 3300009092 Ga0105250_10000100 Ga0105250_1000010055 328
444 3300009092 Ga0105250_10012283 Ga0105250_100122834 328
445 3300009148 Ga0105243_10019553 Ga0105243_100195534 328
446 3300009765 Ga0123341_1000005 Ga0123341_100000586 328
447 3300009766 Ga0123342_1018270 Ga0123342_10182706 328
448 3300011119 Ga0105246_10030787 Ga0105246_100307873 328
449 3300011119 Ga0105246_10081628 Ga0105246_100816284 328
450 3300013100 Ga0157373_10002688 Ga0157373_100026888 328
451 3300013100 Ga0157373_10030689 Ga0157373_100306892 328
452 3300013102 Ga0157371_10000187 Ga0157371_100001876 328
453 3300013102 Ga0157371_10000626 Ga0157371_1000062611 328
454 3300013102 Ga0157371_10002218 Ga0157371_100022188 328
455 3300013104 Ga0157370_10004979 Ga0157370_1000497914 328
456 3300013105 Ga0157369_10032985 Ga0157369_100329855 328
457 3300013105 Ga0157369_10043692 Ga0157369_100436924 328
458 3300025245 Ga0207425_1001731 Ga0207425_10017313 328
459 3300025254 Ga0209148_1009465 Ga0209148_10094652 328
460 3300025258 Ga0209129_1000894 Ga0209129_100089412 328
461 3300025273 Ga0209673_1000020 Ga0209673_1000020206 328
462 3300025273 Ga0209673_1000462 Ga0209673_100046236 328
463 3300025273 Ga0209673_1000607 Ga0209673_100060746 328
464 3300025292 Ga0209676_1011176 Ga0209676_10111763 328
465 3300025294 Ga0209025_1000081 Ga0209025_100008195 328
466 3300025295 Ga0209564_1001810 Ga0209564_100181011 328
467 3300025295 Ga0209564_1004282 Ga0209564_10042826 328
468 3300025297 Ga0209758_1000076 Ga0209758_100007677 328
469 3300025297 Ga0209758_1000341 Ga0209758_100034125 328
470 3300025297 Ga0209758_1001742 Ga0209758_10017429 328
471 3300025298 Ga0209050_1005066 Ga0209050_10050662 328
472 3300025299 Ga0209256_1000500 Ga0209256_100050011 328
473 3300025299 Ga0209256_1002281 Ga0209256_10022813 328
474 3300025299 Ga0209256_1004891 Ga0209256_10048918 328
475 3300025302 Ga0207426_1000169 Ga0207426_100016960 328
476 3300025303 Ga0209051_1000038 Ga0209051_100003898 328
477 3300025303 Ga0209051_1002584 Ga0209051_10025842 328
478 3300025303 Ga0209051_1003890 Ga0209051_100389010 328
479 3300025304 Ga0209257_1003097 Ga0209257_10030972 328
480 3300025304 Ga0209257_1015502 Ga0209257_10155022 328
481 3300025304 Ga0209257_1017591 Ga0209257_10175913 328
482 3300025304 Ga0209257_1037316 Ga0209257_10373162 328
483 3300025711 Ga0207696_1000013 Ga0207696_100001364 328
484 3300025711 Ga0207696_1000533 Ga0207696_100053333 328
485 3300025735 Ga0207713_1006904 Ga0207713_10069045 328
486 3300027111 Ga0209281_1000032 Ga0209281_100003212 328
487 3300027312 Ga0209371_1000012 Ga0209371_10000126 328
488 3300027312 Ga0209371_1009659 Ga0209371_10096593 328
489 3300027666 Ga0209282_1000511 Ga0209282_100051119 328
490 3300028379 Ga0268266_10043518 Ga0268266_100435184 328
491 3300028794 Ga0307515_10037826 Ga0307515_100378264 328
492 3300030500 Ga0268256_1000013 Ga0268256_10000136 328
493 3300030500 Ga0268256_1005243 Ga0268256_10052432 328
494 3300041404 Ga0439436_0008513 Ga0439436_0008513_171_1166 328
495 3300041503 Ga0451847_0052262 Ga0451847_0052262_157_1152 328
496 3300041509 Ga0451843_0401027 Ga0451843_0401027_157_1152 328
497 3300041997 Ga0439431_0034746 Ga0439431_0034746_249_1244 328
498 3300042532 Ga0450893_0009321 Ga0450893_0009321_474_1460 328
499 3300046471 Ga0495650_0000008 Ga0495650_0000008_380967_381953 328
500 3300046471 Ga0495650_0000090 Ga0495650_0000090_12737_13723 328
501 3300046492 Ga0495585_0022694 Ga0495585_0022694_2160_3155 328
502 3300046501 Ga0495607_0009165 Ga0495607_0009165_2747_3742 328
503 3300046501 Ga0495607_0015986 Ga0495607_0015986_55_1041 328
504 3300046506 Ga0495583_0036477 Ga0495583_0036477_923_1918 328
505 3300046512 Ga0495610_0036040 Ga0495610_0036040_1083_2078 328
506 3300046515 Ga0495620_0005522 Ga0495620_0005522_5160_6155 328
507 3300046518 Ga0495631_0047312 Ga0495631_0047312_782_1777 328
508 3300046522 Ga0495643_0001110 Ga0495643_0001110_4086_5081 328
509 3300046524 Ga0495648_0012409 Ga0495648_0012409_2787_3782 328
510 3300046524 Ga0495648_0017180 Ga0495648_0017180_4012_4998 328
511 3300046542 Ga0495597_0005290 Ga0495597_0005290_4185_5180 328
512 3300046558 Ga0495633_0010374 Ga0495633_0010374_4008_5003 328
513 3300046660 Ga0495625_0013022 Ga0495625_0013022_4939_5934 328
514 3300046660 Ga0495625_0058361 Ga0495625_0058361_1529_2524 328
515 3300046691 Ga0495670_0120059 Ga0495670_0120059_129_1124 328
516 3300046692 Ga0495671_0001667 Ga0495671_0001667_10289_11275 328
517 3300046692 Ga0495671_0007781 Ga0495671_0007781_1527_2513 328
518 3300046694 Ga0495649_0002902 Ga0495649_0002902_1791_2777 328
519 3300046694 Ga0495649_0044589 Ga0495649_0044589_727_1722 328
520 3300046794 Ga0495589_0122668 Ga0495589_0122668_142_1137 328
521 3300046810 Ga0495660_0000028 Ga0495660_0000028_213634_214620 328
522 3300046810 Ga0495660_0034326 Ga0495660_0034326_1089_2084 328
523 3300047320 Ga0495672_0000003 Ga0495672_0000003_354331_355317 328
524 3300047323 Ga0495683_0060409 Ga0495683_0060409_874_1869 328
525 3300047323 Ga0495683_0064235 Ga0495683_0064235_212_1198 328
526 3300047443 Ga0495687_021804 Ga0495687_021804_1821_2816 328
527 3300047469 Ga0495673_0000011 Ga0495673_0000011_365304_366290 328
528 3300047470 Ga0495681_0021257 Ga0495681_0021257_1034_2029 328
529 3300048904 Ga0496101_0000097 Ga0496101_0000097_26805_27791 328
530 3300048907 Ga0496104_0014490 Ga0496104_0014490_164_1150 328
531 3300048916 Ga0496113_0060479 Ga0496113_0060479_516_1511 328
532 3300048919 Ga0496116_0007889 Ga0496116_0007889_8184_9170 328
533 3300048919 Ga0496116_0093514 Ga0496116_0093514_53_1048 328
534 3300048919 Ga0496116_0122953 Ga0496116_0122953_356_1351 328
535 3300048920 Ga0496117_0000066 Ga0496117_0000066_249202_250197 328
536 3300048920 Ga0496117_0009038 Ga0496117_0009038_8212_9198 328
537 3300048920 Ga0496117_0013467 Ga0496117_0013467_2752_3738 328
538 3300048920 Ga0496117_0026935 Ga0496117_0026935_433_1428 328
539 3300048920 Ga0496117_0029060 Ga0496117_0029060_1723_2718 328
540 3300048921 Ga0496118_0000477 Ga0496118_0000477_48921_49916 328
541 3300048921 Ga0496118_0001254 Ga0496118_0001254_3340_4335 328
542 3300048921 Ga0496118_0028332 Ga0496118_0028332_2595_3581 328
543 3300048921 Ga0496118_0045182 Ga0496118_0045182_1688_2683 328
544 3300048921 Ga0496118_0058925 Ga0496118_0058925_1499_2485 328
545 3300048921 Ga0496118_0084452 Ga0496118_0084452_155_1150 328
546 3300048921 Ga0496118_0117731 Ga0496118_0117731_236_1222 328
547 3300048922 Ga0496119_0010690 Ga0496119_0010690_3468_4463 328
548 3300048922 Ga0496119_0021111 Ga0496119_0021111_1814_2800 328
549 3300048922 Ga0496119_0050985 Ga0496119_0050985_1015_2010 328
550 3300048923 Ga0496120_0000068 Ga0496120_0000068_106555_107541 328
551 3300048923 Ga0496120_0000100 Ga0496120_0000100_3338_4333 328
552 3300048923 Ga0496120_0022442 Ga0496120_0022442_1822_2808 328
553 3300048923 Ga0496120_0075698 Ga0496120_0075698_298_1293 328
554 3300048924 Ga0496121_0000005 Ga0496121_0000005_78350_79345 328
555 3300048924 Ga0496121_0000615 Ga0496121_0000615_50244_51239 328
556 3300048924 Ga0496121_0019350 Ga0496121_0019350_3998_4993 328
557 3300048924 Ga0496121_0057834 Ga0496121_0057834_719_1714 328
558 3300048924 Ga0496121_0126967 Ga0496121_0126967_462_1457 328
559 3300048925 Ga0496122_0000057 Ga0496122_0000057_3338_4333 328
560 3300048925 Ga0496122_0001663 Ga0496122_0001663_33014_34000 328
561 3300048925 Ga0496122_0006592 Ga0496122_0006592_5925_6920 328
562 3300048925 Ga0496122_0021174 Ga0496122_0021174_4096_5082 328
563 3300048926 Ga0496123_0000096 Ga0496123_0000096_169582_170577 328
564 3300048926 Ga0496123_0001369 Ga0496123_0001369_33014_34000 328
565 3300048926 Ga0496123_0019416 Ga0496123_0019416_752_1738 328
566 3300048926 Ga0496123_0022430 Ga0496123_0022430_3826_4821 328
567 3300048926 Ga0496123_0083065 Ga0496123_0083065_511_1506 328
568 3300048927 Ga0496124_0000092 Ga0496124_0000092_157554_158540 328
569 3300048927 Ga0496124_0112033 Ga0496124_0112033_98_1093 328
570 3300048927 Ga0496124_0118288 Ga0496124_0118288_777_1772 328
571 3300048928 Ga0496125_0000034 Ga0496125_0000034_123345_124340 328
572 3300048928 Ga0496125_0000103 Ga0496125_0000103_62949_63935 328
573 3300048928 Ga0496125_0038672 Ga0496125_0038672_1452_2438 328
574 3300048928 Ga0496125_0054593 Ga0496125_0054593_1617_2612 328
575 3300048929 Ga0496126_0028598 Ga0496126_0028598_4072_5058 328
576 3300048929 Ga0496126_0041673 Ga0496126_0041673_3110_4096 328
577 3300048929 Ga0496126_0145173 Ga0496126_0145173_252_1238 328
578 3300049459 Ga0495678_000198 Ga0495678_000198_32474_33460 328
579 3300049459 Ga0495678_046726 Ga0495678_046726_625_1620 328
580 3300049460 Ga0495682_0000006 Ga0495682_0000006_84818_85804 328
581 3300049570 Ga0501033_0059875 Ga0501033_0059875_733_1725 328
582 3300049571 Ga0501034_0027901 Ga0501034_0027901_677_1669 328
583 3300049575 Ga0501039_0113215 Ga0501039_0113215_722_1714 328
584 3300050489 nmdc:mga03683_61867_c1 nmdc:mga03683_61867_c1_188_1183 328
585 3300050490 nmdc:mga03n38_451_c1 nmdc:mga03n38_451_c1_752_1747 328
586 3300050490 nmdc:mga03n38_59313_c1 nmdc:mga03n38_59313_c1_80_1075 328
587 3300050491 nmdc:mga00v17_120062_c1 nmdc:mga00v17_120062_c1_639_1625 328
588 3300050491 nmdc:mga00v17_14_c1 nmdc:mga00v17_14_c1_60708_61703 328
589 3300050491 nmdc:mga00v17_17_c1 nmdc:mga00v17_17_c1_119772_120767 328
590 3300050491 nmdc:mga00v17_659_c1 nmdc:mga00v17_659_c1_13098_14093 328
591 3300050492 nmdc:mga0yw44_130029_c1 nmdc:mga0yw44_130029_c1_623_1618 328
592 3300050492 nmdc:mga0yw44_62_c1 nmdc:mga0yw44_62_c1_3263_4258 328
593 3300050494 nmdc:mga06z11_53976_c1 nmdc:mga06z11_53976_c1_667_1665 328
594 3300050494 nmdc:mga06z11_57402_c1 nmdc:mga06z11_57402_c1_686_1681 328
595 3300050516 nmdc:mga0sz30_2962_c2 nmdc:mga0sz30_2962_c2_817_1809 328
596 3300050516 nmdc:mga0sz30_769_c1 nmdc:mga0sz30_769_c1_3484_4479 328
597 3300053086 Ga0500578_0082326 Ga0500578_0082326_873_1868 328
598 3300053107 Ga0500560_001940 Ga0500560_001940_229_1224 328
599 3300053126 Ga0500621_000004 Ga0500621_000004_296038_297024 328
600 3300053134 Ga0500658_0005712 Ga0500658_0005712_3411_4406 328
601 3300053137 Ga0500561_0001124 Ga0500561_0001124_2030_3025 328
602 3300053153 Ga0500616_0000094 Ga0500616_0000094_40600_41595 328
603 3300053156 Ga0500622_0000624 Ga0500622_0000624_24903_25898 328
604 3300053157 Ga0500624_000608 Ga0500624_000608_8080_9075 328
605 3300053158 Ga0500627_0106755 Ga0500627_0106755_23_1018 328
606 3300053161 Ga0500634_0008641 Ga0500634_0008641_1002_1997 328
607 iso_pu_bacteria 2667528173 2671109910 329
608 iso_pu_bacteria 2904474040 2904478130 329
609 iso_pu_bacteria 2919150387 2919155608 329
610 iso_pu_bacteria 2927143783 2927148029 329
611 2162886007 SwRhRL2b_contig_3441810 SwRhRL2b_0906.00005940 333
612 3300002737 JGI25162J39368_1000441 JGI25162J39368_10004412 333
613 3300002771 JGI25163J39215_1000118 JGI25163J39215_10001182 333
614 3300002772 JGI25164J39214_1000302 JGI25164J39214_100030235 333
615 3300003751 Ga0055538_1000217 Ga0055538_100021735 333
616 3300003752 Ga0055539_1000259 Ga0055539_100025935 333
617 3300003756 Ga0055533_1000250 Ga0055533_100025035 333
618 3300003759 Ga0055525_1000347 Ga0055525_100034735 333
619 3300003841 Ga0055541_1000156 Ga0055541_10001562 333
620 3300005289 Ga0065704_10001785 Ga0065704_100017852 333
621 3300009036 Ga0105244_10007879 Ga0105244_100078796 333
622 3300009092 Ga0105250_10004578 Ga0105250_100045786 333
623 3300025207 Ga0209760_100179 Ga0209760_1001792 333
624 3300025224 Ga0209784_100001 Ga0209784_1000011467 333
625 3300025225 Ga0209566_100001 Ga0209566_1000011467 333
626 3300025226 Ga0209674_100002 Ga0209674_1000021467 333
627 3300025230 Ga0209563_100002 Ga0209563_1000022 333
628 3300025231 Ga0207427_100032 Ga0207427_1000322 333
629 3300025233 Ga0209437_100001 Ga0209437_1000012 333
630 3300025253 Ga0209677_100002 Ga0209677_1000022 333
631 3300025261 Ga0209233_1004558 Ga0209233_10045585 333
632 3300025711 Ga0207696_1004144 Ga0207696_10041441 333
633 3300025728 Ga0207655_1008007 Ga0207655_10080072 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02626

CT_A_B

Carboxyltransferase domain, subdomain A and B

24

296

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dud-assembly1.cif.gz_A crystal structure of e. coli ybgjk 0.9345 7 321
5dud-assembly2.cif.gz_C crystal structure of e. coli ybgjk 0.9308 7 321
5dud-assembly1.cif.gz_A crystal structure of e. coli ybgjk 0.9225 7 321
5dud-assembly2.cif.gz_C crystal structure of e. coli ybgjk 0.9127 7 321
3mml-assembly2.cif.gz_E allophanate hydrolase complex from mycobacterium smegmatis, msmeg0435-msmeg0436 0.9031 4 304
ID Description Score Start End Superfamily
5dudA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9322 192 320 2.40.100.10
af_Q2FXW9_143_281_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8926 192 323 2.40.100.10
5dudA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8803 192 320 2.40.100.10
af_Q2G094_189_326_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8794 192 324 2.40.100.10
3mmlG02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8646 190 304 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A2J5Q5S0-F1-model_v4 Allophanate hydrolase 0.9932 7 177 GO:0005524
GO:0016787
AF-A0A435UQB7-F1-model_v4 deleted 0.9859 7 159
AF-A0A349FAH0-F1-model_v4 Allophanate hydrolase 0.9752 5 127 GO:0005524
GO:0016787
AF-A0A165RX76-F1-model_v4 Allophanate hydrolase 2 subunit 2 0.9738 38 150 GO:0005524
GO:0016787
AF-A0A3S4KDE1-F1-model_v4 Allophanate hydrolase 2 subunit 2 0.9734 7 173 GO:0005524
GO:0016787

Feature Viewer

pLDDT pTM Quality
90.8 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map