F471015

General Info

Members Datasets Scaffolds Average Seq Length
632 278 624 136

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0725937|Ga0436361_0725937_275_715
Length 146
Sequence MLKSVTNPGQPGPAQTRSRGGLYAVLGSGAILAGALGYVGLVDPHKPDSVFPICPFRLLTGWNCPACGGLRMMHDVLHGDLAAAITDNVFLLVGIPMLAGWVLLRRRSDKSVFPVPMVAIVLVAMLAWTVVRNLPGFPLVPTLLTS

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
6 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
7 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
8 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
192 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
193 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
272 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
273 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
274 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
275 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
276 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
277 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.51
Nodule 0.16
Rhizoplane 11.23
Rhizosphere 64.24
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10036544 3300001991 Bacteria 978
2 JGI24748J21848_1003937 3300002074 Bacteria 1703
3 JGI24744J21845_10021330 3300002077 Bacteria 1275
4 JGI24744J21845_10030637 3300002077 Bacteria 1031
5 JGI24744J21845_10041627 3300002077 Bacteria 858
6 Ga0055540_1002658 3300003792 Bacteria 9241
7 Ga0070676_10017677 3300005328 Bacteria 3946
8 Ga0070683_100023390 3300005329 Bacteria 5527
9 Ga0070690_100045911 3300005330 Bacteria 2776
10 Ga0070670_100238903 3300005331 Bacteria 1582
11 Ga0068869_100015439 3300005334 Bacteria 5124
12 Ga0070666_10019818 3300005335 Bacteria 4345
13 Ga0070680_100188248 3300005336 Bacteria 1739
14 Ga0070682_100002878 3300005337 Bacteria 9543
15 Ga0070682_100057367 3300005337 Bacteria 2453
16 Ga0070682_100299740 3300005337 Bacteria 1179
17 Ga0070682_100377778 3300005337 Bacteria 1065
18 Ga0068868_100644809 3300005338 Bacteria 942
19 Ga0068868_100727875 3300005338 Bacteria 890
20 Ga0070660_100045944 3300005339 Bacteria 3345
21 Ga0070689_100009102 3300005340 Bacteria 7030
22 Ga0070689_101062325 3300005340 Bacteria 722
23 Ga0070689_101161973 3300005340 Bacteria 692
24 Ga0070691_10035105 3300005341 Bacteria 2361
25 Ga0070691_10078999 3300005341 Bacteria 1608
26 Ga0070692_10079083 3300005345 Bacteria 1767
27 Ga0070668_100026476 3300005347 Bacteria 4401
28 Ga0070668_100219214 3300005347 Bacteria 1568
29 Ga0070668_100583970 3300005347 Bacteria 976
30 Ga0070669_100019727 3300005353 Bacteria 4816
31 Ga0070669_100311674 3300005353 Bacteria 1269
32 Ga0070671_100023211 3300005355 Bacteria 5074
33 Ga0070671_100050768 3300005355 Bacteria 3450
34 Ga0070671_100263494 3300005355 Bacteria 1465
35 Ga0070674_100001170 3300005356 Bacteria 13811
36 Ga0070673_101459928 3300005364 Bacteria 644
37 Ga0070688_100005179 3300005365 Bacteria 6844
38 Ga0070688_101014369 3300005365 Bacteria 660
39 Ga0070659_100119164 3300005366 Bacteria 2136
40 Ga0070667_100000082 3300005367 Bacteria 118320
41 Ga0070667_100016095 3300005367 Bacteria 6187
42 Ga0070667_100037621 3300005367 Bacteria 4057
43 Ga0070667_100053854 3300005367 Bacteria 3396
44 Ga0070667_100312880 3300005367 Bacteria 1416
45 Ga0070667_100642711 3300005367 Bacteria 979
46 Ga0070709_10045003 3300005434 Bacteria 2736
47 Ga0070709_11095648 3300005434 Bacteria 637
48 Ga0070714_100038502 3300005435 Bacteria 4019
49 Ga0070714_100354873 3300005435 Bacteria 1378
50 Ga0070714_101931064 3300005435 Bacteria 576
51 Ga0070713_100061125 3300005436 Bacteria 3151
52 Ga0070710_10001153 3300005437 Bacteria 12511
53 Ga0070701_10000735 3300005438 Bacteria 11616
54 Ga0070711_100000535 3300005439 Bacteria 19802
55 Ga0070711_100004184 3300005439 Bacteria 8478
56 Ga0070705_100002582 3300005440 Bacteria 9075
57 Ga0070705_101335052 3300005440 Bacteria 596
58 Ga0070700_100041699 3300005441 Bacteria 2815
59 Ga0070700_100221629 3300005441 Bacteria 1340
60 Ga0070694_100353587 3300005444 Bacteria 1139
61 Ga0070663_100189210 3300005455 Bacteria 1601
62 Ga0070678_100000177 3300005456 Bacteria 27552
63 Ga0070678_100185220 3300005456 Bacteria 1708
64 Ga0070662_100029092 3300005457 Bacteria 3854
65 Ga0068867_100032040 3300005459 Bacteria 3798
66 Ga0068867_100175435 3300005459 Bacteria 1700
67 Ga0070685_10047243 3300005466 Bacteria 2475
68 Ga0070685_10460929 3300005466 Bacteria 892
69 Ga0070685_10483561 3300005466 Bacteria 873
70 Ga0070707_102046579 3300005468 Bacteria 540
71 Ga0068853_100001131 3300005539 Bacteria 18889
72 Ga0068853_100035244 3300005539 Bacteria 4249
73 Ga0068853_100409943 3300005539 Bacteria 1269
74 Ga0070686_100055311 3300005544 Bacteria 2542
75 Ga0070695_100045064 3300005545 Bacteria 2810
76 Ga0070696_100037009 3300005546 Bacteria 3366
77 Ga0070693_100013855 3300005547 Bacteria 4118
78 Ga0070693_100117858 3300005547 Bacteria 1643
79 Ga0070665_100007843 3300005548 Bacteria 10828
80 Ga0070665_100038498 3300005548 Bacteria 4807
81 Ga0070665_100080216 3300005548 Bacteria 3269
82 Ga0070665_100143646 3300005548 Bacteria 2390
83 Ga0070665_100405761 3300005548 Bacteria 1371
84 Ga0070704_100000119 3300005549 Bacteria 28370
85 Ga0068855_100937432 3300005563 Bacteria 913
86 Ga0068854_100006854 3300005578 Bacteria 7263
87 Ga0068854_100164794 3300005578 Bacteria 1720
88 Ga0068856_100224967 3300005614 Bacteria 1892
89 Ga0070702_100001178 3300005615 Bacteria 10537
90 Ga0070702_100027404 3300005615 Bacteria 3074
91 Ga0068852_100220906 3300005616 Bacteria 1802
92 Ga0068852_100534100 3300005616 Bacteria 1171
93 Ga0068859_100001666 3300005617 Bacteria 22618
94 Ga0068859_100006068 3300005617 Bacteria 12266
95 Ga0068859_100251361 3300005617 Bacteria 1858
96 Ga0068859_101065500 3300005617 Bacteria 889
97 Ga0068864_100031008 3300005618 Bacteria 4534
98 Ga0068866_10000444 3300005718 Bacteria 19148
99 Ga0068866_10047926 3300005718 Bacteria 2157
100 Ga0068861_100000376 3300005719 Bacteria 25730
101 Ga0068861_100046423 3300005719 Bacteria 3274
102 Ga0068870_10895313 3300005840 Bacteria 626
103 Ga0068863_100002574 3300005841 Bacteria 17980
104 Ga0068863_100022515 3300005841 Bacteria 6017
105 Ga0068863_100395581 3300005841 Bacteria 1351
106 Ga0068863_100519218 3300005841 Bacteria 1174
107 Ga0068858_100002114 3300005842 Bacteria 20165
108 Ga0068858_100069089 3300005842 Bacteria 3275
109 Ga0068858_100181605 3300005842 Bacteria 1987
110 Ga0068858_100463970 3300005842 Bacteria 1221
111 Ga0068858_100724665 3300005842 Bacteria 968
112 Ga0068860_100000112 3300005843 Bacteria 130953
113 Ga0068860_100090945 3300005843 Bacteria 2907
114 Ga0068860_100156905 3300005843 Bacteria 2193
115 Ga0068860_100507426 3300005843 Bacteria 1205
116 Ga0068860_100961464 3300005843 Bacteria 871
117 Ga0068862_100000012 3300005844 Bacteria 267598
118 Ga0068862_100002023 3300005844 Bacteria 18382
119 Ga0068862_100122507 3300005844 Bacteria 2293
120 Ga0081455_10025499 3300005937 Bacteria 5455
121 Ga0075365_10010294 3300006038 Bacteria 5433
122 Ga0075365_10059442 3300006038 Bacteria 2548
123 Ga0075365_10095656 3300006038 Bacteria 2029
124 Ga0075365_10156398 3300006038 Bacteria 1587
125 Ga0075365_10381819 3300006038 Unclassified 994
126 Ga0075368_10031330 3300006042 Bacteria 2062
127 Ga0075368_10053295 3300006042 Bacteria 1610
128 Ga0075363_100001376 3300006048 Bacteria 9163
129 Ga0075363_100001686 3300006048 Bacteria 8565
130 Ga0075363_100002305 3300006048 Bacteria 7751
131 Ga0075363_100002542 3300006048 Bacteria 7485
132 Ga0075363_100008389 3300006048 Bacteria 4808
133 Ga0075363_100079682 3300006048 Bacteria 1790
134 Ga0075363_100102422 3300006048 Bacteria 1585
135 Ga0075363_100140070 3300006048 Bacteria 1361
136 Ga0075363_100193275 3300006048 Bacteria 1161
137 Ga0075363_100310871 3300006048 Bacteria 916
138 Ga0075363_100591780 3300006048 Bacteria 664
139 Ga0075364_10000434 3300006051 Bacteria 20896
140 Ga0075364_10001802 3300006051 Bacteria 11873
141 Ga0075364_10016359 3300006051 Bacteria 4613
142 Ga0075364_10023409 3300006051 Bacteria 3911
143 Ga0075364_10087497 3300006051 Bacteria 2065
144 Ga0075364_10109360 3300006051 Bacteria 1844
145 Ga0075364_10225829 3300006051 Bacteria 1271
146 Ga0075364_10282058 3300006051 Bacteria 1130
147 Ga0075364_10283946 3300006051 Bacteria 1126
148 Ga0075364_10579075 3300006051 Bacteria 767
149 Ga0075364_10699882 3300006051 Bacteria 691
150 Ga0070715_10065762 3300006163 Bacteria 1606
151 Ga0070716_100036194 3300006173 Bacteria 2720
152 Ga0070716_100747633 3300006173 Bacteria 752
153 Ga0070712_100038911 3300006175 Bacteria 3252
154 Ga0075362_10042227 3300006177 Bacteria 2015
155 Ga0075362_10049590 3300006177 Bacteria 1876
156 Ga0075362_10294316 3300006177 Bacteria 805
157 Ga0075367_10011117 3300006178 Bacteria 4749
158 Ga0075367_10235722 3300006178 Bacteria 1146
159 Ga0075369_10010255 3300006186 Bacteria 3662
160 Ga0075369_10013542 3300006186 Bacteria 3240
161 Ga0075369_10034054 3300006186 Bacteria 2161
162 Ga0075369_10039146 3300006186 Bacteria 2024
163 Ga0075369_10044170 3300006186 Bacteria 1914
164 Ga0075369_10064000 3300006186 Bacteria 1610
165 Ga0075369_10110135 3300006186 Bacteria 1241
166 Ga0075369_10121030 3300006186 Bacteria 1185
167 Ga0075369_10151565 3300006186 Bacteria 1060
168 Ga0075369_10256252 3300006186 Bacteria 813
169 Ga0097621_100175955 3300006237 Bacteria 1847
170 Ga0075370_10010001 3300006353 Bacteria 4945
171 Ga0075370_10051805 3300006353 Bacteria 2328
172 Ga0075370_10085914 3300006353 Bacteria 1812
173 Ga0075370_10102210 3300006353 Bacteria 1660
174 Ga0075370_10103110 3300006353 Bacteria 1653
175 Ga0075370_10170538 3300006353 Bacteria 1279
176 Ga0075370_10322845 3300006353 Bacteria 920
177 Ga0068871_100084010 3300006358 Bacteria 2641
178 Ga0075430_100044118 3300006846 Bacteria 3771
179 Ga0075431_100176613 3300006847 Bacteria 2193
180 Ga0068865_100037446 3300006881 Bacteria 3275
181 Ga0068865_100292840 3300006881 Bacteria 1300
182 Ga0097620_100001666 3300006931 Bacteria 22618
183 Ga0097620_100006068 3300006931 Bacteria 12266
184 Ga0097620_100251363 3300006931 Bacteria 1858
185 Ga0097620_101065448 3300006931 Bacteria 889
186 Ga0105250_10024168 3300009092 Bacteria 2449
187 Ga0105250_10323811 3300009092 Bacteria 670
188 Ga0105250_10425052 3300009092 Bacteria 593
189 Ga0111539_10842449 3300009094 Bacteria 1067
190 Ga0105245_10043452 3300009098 Bacteria 4009
191 Ga0105245_10194852 3300009098 Bacteria 1943
192 Ga0105245_12402307 3300009098 Bacteria 581
193 Ga0105247_10000007 3300009101 Bacteria 409490
194 Ga0105247_10021829 3300009101 Bacteria 3852
195 Ga0105247_10103058 3300009101 Bacteria 1827
196 Ga0105247_10281432 3300009101 Bacteria 1147
197 Ga0105247_11677088 3300009101 Bacteria 525
198 Ga0105243_10008964 3300009148 Bacteria 7646
199 Ga0105243_10029103 3300009148 Bacteria 4246
200 Ga0105241_10034596 3300009174 Bacteria 3797
201 Ga0105242_10159734 3300009176 Bacteria 1972
202 Ga0105242_10208466 3300009176 Bacteria 1740
203 Ga0105242_10994874 3300009176 Bacteria 846
204 Ga0105248_10000254 3300009177 Bacteria 62178
205 Ga0105248_10003491 3300009177 Bacteria 17445
206 Ga0105248_10038234 3300009177 Bacteria 5371
207 Ga0105237_10073891 3300009545 Bacteria 3401
208 Ga0105238_10035956 3300009551 Bacteria 5035
209 Ga0105238_10135303 3300009551 Bacteria 2442
210 Ga0105238_10822911 3300009551 Bacteria 945
211 Ga0105249_10000001 3300009553 Bacteria 504948
212 Ga0105249_10034230 3300009553 Bacteria 4602
213 Ga0105249_10042640 3300009553 Bacteria 4128
214 Ga0105249_11833387 3300009553 Bacteria 679
215 Ga0105239_10019098 3300010375 Bacteria 7575
216 Ga0105239_10073461 3300010375 Bacteria 3760
217 Ga0105239_10544218 3300010375 Bacteria 1322
218 Ga0105239_10931016 3300010375 Bacteria 998
219 Ga0105239_11117882 3300010375 Bacteria 907
220 Ga0105239_11768733 3300010375 Bacteria 716
221 Ga0105246_10124295 3300011119 Bacteria 1917
222 Ga0157369_10728818 3300013105 Bacteria 1020
223 Ga0157374_10134730 3300013296 Bacteria 2393
224 Ga0157378_10415478 3300013297 Bacteria 1329
225 Ga0157378_12228993 3300013297 Bacteria 599
226 Ga0163162_10012920 3300013306 Bacteria 8153
227 Ga0163162_10148259 3300013306 Bacteria 2463
228 Ga0163162_12905472 3300013306 Bacteria 551
229 Ga0157372_10042177 3300013307 Bacteria 5046
230 Ga0157372_10380110 3300013307 Bacteria 1646
231 Ga0157375_10007645 3300013308 Bacteria 9457
232 Ga0157375_10333373 3300013308 Bacteria 1682
233 Ga0163163_10153988 3300014325 Bacteria 2342
234 Ga0163163_10239277 3300014325 Bacteria 1865
235 Ga0163163_10302466 3300014325 Bacteria 1652
236 Ga0163163_11025258 3300014325 Bacteria 888
237 Ga0157380_10010834 3300014326 Bacteria 6572
238 Ga0157377_10047069 3300014745 Bacteria 2414
239 Ga0157377_10181202 3300014745 Bacteria 1325
240 Ga0157377_10509029 3300014745 Bacteria 843
241 Ga0157379_10021686 3300014968 Bacteria 5688
242 Ga0157379_10122969 3300014968 Bacteria 2335
243 Ga0157379_10248487 3300014968 Bacteria 1614
244 Ga0157379_10760593 3300014968 Bacteria 912
245 Ga0157376_10781054 3300014969 Bacteria 966
246 Ga0163161_10007677 3300017792 Bacteria 7461
247 Ga0163161_10648802 3300017792 Bacteria 874
248 Ga0213874_10195733 3300021377 Bacteria 725
249 Ga0209673_1034296 3300025273 Bacteria 1535
250 Ga0209051_1000651 3300025303 Bacteria 39360
251 Ga0209051_1010498 3300025303 Bacteria 4667
252 Ga0209051_1018311 3300025303 Bacteria 3102
253 Ga0207696_1103192 3300025711 Bacteria 776
254 Ga0207653_10067132 3300025885 Bacteria 1220
255 Ga0207692_10026407 3300025898 Bacteria 2724
256 Ga0207692_10042664 3300025898 Bacteria 2253
257 Ga0207642_10000881 3300025899 Bacteria 9381
258 Ga0207642_10254191 3300025899 Bacteria 999
259 Ga0207710_10000013 3300025900 Bacteria 409402
260 Ga0207710_10010865 3300025900 Bacteria 3834
261 Ga0207688_10005413 3300025901 Bacteria 6938
262 Ga0207688_10025622 3300025901 Bacteria 3240
263 Ga0207680_10040830 3300025903 Bacteria 2703
264 Ga0207647_10181400 3300025904 Bacteria 1222
265 Ga0207685_10034598 3300025905 Bacteria 1837
266 Ga0207699_10045300 3300025906 Bacteria 2567
267 Ga0207699_10816143 3300025906 Bacteria 686
268 Ga0207645_10042723 3300025907 Bacteria 2900
269 Ga0207645_10063686 3300025907 Bacteria 2356
270 Ga0207643_10548202 3300025908 Bacteria 742
271 Ga0207654_10034208 3300025911 Bacteria 2822
272 Ga0207671_10191593 3300025914 Bacteria 1595
273 Ga0207671_10229225 3300025914 Bacteria 1457
274 Ga0207671_10245568 3300025914 Bacteria 1407
275 Ga0207693_10000746 3300025915 Bacteria 29275
276 Ga0207663_10191631 3300025916 Bacteria 1468
277 Ga0207660_10167389 3300025917 Bacteria 1700
278 Ga0207660_11074967 3300025917 Bacteria 656
279 Ga0207662_10385831 3300025918 Bacteria 947
280 Ga0207657_10063809 3300025919 Bacteria 3147
281 Ga0207681_10031476 3300025923 Bacteria 3465
282 Ga0207694_10128205 3300025924 Bacteria 2032
283 Ga0207694_10184679 3300025924 Bacteria 1692
284 Ga0207650_10144819 3300025925 Bacteria 1870
285 Ga0207687_10073519 3300025927 Bacteria 2448
286 Ga0207687_10265683 3300025927 Bacteria 1370
287 Ga0207700_10026041 3300025928 Bacteria 4073
288 Ga0207664_10110444 3300025929 Bacteria 2286
289 Ga0207664_10417732 3300025929 Bacteria 1194
290 Ga0207644_10073990 3300025931 Bacteria 2499
291 Ga0207644_10214567 3300025931 Bacteria 1523
292 Ga0207690_10076231 3300025932 Bacteria 2328
293 Ga0207690_10330345 3300025932 Bacteria 1201
294 Ga0207690_10408393 3300025932 Bacteria 1084
295 Ga0207706_10018419 3300025933 Bacteria 6283
296 Ga0207706_10051956 3300025933 Bacteria 3619
297 Ga0207686_10007038 3300025934 Bacteria 6052
298 Ga0207686_11342856 3300025934 Bacteria 588
299 Ga0207709_10029376 3300025935 Bacteria 3188
300 Ga0207709_10111798 3300025935 Bacteria 1828
301 Ga0207709_10396937 3300025935 Bacteria 1053
302 Ga0207670_10067158 3300025936 Bacteria 2466
303 Ga0207670_10171906 3300025936 Bacteria 1625
304 Ga0207669_10020507 3300025937 Bacteria 3468
305 Ga0207704_10034460 3300025938 Bacteria 2889
306 Ga0207704_10831165 3300025938 Bacteria 773
307 Ga0207704_11745022 3300025938 Bacteria 535
308 Ga0207665_10040303 3300025939 Bacteria 3116
309 Ga0207665_10078915 3300025939 Bacteria 2262
310 Ga0207665_10085618 3300025939 Bacteria 2176
311 Ga0207665_10277587 3300025939 Bacteria 1246
312 Ga0207711_10000509 3300025941 Bacteria 40017
313 Ga0207711_10008953 3300025941 Bacteria 8368
314 Ga0207711_10095006 3300025941 Bacteria 2628
315 Ga0207711_10298134 3300025941 Bacteria 1486
316 Ga0207711_10686341 3300025941 Bacteria 955
317 Ga0207689_10004958 3300025942 Bacteria 11987
318 Ga0207689_10059866 3300025942 Bacteria 3132
319 Ga0207667_10124004 3300025949 Bacteria 2661
320 Ga0207651_10259155 3300025960 Bacteria 1427
321 Ga0207651_11002260 3300025960 Bacteria 746
322 Ga0207712_10000006 3300025961 Bacteria 573204
323 Ga0207712_10008748 3300025961 Bacteria 6403
324 Ga0207712_10072067 3300025961 Bacteria 2487
325 Ga0207712_11823940 3300025961 Bacteria 545
326 Ga0207668_10049542 3300025972 Bacteria 2888
327 Ga0207668_10579418 3300025972 Bacteria 975
328 Ga0207640_10019158 3300025981 Bacteria 4038
329 Ga0207640_10077814 3300025981 Bacteria 2256
330 Ga0207640_11007170 3300025981 Bacteria 733
331 Ga0207658_10002065 3300025986 Bacteria 14940
332 Ga0207658_10013299 3300025986 Bacteria 5620
333 Ga0207658_10070685 3300025986 Bacteria 2641
334 Ga0207658_10328681 3300025986 Bacteria 1325
335 Ga0207658_10591930 3300025986 Bacteria 996
336 Ga0207658_11245944 3300025986 Bacteria 680
337 Ga0207677_10015614 3300026023 Bacteria 4473
338 Ga0207677_10243832 3300026023 Bacteria 1455
339 Ga0207703_10021586 3300026035 Bacteria 5042
340 Ga0207703_10374199 3300026035 Bacteria 1316
341 Ga0207703_10701898 3300026035 Bacteria 962
342 Ga0207639_10038393 3300026041 Bacteria 3561
343 Ga0207639_10257982 3300026041 Bacteria 1523
344 Ga0207678_10029270 3300026067 Bacteria 4806
345 Ga0207678_10154356 3300026067 Bacteria 1960
346 Ga0207708_10001994 3300026075 Bacteria 15032
347 Ga0207708_10758350 3300026075 Bacteria 833
348 Ga0207702_10074460 3300026078 Bacteria 2931
349 Ga0207641_10004004 3300026088 Bacteria 12856
350 Ga0207641_10037431 3300026088 Bacteria 4051
351 Ga0207641_10463555 3300026088 Bacteria 1226
352 Ga0207648_10011895 3300026089 Bacteria 8177
353 Ga0207648_10021131 3300026089 Bacteria 5852
354 Ga0207676_10116539 3300026095 Bacteria 2245
355 Ga0207676_10845120 3300026095 Bacteria 895
356 Ga0207675_100001770 3300026118 Bacteria 21580
357 Ga0207675_100041913 3300026118 Bacteria 4275
358 Ga0207675_100258324 3300026118 Bacteria 1687
359 Ga0207675_102678002 3300026118 Bacteria 507
360 Ga0207683_10002908 3300026121 Bacteria 14937
361 Ga0207683_10106623 3300026121 Bacteria 2506
362 Ga0207683_10357441 3300026121 Bacteria 1341
363 Ga0207683_10863957 3300026121 Bacteria 840
364 Ga0207698_10109116 3300026142 Bacteria 2315
365 Ga0207698_10558504 3300026142 Bacteria 1123
366 Ga0209813_10018004 3300027866 Bacteria 1946
367 Ga0268266_10010980 3300028379 Bacteria 7881
368 Ga0268266_10155421 3300028379 Bacteria 2065
369 Ga0268266_10264426 3300028379 Bacteria 1595
370 Ga0268266_10344449 3300028379 Bacteria 1399
371 Ga0268265_10000016 3300028380 Bacteria 299380
372 Ga0268265_10082712 3300028380 Bacteria 2539
373 Ga0268265_10460025 3300028380 Bacteria 1190
374 Ga0268265_10722498 3300028380 Bacteria 964
375 Ga0268264_10000026 3300028381 Bacteria 459088
376 Ga0268264_10371394 3300028381 Bacteria 1367
377 Ga0268264_10505179 3300028381 Bacteria 1180
378 Ga0268264_10857548 3300028381 Bacteria 910
379 Ga0307515_10681016 3300028794 Bacteria 643
380 Ga0265327_10002543 3300031251 Bacteria 18976
381 Ga0316578_10409623 3300031728 Bacteria 803
382 Ga0307410_10638313 3300031852 Bacteria 892
383 Ga0307409_100179019 3300031995 Bacteria 1875
384 Ga0307409_100471635 3300031995 Bacteria 1216
385 Ga0373959_0136328 3300034820 Bacteria 611
386 Ga0373938_0028384 3300034957 Bacteria 1183
387 Ga0373928_0006583 3300035084 Bacteria 2234
388 Ga0373932_0017431 3300035112 Bacteria 1844
389 Ga0373960_0171028 3300035121 Bacteria 753
390 Ga0373942_0045314 3300035207 Bacteria 1215
391 Ga0373931_0226183 3300035691 Bacteria 1128
392 Ga0373931_0263502 3300035691 Bacteria 1052
393 Ga0316584_0029843 3300036712 Bacteria 4026
394 Ga0436361_0537380 3300039447 Bacteria 613
395 Ga0436361_0725937 3300039447 Bacteria 2528
396 Ga0436363_0288378 3300039450 Bacteria 4593
397 Ga0439466_0001828 3300041411 Bacteria 8339
398 Ga0439466_0030525 3300041411 Bacteria 1848
399 Ga0439465_0002757 3300041413 Bacteria 5748
400 Ga0439465_0010441 3300041413 Bacteria 2917
401 Ga0439465_0014092 3300041413 Bacteria 2490
402 Ga0451833_0022299 3300041491 Bacteria 1139
403 Ga0451837_1721570 3300041494 Unclassified 629
404 Ga0451843_1311791 3300041509 Unclassified 655
405 Ga0451853_1912762 3300041512 Bacteria 853
406 Ga0439431_0009921 3300041997 Bacteria 2156
407 Ga0439431_0164964 3300041997 Bacteria 634
408 Ga0439448_0018072 3300042005 Bacteria 2157
409 Ga0439435_0026295 3300042436 Bacteria 1548
410 Ga0439459_0079761 3300042438 Bacteria 771
411 Ga0466969_0152580 3300044656 Bacteria 1064
412 Ga0466972_0002940 3300044658 Bacteria 8447
413 Ga0466972_0016906 3300044658 Bacteria 3649
414 Ga0466965_0060425 3300044683 Bacteria 1893
415 Ga0466965_0164547 3300044683 Bacteria 1164
416 Ga0466966_0004859 3300044684 Bacteria 8841
417 Ga0466966_0066263 3300044684 Bacteria 2270
418 Ga0466966_0306529 3300044684 Bacteria 954
419 Ga0466961_0056165 3300044693 Bacteria 2508
420 Ga0466961_0498593 3300044693 Bacteria 735
421 Ga0466963_0109197 3300044694 Bacteria 1898
422 Ga0466964_0030248 3300044706 Bacteria 2142
423 Ga0466971_0116842 3300044719 Bacteria 1233
424 Ga0466968_0008280 3300044735 Bacteria 3978
425 Ga0466968_0019038 3300044735 Bacteria 2759
426 Ga0466968_0042721 3300044735 Bacteria 1917
427 Ga0466970_0056564 3300044765 Bacteria 2096
428 Ga0466970_0126002 3300044765 Bacteria 1404
429 Ga0466957_0649687 3300044842 Bacteria 741
430 Ga0466960_0007027 3300044901 Bacteria 4548
431 Ga0466959_0000940 3300045049 Bacteria 17285
432 Ga0466959_0020237 3300045049 Bacteria 4900
433 Ga0466959_0020683 3300045049 Bacteria 4849
434 Ga0466958_0032709 3300045836 Bacteria 3095
435 Ga0466958_0299705 3300045836 Bacteria 1032
436 Ga0466958_0341356 3300045836 Bacteria 964
437 Ga0466967_0589678 3300045976 Bacteria 1096
438 Ga0466967_1276828 3300045976 Bacteria 731
439 Ga0495671_0228472 3300046692 Bacteria 900
440 Ga0495649_0141710 3300046694 Bacteria 1265
441 Ga0495649_0262655 3300046694 Bacteria 885
442 Ga0495672_0126560 3300047320 Bacteria 1350
443 Ga0496100_0000060 3300048903 Bacteria 64789
444 Ga0496100_0000571 3300048903 Bacteria 17512
445 Ga0496100_0180262 3300048903 Bacteria 1527
446 Ga0496100_0375169 3300048903 Bacteria 1079
447 Ga0496100_0415720 3300048903 Bacteria 1026
448 Ga0496100_0487407 3300048903 Bacteria 949
449 Ga0496101_0000116 3300048904 Bacteria 78303
450 Ga0496101_0001602 3300048904 Bacteria 13609
451 Ga0496101_0006869 3300048904 Bacteria 7346
452 Ga0496101_0007271 3300048904 Bacteria 7166
453 Ga0496101_0016534 3300048904 Bacteria 4988
454 Ga0496101_0595109 3300048904 Bacteria 874
455 Ga0496102_0000124 3300048905 Bacteria 110030
456 Ga0496102_0001287 3300048905 Bacteria 22607
457 Ga0496102_0005428 3300048905 Bacteria 10815
458 Ga0496102_0030766 3300048905 Bacteria 4807
459 Ga0496102_0161230 3300048905 Bacteria 2110
460 Ga0496102_0531954 3300048905 Bacteria 1098
461 Ga0496102_0608715 3300048905 Bacteria 1015
462 Ga0496103_0000560 3300048906 Bacteria 29543
463 Ga0496103_0000933 3300048906 Bacteria 20968
464 Ga0496103_0015930 3300048906 Bacteria 4483
465 Ga0496103_0058889 3300048906 Bacteria 2386
466 Ga0496103_0090427 3300048906 Bacteria 1931
467 Ga0496104_0003506 3300048907 Bacteria 13533
468 Ga0496104_0017003 3300048907 Bacteria 6617
469 Ga0496104_0305995 3300048907 Bacteria 1502
470 Ga0496104_0978292 3300048907 Bacteria 750
471 Ga0496105_0001389 3300048908 Bacteria 16994
472 Ga0496105_0021354 3300048908 Bacteria 5239
473 Ga0496105_0553615 3300048908 Bacteria 897
474 Ga0496106_0001551 3300048909 Bacteria 17316
475 Ga0496106_0002145 3300048909 Bacteria 14735
476 Ga0496106_0003263 3300048909 Bacteria 12136
477 Ga0496106_0088938 3300048909 Bacteria 2381
478 Ga0496107_0000786 3300048910 Bacteria 18338
479 Ga0496107_0001093 3300048910 Bacteria 16305
480 Ga0496107_0004417 3300048910 Bacteria 9529
481 Ga0496107_0043951 3300048910 Bacteria 3211
482 Ga0496108_0004480 3300048911 Bacteria 11244
483 Ga0496108_0013527 3300048911 Bacteria 6660
484 Ga0496108_0017130 3300048911 Bacteria 5926
485 Ga0496108_0099551 3300048911 Bacteria 2478
486 Ga0496109_0000829 3300048912 Bacteria 25810
487 Ga0496109_0004667 3300048912 Bacteria 11441
488 Ga0496109_0031496 3300048912 Bacteria 4759
489 Ga0496109_0074525 3300048912 Bacteria 3120
490 Ga0496110_0004498 3300048913 Bacteria 10813
491 Ga0496110_0144881 3300048913 Bacteria 2148
492 Ga0496110_0343709 3300048913 Bacteria 1359
493 Ga0496110_0543013 3300048913 Bacteria 1057
494 Ga0496111_0040180 3300048914 Bacteria 3355
495 Ga0496111_0124417 3300048914 Bacteria 1906
496 Ga0496111_0149141 3300048914 Bacteria 1734
497 Ga0496112_0058213 3300048915 Bacteria 3805
498 Ga0496112_0109402 3300048915 Bacteria 2734
499 Ga0496112_0214787 3300048915 Bacteria 1880
500 Ga0496112_0494962 3300048915 Bacteria 1158
501 Ga0496113_0039095 3300048916 Bacteria 3491
502 Ga0496113_0086424 3300048916 Bacteria 2410
503 Ga0496114_0000215 3300048917 Bacteria 42076
504 Ga0496114_0032696 3300048917 Bacteria 4283
505 Ga0496114_0232163 3300048917 Bacteria 1621
506 Ga0496114_0777527 3300048917 Bacteria 836
507 Ga0496115_0003338 3300048918 Bacteria 11517
508 Ga0496115_0109970 3300048918 Bacteria 2264
509 Ga0496115_0151166 3300048918 Bacteria 1917
510 Ga0496115_0206079 3300048918 Bacteria 1624
511 Ga0496115_0223766 3300048918 Bacteria 1553
512 Ga0496115_0299729 3300048918 Bacteria 1317
513 Ga0496115_0463112 3300048918 Bacteria 1023
514 Ga0496116_0005941 3300048919 Bacteria 11191
515 Ga0496116_0011701 3300048919 Bacteria 7230
516 Ga0496117_0000496 3300048920 Bacteria 64935
517 Ga0496117_0011200 3300048920 Bacteria 8052
518 Ga0496118_0001104 3300048921 Bacteria 41942
519 Ga0496118_0001433 3300048921 Bacteria 35920
520 Ga0496118_0007845 3300048921 Bacteria 11191
521 Ga0496119_0001302 3300048922 Bacteria 30815
522 Ga0496119_0006797 3300048922 Bacteria 10487
523 Ga0496119_0215636 3300048922 Bacteria 985
524 Ga0496120_0057110 3300048923 Bacteria 2199
525 Ga0496121_0000016 3300048924 Bacteria 562911
526 Ga0496121_0009565 3300048924 Bacteria 11105
527 Ga0496122_0000250 3300048925 Bacteria 121043
528 Ga0496123_0005844 3300048926 Bacteria 12194
529 Ga0496124_0000015 3300048927 Bacteria 460700
530 Ga0496124_0037931 3300048927 Bacteria 4186
531 Ga0496125_0000021 3300048928 Bacteria 460688
532 Ga0496125_0016481 3300048928 Bacteria 7093
533 Ga0496126_0000015 3300048929 Bacteria 663212
534 Ga0496126_0003135 3300048929 Bacteria 21318
535 Ga0496126_0015698 3300048929 Bacteria 7610
536 Ga0496126_0481133 3300048929 Bacteria 995
537 Ga0501032_0027257 3300049569 Bacteria 3927
538 Ga0501033_0065222 3300049570 Bacteria 2679
539 Ga0501034_0006605 3300049571 Bacteria 12445
540 Ga0501034_0063349 3300049571 Bacteria 3711
541 Ga0501036_0012162 3300049572 Bacteria 7130
542 Ga0501037_0000060 3300049573 Bacteria 100831
543 Ga0501038_0005039 3300049574 Bacteria 12272
544 Ga0501039_0001404 3300049575 Bacteria 17705
545 Ga0501041_0490743 3300049577 Bacteria 781
546 Ga0501043_0001080 3300049579 Bacteria 23972
547 Ga0501043_0469908 3300049579 Bacteria 943
548 Ga0501047_0007251 3300049581 Bacteria 10423
549 Ga0501047_0697261 3300049581 Bacteria 833
550 Ga0501070_0006373 3300049586 Bacteria 10043
551 Ga0501070_0026217 3300049586 Bacteria 4893
552 Ga0501070_1150733 3300049586 Bacteria 597
553 Ga0501073_0010396 3300049589 Bacteria 6828
554 Ga0501073_0337035 3300049589 Bacteria 1041
555 Ga0501080_0041878 3300049742 Bacteria 4266
556 Ga0501035_0000279 3300049822 Bacteria 60584
557 Ga0501044_0000637 3300049823 Bacteria 42365
558 Ga0501044_0011489 3300049823 Bacteria 9593
559 Ga0501045_1050961 3300049824 Bacteria 596
560 nmdc:mga03683_166942_c1 3300050489 Bacteria 999
561 nmdc:mga03683_189315_c1 3300050489 Bacteria 941
562 nmdc:mga03683_2488_c1 3300050489 Bacteria 5731
563 nmdc:mga03n38_114596_c1 3300050490 Bacteria 1317
564 nmdc:mga03n38_123452_c1 3300050490 Bacteria 1275
565 nmdc:mga03n38_124761_c1 3300050490 Bacteria 1269
566 nmdc:mga03n38_168891_c1 3300050490 Bacteria 1113
567 nmdc:mga03n38_189775_c1 3300050490 Bacteria 1058
568 nmdc:mga03n38_201575_c1 3300050490 Bacteria 1030
569 nmdc:mga03n38_2084_c1 3300050490 Bacteria 6055
570 nmdc:mga03n38_4052_c1 3300050490 Bacteria 4798
571 nmdc:mga03n38_42961_c1 3300050490 Bacteria 1979
572 nmdc:mga03n38_474914_c1 3300050490 Bacteria 698
573 nmdc:mga03n38_6112_c1 3300050490 Bacteria 4159
574 nmdc:mga03n38_75159_c1 3300050490 Bacteria 1573
575 nmdc:mga00v17_1056_c1 3300050491 Bacteria 14539
576 nmdc:mga00v17_106638_c1 3300050491 Bacteria 1774
577 nmdc:mga00v17_190834_c1 3300050491 Bacteria 1323
578 nmdc:mga00v17_280895_c1 3300050491 Bacteria 1081
579 nmdc:mga00v17_29024_c1 3300050491 Bacteria 2791
580 nmdc:mga00v17_396347_c1 3300050491 Bacteria 897
581 nmdc:mga00v17_39671_c1 3300050491 Bacteria 2821
582 nmdc:mga00v17_439025_c1 3300050491 Bacteria 848
583 nmdc:mga00v17_480977_c1 3300050491 Bacteria 805
584 nmdc:mga00v17_85065_c1 3300050491 Bacteria 1980
585 nmdc:mga00v17_993720_c1 3300050491 Bacteria 528
586 nmdc:mga0yw44_10124_c1 3300050492 Bacteria 4803
587 nmdc:mga0yw44_128413_c1 3300050492 Bacteria 1639
588 nmdc:mga0yw44_133451_c1 3300050492 Bacteria 1609
589 nmdc:mga0yw44_13918_c1 3300050492 Bacteria 4253
590 nmdc:mga0yw44_50003_c1 3300050492 Bacteria 2526
591 nmdc:mga06z11_163622_c1 3300050494 Bacteria 1273
592 nmdc:mga06z11_407730_c1 3300050494 Bacteria 818
593 nmdc:mga06z11_6710_c1 3300050494 Bacteria 4704
594 nmdc:mga04h51_30979_c1 3300050495 Bacteria 1687
595 nmdc:mga04h51_40503_c1 3300050495 Bacteria 1518
596 nmdc:mga04h51_72657_c1 3300050495 Bacteria 1204
597 nmdc:mga07m45_194127_c1 3300050496 Bacteria 1181
598 nmdc:mga07m45_248297_c1 3300050496 Bacteria 1035
599 nmdc:mga07m45_37451_c1 3300050496 Bacteria 2705
600 nmdc:mga07m45_53527_c1 3300050496 Bacteria 2280
601 nmdc:mga07m45_7712_c1 3300050496 Bacteria 5509
602 nmdc:mga07m45_900392_c1 3300050496 Bacteria 506
603 nmdc:mga07m45_9478_c1 3300050496 Bacteria 5053
604 nmdc:mga09592_1147841_c1 3300050508 Bacteria 644
605 nmdc:mga0qj67_121054_c1 3300050509 Bacteria 2117
606 nmdc:mga06r32_870120_c1 3300050510 Bacteria 859
607 nmdc:mga0sz30_123349_c1 3300050516 Bacteria 1139
608 nmdc:mga0sz30_144543_c1 3300050516 Bacteria 1051
609 nmdc:mga0sz30_1492_c1 3300050516 Bacteria 8339
610 nmdc:mga0sz30_15817_c1 3300050516 Bacteria 2986
611 nmdc:mga0sz30_17537_c2 3300050516 Bacteria 2274
612 nmdc:mga0sz30_215034_c1 3300050516 Bacteria 854
613 nmdc:mga0sz30_300435_c1 3300050516 Bacteria 716
614 nmdc:mga0sz30_525675_c1 3300050516 Bacteria 533
615 nmdc:mga0sz30_59470_c1 3300050516 Bacteria 1631
616 nmdc:mga0sz30_92366_c1 3300050516 Bacteria 1317
617 Ga0500610_0046885 3300053079 Bacteria 2245
618 Ga0500635_0015897 3300053080 Bacteria 2229
619 Ga0495655_0038555 3300053083 Bacteria 1206
620 Ga0500646_0014290 3300053090 Bacteria 2060
621 Ga0500556_0048606 3300053104 Bacteria 1526
622 Ga0500652_058831 3300053131 Bacteria 1579
623 Ga0500564_201201 3300053138 Bacteria 818
624 Ga0466962_0055922 3300061719 Bacteria 1885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042005 Ga0439448_0018072 Ga0439448_0018072_1604_2002 111
2 3300049579 Ga0501043_0469908 Ga0501043_0469908_573_920 115
3 3300006048 Ga0075363_100102422 Ga0075363_1001024223 118
4 3300006051 Ga0075364_10225829 Ga0075364_102258291 118
5 3300006186 Ga0075369_10151565 Ga0075369_101515652 118
6 3300048903 Ga0496100_0487407 Ga0496100_0487407_101_508 119
7 3300048918 Ga0496115_0463112 Ga0496115_0463112_324_731 119
8 3300048929 Ga0496126_0015698 Ga0496126_0015698_1541_1948 119
9 3300050490 nmdc:mga03n38_124761_c1 nmdc:mga03n38_124761_c1_154_561 119
10 3300050491 nmdc:mga00v17_29024_c1 nmdc:mga00v17_29024_c1_1634_2041 119
11 3300050494 nmdc:mga06z11_407730_c1 nmdc:mga06z11_407730_c1_339_746 119
12 3300050516 nmdc:mga0sz30_123349_c1 nmdc:mga0sz30_123349_c1_608_1015 119
13 3300050516 nmdc:mga0sz30_300435_c1 nmdc:mga0sz30_300435_c1_107_514 119
14 3300005367 Ga0070667_100016095 Ga0070667_1000160952 120
15 3300006186 Ga0075369_10110135 Ga0075369_101101352 121
16 3300045976 Ga0466967_1276828 Ga0466967_1276828_44_409 121
17 3300048921 Ga0496118_0001433 Ga0496118_0001433_9242_9670 121
18 3300050516 nmdc:mga0sz30_144543_c1 nmdc:mga0sz30_144543_c1_593_1000 121
19 3300041413 Ga0439465_0010441 Ga0439465_0010441_1908_2318 122
20 3300041997 Ga0439431_0009921 Ga0439431_0009921_175_585 122
21 3300042436 Ga0439435_0026295 Ga0439435_0026295_34_444 122
22 iso_pu_bacteria 2738541264 2738665069 123
23 iso_pu_bacteria 2738541356 2739144203 123
24 3300010375 Ga0105239_10073461 Ga0105239_100734612 126
25 3300010375 Ga0105239_11768733 Ga0105239_117687331 126
26 3300021377 Ga0213874_10195733 Ga0213874_101957331 126
27 3300025914 Ga0207671_10229225 Ga0207671_102292252 126
28 3300025986 Ga0207658_10002065 Ga0207658_100020657 126
29 3300039450 Ga0436363_0288378 Ga0436363_0288378_2358_2774 126
30 3300045836 Ga0466958_0299705 Ga0466958_0299705_59_466 126
31 3300048903 Ga0496100_0000060 Ga0496100_0000060_43427_43825 126
32 3300048904 Ga0496101_0000116 Ga0496101_0000116_42327_42725 126
33 3300048905 Ga0496102_0001287 Ga0496102_0001287_3476_3874 126
34 3300048906 Ga0496103_0000933 Ga0496103_0000933_10811_11209 126
35 3300048908 Ga0496105_0553615 Ga0496105_0553615_223_621 126
36 3300048909 Ga0496106_0002145 Ga0496106_0002145_9918_10316 126
37 3300048910 Ga0496107_0001093 Ga0496107_0001093_6210_6608 126
38 3300048911 Ga0496108_0013527 Ga0496108_0013527_3063_3461 126
39 3300048912 Ga0496109_0000829 Ga0496109_0000829_25007_25405 126
40 3300048913 Ga0496110_0004498 Ga0496110_0004498_657_1055 126
41 3300048914 Ga0496111_0040180 Ga0496111_0040180_2439_2837 126
42 3300048917 Ga0496114_0032696 Ga0496114_0032696_2421_2819 126
43 3300048918 Ga0496115_0151166 Ga0496115_0151166_616_1014 126
44 3300048919 Ga0496116_0005941 Ga0496116_0005941_7998_8396 126
45 3300048920 Ga0496117_0011200 Ga0496117_0011200_2924_3322 126
46 3300048921 Ga0496118_0007845 Ga0496118_0007845_7998_8396 126
47 3300048922 Ga0496119_0001302 Ga0496119_0001302_28925_29323 126
48 3300048924 Ga0496121_0000016 Ga0496121_0000016_18857_19255 126
49 3300048925 Ga0496122_0000250 Ga0496122_0000250_68490_68888 126
50 3300048926 Ga0496123_0005844 Ga0496123_0005844_4495_4893 126
51 3300048927 Ga0496124_0000015 Ga0496124_0000015_359135_359533 126
52 3300048928 Ga0496125_0000021 Ga0496125_0000021_101168_101566 126
53 3300048929 Ga0496126_0000015 Ga0496126_0000015_101168_101566 126
54 3300053138 Ga0500564_201201 Ga0500564_201201_231_623 126
55 3300006051 Ga0075364_10579075 Ga0075364_105790752 127
56 3300031728 Ga0316578_10409623 Ga0316578_104096232 127
57 3300031995 Ga0307409_100471635 Ga0307409_1004716352 127
58 3300036712 Ga0316584_0029843 Ga0316584_0029843_1169_1582 127
59 3300050491 nmdc:mga00v17_993720_c1 nmdc:mga00v17_993720_c1_120_506 127
60 3300050492 nmdc:mga0yw44_10124_c1 nmdc:mga0yw44_10124_c1_192_578 127
61 3300049581 Ga0501047_0697261 Ga0501047_0697261_263_673 129
62 iso_pu_bacteria 2738543028 2739334624 129
63 3300031251 Ga0265327_10002543 Ga0265327_100025432 130
64 iso_pu_bacteria 2842134933 2842137721 130
65 iso_pu_bacteria 2902799365 2902803899 130
66 3300006051 Ga0075364_10699882 Ga0075364_106998821 131
67 3300006177 Ga0075362_10294316 Ga0075362_102943161 131
68 3300044684 Ga0466966_0066263 Ga0466966_0066263_859_1278 131
69 3300050489 nmdc:mga03683_189315_c1 nmdc:mga03683_189315_c1_381_788 131
70 3300050491 nmdc:mga00v17_439025_c1 nmdc:mga00v17_439025_c1_335_742 131
71 iso_pu_bacteria 2902837492 2902843697 131
72 3300014968 Ga0157379_10760593 Ga0157379_107605932 132
73 3300039447 Ga0436361_0537380 Ga0436361_0537380_14_427 132
74 3300044656 Ga0466969_0152580 Ga0466969_0152580_229_645 132
75 3300044683 Ga0466965_0060425 Ga0466965_0060425_105_521 132
76 3300044684 Ga0466966_0004859 Ga0466966_0004859_1993_2409 132
77 3300044693 Ga0466961_0498593 Ga0466961_0498593_227_643 132
78 3300044694 Ga0466963_0109197 Ga0466963_0109197_463_879 132
79 3300044735 Ga0466968_0042721 Ga0466968_0042721_1332_1748 132
80 3300044765 Ga0466970_0056564 Ga0466970_0056564_1139_1555 132
81 3300044842 Ga0466957_0649687 Ga0466957_0649687_200_616 132
82 3300045049 Ga0466959_0000940 Ga0466959_0000940_11720_12136 132
83 3300049571 Ga0501034_0006605 Ga0501034_0006605_65_478 132
84 3300049572 Ga0501036_0012162 Ga0501036_0012162_5065_5478 132
85 3300049573 Ga0501037_0000060 Ga0501037_0000060_7832_8245 132
86 3300049574 Ga0501038_0005039 Ga0501038_0005039_1453_1866 132
87 3300049575 Ga0501039_0001404 Ga0501039_0001404_14243_14656 132
88 3300049577 Ga0501041_0490743 Ga0501041_0490743_289_702 132
89 3300049579 Ga0501043_0001080 Ga0501043_0001080_3566_3979 132
90 3300049586 Ga0501070_0006373 Ga0501070_0006373_1154_1567 132
91 3300049589 Ga0501073_0010396 Ga0501073_0010396_6220_6633 132
92 3300049823 Ga0501044_0011489 Ga0501044_0011489_1104_1517 132
93 3300049824 Ga0501045_1050961 Ga0501045_1050961_150_563 132
94 iso_pu_bacteria 2929212328 2929215539 132
95 3300005434 Ga0070709_11095648 Ga0070709_110956481 133
96 3300005435 Ga0070714_100038502 Ga0070714_1000385023 133
97 3300005435 Ga0070714_100354873 Ga0070714_1003548732 133
98 3300005436 Ga0070713_100061125 Ga0070713_1000611252 133
99 3300025928 Ga0207700_10026041 Ga0207700_100260414 133
100 3300025929 Ga0207664_10110444 Ga0207664_101104442 133
101 3300025939 Ga0207665_10277587 Ga0207665_102775871 133
102 3300045836 Ga0466958_0341356 Ga0466958_0341356_378_806 133
103 3300049569 Ga0501032_0027257 Ga0501032_0027257_378_803 133
104 3300049570 Ga0501033_0065222 Ga0501033_0065222_1564_1989 133
105 3300049571 Ga0501034_0063349 Ga0501034_0063349_103_528 133
106 3300049581 Ga0501047_0007251 Ga0501047_0007251_8037_8462 133
107 3300049822 Ga0501035_0000279 Ga0501035_0000279_24940_25365 133
108 3300049823 Ga0501044_0000637 Ga0501044_0000637_14249_14674 133
109 3300006038 Ga0075365_10059442 Ga0075365_100594422 134
110 3300006042 Ga0075368_10031330 Ga0075368_100313302 134
111 3300006048 Ga0075363_100001686 Ga0075363_1000016863 134
112 3300006048 Ga0075363_100079682 Ga0075363_1000796822 134
113 3300006048 Ga0075363_100591780 Ga0075363_1005917801 134
114 3300006051 Ga0075364_10001802 Ga0075364_100018025 134
115 3300006186 Ga0075369_10013542 Ga0075369_100135423 134
116 3300006186 Ga0075369_10064000 Ga0075369_100640002 134
117 3300006353 Ga0075370_10010001 Ga0075370_100100012 134
118 3300006353 Ga0075370_10103110 Ga0075370_101031102 134
119 3300010375 Ga0105239_10931016 Ga0105239_109310162 134
120 3300027866 Ga0209813_10018004 Ga0209813_100180042 134
121 3300028380 Ga0268265_10722498 Ga0268265_107224982 134
122 3300039447 Ga0436361_0725937 Ga0436361_0725937_275_715 134
123 3300044658 Ga0466972_0016906 Ga0466972_0016906_1816_2223 134
124 3300045049 Ga0466959_0020237 Ga0466959_0020237_2263_2670 134
125 3300050490 nmdc:mga03n38_114596_c1 nmdc:mga03n38_114596_c1_140_547 134
126 3300050490 nmdc:mga03n38_2084_c1 nmdc:mga03n38_2084_c1_2122_2541 134
127 3300050490 nmdc:mga03n38_75159_c1 nmdc:mga03n38_75159_c1_141_548 134
128 3300050491 nmdc:mga00v17_39671_c1 nmdc:mga00v17_39671_c1_2122_2541 134
129 3300050495 nmdc:mga04h51_30979_c1 nmdc:mga04h51_30979_c1_1254_1673 134
130 3300050496 nmdc:mga07m45_37451_c1 nmdc:mga07m45_37451_c1_155_562 134
131 3300050496 nmdc:mga07m45_900392_c1 nmdc:mga07m45_900392_c1_25_432 134
132 3300050496 nmdc:mga07m45_9478_c1 nmdc:mga07m45_9478_c1_734_1153 134
133 3300050516 nmdc:mga0sz30_215034_c1 nmdc:mga0sz30_215034_c1_271_678 134
134 3300001991 JGI24743J22301_10036544 JGI24743J22301_100365442 135
135 3300002074 JGI24748J21848_1003937 JGI24748J21848_10039373 135
136 3300002077 JGI24744J21845_10021330 JGI24744J21845_100213302 135
137 3300002077 JGI24744J21845_10030637 JGI24744J21845_100306372 135
138 3300002077 JGI24744J21845_10041627 JGI24744J21845_100416272 135
139 3300003792 Ga0055540_1002658 Ga0055540_10026581 135
140 3300005328 Ga0070676_10017677 Ga0070676_100176772 135
141 3300005329 Ga0070683_100023390 Ga0070683_1000233903 135
142 3300005330 Ga0070690_100045911 Ga0070690_1000459112 135
143 3300005331 Ga0070670_100238903 Ga0070670_1002389032 135
144 3300005334 Ga0068869_100015439 Ga0068869_1000154392 135
145 3300005335 Ga0070666_10019818 Ga0070666_100198182 135
146 3300005336 Ga0070680_100188248 Ga0070680_1001882483 135
147 3300005337 Ga0070682_100002878 Ga0070682_1000028786 135
148 3300005337 Ga0070682_100057367 Ga0070682_1000573674 135
149 3300005337 Ga0070682_100299740 Ga0070682_1002997402 135
150 3300005337 Ga0070682_100377778 Ga0070682_1003777781 135
151 3300005338 Ga0068868_100644809 Ga0068868_1006448091 135
152 3300005338 Ga0068868_100727875 Ga0068868_1007278751 135
153 3300005339 Ga0070660_100045944 Ga0070660_1000459442 135
154 3300005340 Ga0070689_100009102 Ga0070689_1000091022 135
155 3300005340 Ga0070689_101062325 Ga0070689_1010623251 135
156 3300005340 Ga0070689_101161973 Ga0070689_1011619731 135
157 3300005341 Ga0070691_10035105 Ga0070691_100351052 135
158 3300005341 Ga0070691_10078999 Ga0070691_100789992 135
159 3300005345 Ga0070692_10079083 Ga0070692_100790832 135
160 3300005347 Ga0070668_100026476 Ga0070668_1000264764 135
161 3300005347 Ga0070668_100219214 Ga0070668_1002192142 135
162 3300005347 Ga0070668_100583970 Ga0070668_1005839702 135
163 3300005353 Ga0070669_100019727 Ga0070669_1000197272 135
164 3300005353 Ga0070669_100311674 Ga0070669_1003116742 135
165 3300005355 Ga0070671_100023211 Ga0070671_1000232112 135
166 3300005355 Ga0070671_100050768 Ga0070671_1000507682 135
167 3300005355 Ga0070671_100263494 Ga0070671_1002634942 135
168 3300005356 Ga0070674_100001170 Ga0070674_10000117013 135
169 3300005364 Ga0070673_101459928 Ga0070673_1014599282 135
170 3300005365 Ga0070688_100005179 Ga0070688_1000051792 135
171 3300005365 Ga0070688_101014369 Ga0070688_1010143692 135
172 3300005366 Ga0070659_100119164 Ga0070659_1001191642 135
173 3300005367 Ga0070667_100000082 Ga0070667_100000082111 135
174 3300005367 Ga0070667_100037621 Ga0070667_1000376212 135
175 3300005367 Ga0070667_100053854 Ga0070667_1000538544 135
176 3300005367 Ga0070667_100312880 Ga0070667_1003128802 135
177 3300005367 Ga0070667_100642711 Ga0070667_1006427112 135
178 3300005434 Ga0070709_10045003 Ga0070709_100450032 135
179 3300005435 Ga0070714_101931064 Ga0070714_1019310641 135
180 3300005437 Ga0070710_10001153 Ga0070710_100011536 135
181 3300005438 Ga0070701_10000735 Ga0070701_100007353 135
182 3300005439 Ga0070711_100000535 Ga0070711_10000053511 135
183 3300005439 Ga0070711_100004184 Ga0070711_1000041846 135
184 3300005440 Ga0070705_100002582 Ga0070705_1000025824 135
185 3300005440 Ga0070705_101335052 Ga0070705_1013350521 135
186 3300005441 Ga0070700_100041699 Ga0070700_1000416992 135
187 3300005441 Ga0070700_100221629 Ga0070700_1002216292 135
188 3300005444 Ga0070694_100353587 Ga0070694_1003535871 135
189 3300005455 Ga0070663_100189210 Ga0070663_1001892103 135
190 3300005456 Ga0070678_100000177 Ga0070678_10000017731 135
191 3300005456 Ga0070678_100185220 Ga0070678_1001852202 135
192 3300005457 Ga0070662_100029092 Ga0070662_1000290922 135
193 3300005459 Ga0068867_100032040 Ga0068867_1000320402 135
194 3300005459 Ga0068867_100175435 Ga0068867_1001754352 135
195 3300005466 Ga0070685_10047243 Ga0070685_100472432 135
196 3300005466 Ga0070685_10460929 Ga0070685_104609291 135
197 3300005466 Ga0070685_10483561 Ga0070685_104835612 135
198 3300005468 Ga0070707_102046579 Ga0070707_1020465791 135
199 3300005539 Ga0068853_100001131 Ga0068853_10000113115 135
200 3300005539 Ga0068853_100035244 Ga0068853_1000352442 135
201 3300005539 Ga0068853_100409943 Ga0068853_1004099432 135
202 3300005544 Ga0070686_100055311 Ga0070686_1000553113 135
203 3300005545 Ga0070695_100045064 Ga0070695_1000450643 135
204 3300005546 Ga0070696_100037009 Ga0070696_1000370094 135
205 3300005547 Ga0070693_100013855 Ga0070693_1000138554 135
206 3300005547 Ga0070693_100117858 Ga0070693_1001178583 135
207 3300005548 Ga0070665_100007843 Ga0070665_1000078434 135
208 3300005548 Ga0070665_100038498 Ga0070665_1000384985 135
209 3300005548 Ga0070665_100080216 Ga0070665_1000802163 135
210 3300005548 Ga0070665_100143646 Ga0070665_1001436462 135
211 3300005548 Ga0070665_100405761 Ga0070665_1004057612 135
212 3300005549 Ga0070704_100000119 Ga0070704_1000001194 135
213 3300005563 Ga0068855_100937432 Ga0068855_1009374322 135
214 3300005578 Ga0068854_100006854 Ga0068854_1000068543 135
215 3300005578 Ga0068854_100164794 Ga0068854_1001647942 135
216 3300005614 Ga0068856_100224967 Ga0068856_1002249672 135
217 3300005615 Ga0070702_100001178 Ga0070702_1000011784 135
218 3300005615 Ga0070702_100027404 Ga0070702_1000274042 135
219 3300005616 Ga0068852_100220906 Ga0068852_1002209063 135
220 3300005616 Ga0068852_100534100 Ga0068852_1005341001 135
221 3300005617 Ga0068859_100001666 Ga0068859_1000016664 135
222 3300005617 Ga0068859_100006068 Ga0068859_1000060688 135
223 3300005617 Ga0068859_100251361 Ga0068859_1002513612 135
224 3300005617 Ga0068859_101065500 Ga0068859_1010655002 135
225 3300005618 Ga0068864_100031008 Ga0068864_1000310084 135
226 3300005718 Ga0068866_10000444 Ga0068866_100004444 135
227 3300005718 Ga0068866_10047926 Ga0068866_100479263 135
228 3300005719 Ga0068861_100000376 Ga0068861_10000037616 135
229 3300005719 Ga0068861_100046423 Ga0068861_1000464234 135
230 3300005840 Ga0068870_10895313 Ga0068870_108953132 135
231 3300005841 Ga0068863_100002574 Ga0068863_1000025742 135
232 3300005841 Ga0068863_100022515 Ga0068863_1000225152 135
233 3300005841 Ga0068863_100395581 Ga0068863_1003955813 135
234 3300005841 Ga0068863_100519218 Ga0068863_1005192182 135
235 3300005842 Ga0068858_100002114 Ga0068858_1000021142 135
236 3300005842 Ga0068858_100069089 Ga0068858_1000690892 135
237 3300005842 Ga0068858_100181605 Ga0068858_1001816051 135
238 3300005842 Ga0068858_100463970 Ga0068858_1004639702 135
239 3300005842 Ga0068858_100724665 Ga0068858_1007246652 135
240 3300005843 Ga0068860_100000112 Ga0068860_100000112111 135
241 3300005843 Ga0068860_100090945 Ga0068860_1000909452 135
242 3300005843 Ga0068860_100156905 Ga0068860_1001569052 135
243 3300005843 Ga0068860_100507426 Ga0068860_1005074262 135
244 3300005843 Ga0068860_100961464 Ga0068860_1009614642 135
245 3300005844 Ga0068862_100000012 Ga0068862_10000001282 135
246 3300005844 Ga0068862_100002023 Ga0068862_1000020234 135
247 3300005844 Ga0068862_100122507 Ga0068862_1001225072 135
248 3300005937 Ga0081455_10025499 Ga0081455_100254994 135
249 3300006038 Ga0075365_10010294 Ga0075365_100102943 135
250 3300006038 Ga0075365_10095656 Ga0075365_100956562 135
251 3300006038 Ga0075365_10156398 Ga0075365_101563982 135
252 3300006038 Ga0075365_10381819 Ga0075365_103818191 135
253 3300006042 Ga0075368_10053295 Ga0075368_100532952 135
254 3300006048 Ga0075363_100001376 Ga0075363_1000013767 135
255 3300006048 Ga0075363_100002305 Ga0075363_1000023055 135
256 3300006048 Ga0075363_100002542 Ga0075363_1000025423 135
257 3300006048 Ga0075363_100008389 Ga0075363_1000083892 135
258 3300006048 Ga0075363_100140070 Ga0075363_1001400702 135
259 3300006048 Ga0075363_100193275 Ga0075363_1001932752 135
260 3300006048 Ga0075363_100310871 Ga0075363_1003108712 135
261 3300006051 Ga0075364_10000434 Ga0075364_100004342 135
262 3300006051 Ga0075364_10016359 Ga0075364_100163592 135
263 3300006051 Ga0075364_10023409 Ga0075364_100234092 135
264 3300006051 Ga0075364_10087497 Ga0075364_100874972 135
265 3300006051 Ga0075364_10109360 Ga0075364_101093603 135
266 3300006051 Ga0075364_10282058 Ga0075364_102820582 135
267 3300006051 Ga0075364_10283946 Ga0075364_102839462 135
268 3300006163 Ga0070715_10065762 Ga0070715_100657622 135
269 3300006173 Ga0070716_100036194 Ga0070716_1000361942 135
270 3300006173 Ga0070716_100747633 Ga0070716_1007476332 135
271 3300006175 Ga0070712_100038911 Ga0070712_1000389112 135
272 3300006177 Ga0075362_10042227 Ga0075362_100422272 135
273 3300006177 Ga0075362_10049590 Ga0075362_100495901 135
274 3300006178 Ga0075367_10011117 Ga0075367_100111176 135
275 3300006178 Ga0075367_10235722 Ga0075367_102357222 135
276 3300006186 Ga0075369_10010255 Ga0075369_100102552 135
277 3300006186 Ga0075369_10034054 Ga0075369_100340542 135
278 3300006186 Ga0075369_10039146 Ga0075369_100391462 135
279 3300006186 Ga0075369_10044170 Ga0075369_100441702 135
280 3300006186 Ga0075369_10121030 Ga0075369_101210302 135
281 3300006186 Ga0075369_10256252 Ga0075369_102562522 135
282 3300006237 Ga0097621_100175955 Ga0097621_1001759552 135
283 3300006353 Ga0075370_10051805 Ga0075370_100518053 135
284 3300006353 Ga0075370_10085914 Ga0075370_100859142 135
285 3300006353 Ga0075370_10102210 Ga0075370_101022102 135
286 3300006353 Ga0075370_10170538 Ga0075370_101705382 135
287 3300006353 Ga0075370_10322845 Ga0075370_103228452 135
288 3300006358 Ga0068871_100084010 Ga0068871_1000840102 135
289 3300006846 Ga0075430_100044118 Ga0075430_1000441182 135
290 3300006847 Ga0075431_100176613 Ga0075431_1001766132 135
291 3300006881 Ga0068865_100037446 Ga0068865_1000374462 135
292 3300006881 Ga0068865_100292840 Ga0068865_1002928403 135
293 3300006931 Ga0097620_100001666 Ga0097620_10000166615 135
294 3300006931 Ga0097620_100006068 Ga0097620_1000060688 135
295 3300006931 Ga0097620_100251363 Ga0097620_1002513632 135
296 3300006931 Ga0097620_101065448 Ga0097620_1010654482 135
297 3300009092 Ga0105250_10024168 Ga0105250_100241682 135
298 3300009092 Ga0105250_10323811 Ga0105250_103238112 135
299 3300009092 Ga0105250_10425052 Ga0105250_104250522 135
300 3300009094 Ga0111539_10842449 Ga0111539_108424493 135
301 3300009098 Ga0105245_10043452 Ga0105245_100434524 135
302 3300009098 Ga0105245_10194852 Ga0105245_101948524 135
303 3300009098 Ga0105245_12402307 Ga0105245_124023072 135
304 3300009101 Ga0105247_10000007 Ga0105247_10000007105 135
305 3300009101 Ga0105247_10021829 Ga0105247_100218294 135
306 3300009101 Ga0105247_10103058 Ga0105247_101030583 135
307 3300009101 Ga0105247_10281432 Ga0105247_102814322 135
308 3300009101 Ga0105247_11677088 Ga0105247_116770882 135
309 3300009148 Ga0105243_10008964 Ga0105243_100089643 135
310 3300009148 Ga0105243_10029103 Ga0105243_100291032 135
311 3300009174 Ga0105241_10034596 Ga0105241_100345963 135
312 3300009176 Ga0105242_10159734 Ga0105242_101597343 135
313 3300009176 Ga0105242_10208466 Ga0105242_102084663 135
314 3300009176 Ga0105242_10994874 Ga0105242_109948742 135
315 3300009177 Ga0105248_10000254 Ga0105248_100002545 135
316 3300009177 Ga0105248_10003491 Ga0105248_100034915 135
317 3300009177 Ga0105248_10038234 Ga0105248_100382343 135
318 3300009545 Ga0105237_10073891 Ga0105237_100738914 135
319 3300009551 Ga0105238_10035956 Ga0105238_100359565 135
320 3300009551 Ga0105238_10135303 Ga0105238_101353032 135
321 3300009551 Ga0105238_10822911 Ga0105238_108229112 135
322 3300009553 Ga0105249_10000001 Ga0105249_10000001380 135
323 3300009553 Ga0105249_10034230 Ga0105249_100342301 135
324 3300009553 Ga0105249_10042640 Ga0105249_100426403 135
325 3300009553 Ga0105249_11833387 Ga0105249_118333872 135
326 3300010375 Ga0105239_10019098 Ga0105239_100190984 135
327 3300010375 Ga0105239_10544218 Ga0105239_105442182 135
328 3300010375 Ga0105239_11117882 Ga0105239_111178822 135
329 3300011119 Ga0105246_10124295 Ga0105246_101242951 135
330 3300013105 Ga0157369_10728818 Ga0157369_107288182 135
331 3300013296 Ga0157374_10134730 Ga0157374_101347302 135
332 3300013297 Ga0157378_10415478 Ga0157378_104154782 135
333 3300013297 Ga0157378_12228993 Ga0157378_122289931 135
334 3300013306 Ga0163162_10012920 Ga0163162_100129203 135
335 3300013306 Ga0163162_10148259 Ga0163162_101482592 135
336 3300013306 Ga0163162_12905472 Ga0163162_129054722 135
337 3300013307 Ga0157372_10042177 Ga0157372_100421773 135
338 3300013307 Ga0157372_10380110 Ga0157372_103801101 135
339 3300013308 Ga0157375_10007645 Ga0157375_100076454 135
340 3300013308 Ga0157375_10333373 Ga0157375_103333732 135
341 3300014325 Ga0163163_10153988 Ga0163163_101539882 135
342 3300014325 Ga0163163_10239277 Ga0163163_102392774 135
343 3300014325 Ga0163163_10302466 Ga0163163_103024662 135
344 3300014325 Ga0163163_11025258 Ga0163163_110252582 135
345 3300014326 Ga0157380_10010834 Ga0157380_100108342 135
346 3300014745 Ga0157377_10047069 Ga0157377_100470692 135
347 3300014745 Ga0157377_10181202 Ga0157377_101812021 135
348 3300014745 Ga0157377_10509029 Ga0157377_105090292 135
349 3300014968 Ga0157379_10021686 Ga0157379_100216864 135
350 3300014968 Ga0157379_10122969 Ga0157379_101229692 135
351 3300014968 Ga0157379_10248487 Ga0157379_102484872 135
352 3300014969 Ga0157376_10781054 Ga0157376_107810541 135
353 3300017792 Ga0163161_10007677 Ga0163161_100076772 135
354 3300017792 Ga0163161_10648802 Ga0163161_106488022 135
355 3300025273 Ga0209673_1034296 Ga0209673_10342962 135
356 3300025303 Ga0209051_1000651 Ga0209051_100065135 135
357 3300025303 Ga0209051_1010498 Ga0209051_10104982 135
358 3300025303 Ga0209051_1018311 Ga0209051_10183112 135
359 3300025711 Ga0207696_1103192 Ga0207696_11031922 135
360 3300025885 Ga0207653_10067132 Ga0207653_100671322 135
361 3300025898 Ga0207692_10026407 Ga0207692_100264071 135
362 3300025898 Ga0207692_10042664 Ga0207692_100426644 135
363 3300025899 Ga0207642_10000881 Ga0207642_100008813 135
364 3300025899 Ga0207642_10254191 Ga0207642_102541912 135
365 3300025900 Ga0207710_10000013 Ga0207710_10000013105 135
366 3300025900 Ga0207710_10010865 Ga0207710_100108652 135
367 3300025901 Ga0207688_10005413 Ga0207688_100054133 135
368 3300025901 Ga0207688_10025622 Ga0207688_100256223 135
369 3300025903 Ga0207680_10040830 Ga0207680_100408302 135
370 3300025904 Ga0207647_10181400 Ga0207647_101814002 135
371 3300025905 Ga0207685_10034598 Ga0207685_100345983 135
372 3300025906 Ga0207699_10045300 Ga0207699_100453003 135
373 3300025906 Ga0207699_10816143 Ga0207699_108161431 135
374 3300025907 Ga0207645_10042723 Ga0207645_100427232 135
375 3300025907 Ga0207645_10063686 Ga0207645_100636862 135
376 3300025908 Ga0207643_10548202 Ga0207643_105482022 135
377 3300025911 Ga0207654_10034208 Ga0207654_100342083 135
378 3300025914 Ga0207671_10191593 Ga0207671_101915932 135
379 3300025914 Ga0207671_10245568 Ga0207671_102455681 135
380 3300025915 Ga0207693_10000746 Ga0207693_1000074611 135
381 3300025916 Ga0207663_10191631 Ga0207663_101916312 135
382 3300025917 Ga0207660_10167389 Ga0207660_101673892 135
383 3300025917 Ga0207660_11074967 Ga0207660_110749672 135
384 3300025918 Ga0207662_10385831 Ga0207662_103858312 135
385 3300025919 Ga0207657_10063809 Ga0207657_100638091 135
386 3300025923 Ga0207681_10031476 Ga0207681_100314762 135
387 3300025924 Ga0207694_10128205 Ga0207694_101282052 135
388 3300025924 Ga0207694_10184679 Ga0207694_101846792 135
389 3300025925 Ga0207650_10144819 Ga0207650_101448193 135
390 3300025927 Ga0207687_10073519 Ga0207687_100735192 135
391 3300025927 Ga0207687_10265683 Ga0207687_102656832 135
392 3300025929 Ga0207664_10417732 Ga0207664_104177322 135
393 3300025931 Ga0207644_10073990 Ga0207644_100739903 135
394 3300025931 Ga0207644_10214567 Ga0207644_102145672 135
395 3300025932 Ga0207690_10076231 Ga0207690_100762312 135
396 3300025932 Ga0207690_10330345 Ga0207690_103303452 135
397 3300025932 Ga0207690_10408393 Ga0207690_104083933 135
398 3300025933 Ga0207706_10018419 Ga0207706_100184193 135
399 3300025933 Ga0207706_10051956 Ga0207706_100519562 135
400 3300025934 Ga0207686_10007038 Ga0207686_100070383 135
401 3300025934 Ga0207686_11342856 Ga0207686_113428562 135
402 3300025935 Ga0207709_10029376 Ga0207709_100293764 135
403 3300025935 Ga0207709_10111798 Ga0207709_101117982 135
404 3300025935 Ga0207709_10396937 Ga0207709_103969373 135
405 3300025936 Ga0207670_10067158 Ga0207670_100671582 135
406 3300025936 Ga0207670_10171906 Ga0207670_101719061 135
407 3300025937 Ga0207669_10020507 Ga0207669_100205074 135
408 3300025938 Ga0207704_10034460 Ga0207704_100344603 135
409 3300025938 Ga0207704_10831165 Ga0207704_108311652 135
410 3300025938 Ga0207704_11745022 Ga0207704_117450221 135
411 3300025939 Ga0207665_10040303 Ga0207665_100403034 135
412 3300025939 Ga0207665_10078915 Ga0207665_100789151 135
413 3300025939 Ga0207665_10085618 Ga0207665_100856182 135
414 3300025941 Ga0207711_10000509 Ga0207711_1000050915 135
415 3300025941 Ga0207711_10008953 Ga0207711_100089533 135
416 3300025941 Ga0207711_10095006 Ga0207711_100950063 135
417 3300025941 Ga0207711_10298134 Ga0207711_102981342 135
418 3300025941 Ga0207711_10686341 Ga0207711_106863412 135
419 3300025942 Ga0207689_10004958 Ga0207689_100049583 135
420 3300025942 Ga0207689_10059866 Ga0207689_100598664 135
421 3300025949 Ga0207667_10124004 Ga0207667_101240042 135
422 3300025960 Ga0207651_10259155 Ga0207651_102591552 135
423 3300025960 Ga0207651_11002260 Ga0207651_110022602 135
424 3300025961 Ga0207712_10000006 Ga0207712_10000006111 135
425 3300025961 Ga0207712_10008748 Ga0207712_100087482 135
426 3300025961 Ga0207712_10072067 Ga0207712_100720674 135
427 3300025961 Ga0207712_11823940 Ga0207712_118239401 135
428 3300025972 Ga0207668_10049542 Ga0207668_100495422 135
429 3300025972 Ga0207668_10579418 Ga0207668_105794182 135
430 3300025981 Ga0207640_10019158 Ga0207640_100191582 135
431 3300025981 Ga0207640_10077814 Ga0207640_100778142 135
432 3300025981 Ga0207640_11007170 Ga0207640_110071701 135
433 3300025986 Ga0207658_10013299 Ga0207658_100132995 135
434 3300025986 Ga0207658_10070685 Ga0207658_100706852 135
435 3300025986 Ga0207658_10328681 Ga0207658_103286813 135
436 3300025986 Ga0207658_10591930 Ga0207658_105919302 135
437 3300025986 Ga0207658_11245944 Ga0207658_112459442 135
438 3300026023 Ga0207677_10015614 Ga0207677_100156142 135
439 3300026023 Ga0207677_10243832 Ga0207677_102438322 135
440 3300026035 Ga0207703_10021586 Ga0207703_100215864 135
441 3300026035 Ga0207703_10374199 Ga0207703_103741993 135
442 3300026035 Ga0207703_10701898 Ga0207703_107018982 135
443 3300026041 Ga0207639_10038393 Ga0207639_100383932 135
444 3300026041 Ga0207639_10257982 Ga0207639_102579822 135
445 3300026067 Ga0207678_10029270 Ga0207678_100292702 135
446 3300026067 Ga0207678_10154356 Ga0207678_101543562 135
447 3300026075 Ga0207708_10001994 Ga0207708_100019942 135
448 3300026075 Ga0207708_10758350 Ga0207708_107583502 135
449 3300026078 Ga0207702_10074460 Ga0207702_100744603 135
450 3300026088 Ga0207641_10004004 Ga0207641_1000400410 135
451 3300026088 Ga0207641_10037431 Ga0207641_100374312 135
452 3300026088 Ga0207641_10463555 Ga0207641_104635552 135
453 3300026089 Ga0207648_10011895 Ga0207648_100118954 135
454 3300026089 Ga0207648_10021131 Ga0207648_100211312 135
455 3300026095 Ga0207676_10116539 Ga0207676_101165395 135
456 3300026095 Ga0207676_10845120 Ga0207676_108451202 135
457 3300026118 Ga0207675_100001770 Ga0207675_1000017704 135
458 3300026118 Ga0207675_100041913 Ga0207675_1000419132 135
459 3300026118 Ga0207675_100258324 Ga0207675_1002583242 135
460 3300026118 Ga0207675_102678002 Ga0207675_1026780021 135
461 3300026121 Ga0207683_10002908 Ga0207683_1000290815 135
462 3300026121 Ga0207683_10106623 Ga0207683_101066232 135
463 3300026121 Ga0207683_10357441 Ga0207683_103574412 135
464 3300026121 Ga0207683_10863957 Ga0207683_108639572 135
465 3300026142 Ga0207698_10109116 Ga0207698_101091162 135
466 3300026142 Ga0207698_10558504 Ga0207698_105585041 135
467 3300028379 Ga0268266_10010980 Ga0268266_100109802 135
468 3300028379 Ga0268266_10155421 Ga0268266_101554212 135
469 3300028379 Ga0268266_10264426 Ga0268266_102644262 135
470 3300028379 Ga0268266_10344449 Ga0268266_103444493 135
471 3300028380 Ga0268265_10000016 Ga0268265_10000016107 135
472 3300028380 Ga0268265_10082712 Ga0268265_100827122 135
473 3300028380 Ga0268265_10460025 Ga0268265_104600252 135
474 3300028381 Ga0268264_10000026 Ga0268264_10000026109 135
475 3300028381 Ga0268264_10371394 Ga0268264_103713942 135
476 3300028381 Ga0268264_10505179 Ga0268264_105051792 135
477 3300028381 Ga0268264_10857548 Ga0268264_108575481 135
478 3300028794 Ga0307515_10681016 Ga0307515_106810162 135
479 3300031852 Ga0307410_10638313 Ga0307410_106383132 135
480 3300031995 Ga0307409_100179019 Ga0307409_1001790192 135
481 3300034820 Ga0373959_0136328 Ga0373959_0136328_67_477 135
482 3300034957 Ga0373938_0028384 Ga0373938_0028384_169_576 135
483 3300035084 Ga0373928_0006583 Ga0373928_0006583_711_1121 135
484 3300035112 Ga0373932_0017431 Ga0373932_0017431_787_1194 135
485 3300035121 Ga0373960_0171028 Ga0373960_0171028_314_724 135
486 3300035207 Ga0373942_0045314 Ga0373942_0045314_399_809 135
487 3300035691 Ga0373931_0226183 Ga0373931_0226183_302_709 135
488 3300035691 Ga0373931_0263502 Ga0373931_0263502_600_1010 135
489 3300041411 Ga0439466_0001828 Ga0439466_0001828_5923_6333 135
490 3300041411 Ga0439466_0030525 Ga0439466_0030525_637_1044 135
491 3300041413 Ga0439465_0002757 Ga0439465_0002757_2701_3111 135
492 3300041413 Ga0439465_0014092 Ga0439465_0014092_808_1215 135
493 3300041491 Ga0451833_0022299 Ga0451833_0022299_243_659 135
494 3300041494 Ga0451837_1721570 Ga0451837_1721570_87_500 135
495 3300041509 Ga0451843_1311791 Ga0451843_1311791_169_582 135
496 3300041512 Ga0451853_1912762 Ga0451853_1912762_160_570 135
497 3300041997 Ga0439431_0164964 Ga0439431_0164964_46_456 135
498 3300042438 Ga0439459_0079761 Ga0439459_0079761_251_664 135
499 3300044658 Ga0466972_0002940 Ga0466972_0002940_7119_7529 135
500 3300044683 Ga0466965_0164547 Ga0466965_0164547_712_1122 135
501 3300044684 Ga0466966_0306529 Ga0466966_0306529_528_938 135
502 3300044693 Ga0466961_0056165 Ga0466961_0056165_1644_2054 135
503 3300044706 Ga0466964_0030248 Ga0466964_0030248_804_1214 135
504 3300044719 Ga0466971_0116842 Ga0466971_0116842_626_1036 135
505 3300044735 Ga0466968_0008280 Ga0466968_0008280_2380_2787 135
506 3300044735 Ga0466968_0019038 Ga0466968_0019038_206_616 135
507 3300044765 Ga0466970_0126002 Ga0466970_0126002_138_548 135
508 3300044901 Ga0466960_0007027 Ga0466960_0007027_2719_3132 135
509 3300045049 Ga0466959_0020683 Ga0466959_0020683_3656_4066 135
510 3300045836 Ga0466958_0032709 Ga0466958_0032709_802_1212 135
511 3300045976 Ga0466967_0589678 Ga0466967_0589678_242_649 135
512 3300046692 Ga0495671_0228472 Ga0495671_0228472_460_873 135
513 3300046694 Ga0495649_0141710 Ga0495649_0141710_278_688 135
514 3300046694 Ga0495649_0262655 Ga0495649_0262655_163_579 135
515 3300047320 Ga0495672_0126560 Ga0495672_0126560_780_1196 135
516 3300048903 Ga0496100_0000571 Ga0496100_0000571_15463_15876 135
517 3300048903 Ga0496100_0180262 Ga0496100_0180262_734_1141 135
518 3300048903 Ga0496100_0375169 Ga0496100_0375169_119_535 135
519 3300048903 Ga0496100_0415720 Ga0496100_0415720_106_516 135
520 3300048904 Ga0496101_0001602 Ga0496101_0001602_12149_12565 135
521 3300048904 Ga0496101_0006869 Ga0496101_0006869_5788_6201 135
522 3300048904 Ga0496101_0007271 Ga0496101_0007271_3812_4219 135
523 3300048904 Ga0496101_0016534 Ga0496101_0016534_3434_3841 135
524 3300048904 Ga0496101_0595109 Ga0496101_0595109_30_446 135
525 3300048905 Ga0496102_0000124 Ga0496102_0000124_85597_86013 135
526 3300048905 Ga0496102_0005428 Ga0496102_0005428_2219_2626 135
527 3300048905 Ga0496102_0030766 Ga0496102_0030766_184_591 135
528 3300048905 Ga0496102_0161230 Ga0496102_0161230_406_819 135
529 3300048905 Ga0496102_0531954 Ga0496102_0531954_588_1001 135
530 3300048905 Ga0496102_0608715 Ga0496102_0608715_82_492 135
531 3300048906 Ga0496103_0000560 Ga0496103_0000560_26106_26522 135
532 3300048906 Ga0496103_0015930 Ga0496103_0015930_2132_2539 135
533 3300048906 Ga0496103_0058889 Ga0496103_0058889_233_640 135
534 3300048906 Ga0496103_0090427 Ga0496103_0090427_1386_1796 135
535 3300048907 Ga0496104_0003506 Ga0496104_0003506_1215_1628 135
536 3300048907 Ga0496104_0017003 Ga0496104_0017003_1783_2190 135
537 3300048907 Ga0496104_0305995 Ga0496104_0305995_837_1244 135
538 3300048907 Ga0496104_0978292 Ga0496104_0978292_56_466 135
539 3300048908 Ga0496105_0001389 Ga0496105_0001389_15325_15738 135
540 3300048908 Ga0496105_0021354 Ga0496105_0021354_4277_4684 135
541 3300048909 Ga0496106_0001551 Ga0496106_0001551_6441_6848 135
542 3300048909 Ga0496106_0003263 Ga0496106_0003263_1072_1485 135
543 3300048909 Ga0496106_0088938 Ga0496106_0088938_502_912 135
544 3300048910 Ga0496107_0000786 Ga0496107_0000786_195_608 135
545 3300048910 Ga0496107_0004417 Ga0496107_0004417_1557_1964 135
546 3300048910 Ga0496107_0043951 Ga0496107_0043951_571_987 135
547 3300048911 Ga0496108_0004480 Ga0496108_0004480_2499_2909 135
548 3300048911 Ga0496108_0017130 Ga0496108_0017130_4930_5346 135
549 3300048911 Ga0496108_0099551 Ga0496108_0099551_172_579 135
550 3300048912 Ga0496109_0004667 Ga0496109_0004667_7670_8080 135
551 3300048912 Ga0496109_0031496 Ga0496109_0031496_2335_2751 135
552 3300048912 Ga0496109_0074525 Ga0496109_0074525_1277_1684 135
553 3300048913 Ga0496110_0144881 Ga0496110_0144881_642_1049 135
554 3300048913 Ga0496110_0343709 Ga0496110_0343709_442_849 135
555 3300048913 Ga0496110_0543013 Ga0496110_0543013_52_462 135
556 3300048914 Ga0496111_0124417 Ga0496111_0124417_1194_1604 135
557 3300048914 Ga0496111_0149141 Ga0496111_0149141_397_804 135
558 3300048915 Ga0496112_0058213 Ga0496112_0058213_1779_2195 135
559 3300048915 Ga0496112_0109402 Ga0496112_0109402_1260_1667 135
560 3300048915 Ga0496112_0214787 Ga0496112_0214787_1341_1751 135
561 3300048915 Ga0496112_0494962 Ga0496112_0494962_529_945 135
562 3300048916 Ga0496113_0039095 Ga0496113_0039095_695_1111 135
563 3300048916 Ga0496113_0086424 Ga0496113_0086424_1231_1641 135
564 3300048917 Ga0496114_0000215 Ga0496114_0000215_40167_40580 135
565 3300048917 Ga0496114_0232163 Ga0496114_0232163_672_1082 135
566 3300048917 Ga0496114_0777527 Ga0496114_0777527_223_639 135
567 3300048918 Ga0496115_0003338 Ga0496115_0003338_10952_11365 135
568 3300048918 Ga0496115_0109970 Ga0496115_0109970_749_1159 135
569 3300048918 Ga0496115_0206079 Ga0496115_0206079_819_1226 135
570 3300048918 Ga0496115_0223766 Ga0496115_0223766_112_540 135
571 3300048918 Ga0496115_0299729 Ga0496115_0299729_880_1296 135
572 3300048919 Ga0496116_0011701 Ga0496116_0011701_5394_5810 135
573 3300048920 Ga0496117_0000496 Ga0496117_0000496_15947_16363 135
574 3300048921 Ga0496118_0001104 Ga0496118_0001104_38524_38940 135
575 3300048922 Ga0496119_0006797 Ga0496119_0006797_2390_2806 135
576 3300048922 Ga0496119_0215636 Ga0496119_0215636_246_653 135
577 3300048923 Ga0496120_0057110 Ga0496120_0057110_456_872 135
578 3300048924 Ga0496121_0009565 Ga0496121_0009565_3248_3664 135
579 3300048927 Ga0496124_0037931 Ga0496124_0037931_459_875 135
580 3300048928 Ga0496125_0016481 Ga0496125_0016481_4011_4427 135
581 3300048929 Ga0496126_0003135 Ga0496126_0003135_15301_15729 135
582 3300048929 Ga0496126_0481133 Ga0496126_0481133_525_953 135
583 3300049586 Ga0501070_0026217 Ga0501070_0026217_290_700 135
584 3300049586 Ga0501070_1150733 Ga0501070_1150733_44_454 135
585 3300049589 Ga0501073_0337035 Ga0501073_0337035_549_959 135
586 3300049742 Ga0501080_0041878 Ga0501080_0041878_2345_2755 135
587 3300050489 nmdc:mga03683_166942_c1 nmdc:mga03683_166942_c1_315_734 135
588 3300050489 nmdc:mga03683_2488_c1 nmdc:mga03683_2488_c1_1344_1751 135
589 3300050490 nmdc:mga03n38_123452_c1 nmdc:mga03n38_123452_c1_645_1052 135
590 3300050490 nmdc:mga03n38_168891_c1 nmdc:mga03n38_168891_c1_250_657 135
591 3300050490 nmdc:mga03n38_189775_c1 nmdc:mga03n38_189775_c1_351_767 135
592 3300050490 nmdc:mga03n38_201575_c1 nmdc:mga03n38_201575_c1_15_428 135
593 3300050490 nmdc:mga03n38_4052_c1 nmdc:mga03n38_4052_c1_1290_1706 135
594 3300050490 nmdc:mga03n38_42961_c1 nmdc:mga03n38_42961_c1_1039_1446 135
595 3300050490 nmdc:mga03n38_474914_c1 nmdc:mga03n38_474914_c1_213_626 135
596 3300050490 nmdc:mga03n38_6112_c1 nmdc:mga03n38_6112_c1_3730_4149 135
597 3300050491 nmdc:mga00v17_1056_c1 nmdc:mga00v17_1056_c1_8757_9164 135
598 3300050491 nmdc:mga00v17_106638_c1 nmdc:mga00v17_106638_c1_166_573 135
599 3300050491 nmdc:mga00v17_190834_c1 nmdc:mga00v17_190834_c1_671_1084 135
600 3300050491 nmdc:mga00v17_280895_c1 nmdc:mga00v17_280895_c1_582_1001 135
601 3300050491 nmdc:mga00v17_396347_c1 nmdc:mga00v17_396347_c1_309_722 135
602 3300050491 nmdc:mga00v17_480977_c1 nmdc:mga00v17_480977_c1_137_550 135
603 3300050491 nmdc:mga00v17_85065_c1 nmdc:mga00v17_85065_c1_678_1094 135
604 3300050492 nmdc:mga0yw44_128413_c1 nmdc:mga0yw44_128413_c1_367_774 135
605 3300050492 nmdc:mga0yw44_133451_c1 nmdc:mga0yw44_133451_c1_986_1393 135
606 3300050492 nmdc:mga0yw44_13918_c1 nmdc:mga0yw44_13918_c1_2913_3329 135
607 3300050492 nmdc:mga0yw44_50003_c1 nmdc:mga0yw44_50003_c1_1740_2159 135
608 3300050494 nmdc:mga06z11_163622_c1 nmdc:mga06z11_163622_c1_536_952 135
609 3300050494 nmdc:mga06z11_6710_c1 nmdc:mga06z11_6710_c1_1651_2070 135
610 3300050495 nmdc:mga04h51_40503_c1 nmdc:mga04h51_40503_c1_632_1051 135
611 3300050495 nmdc:mga04h51_72657_c1 nmdc:mga04h51_72657_c1_686_1093 135
612 3300050496 nmdc:mga07m45_194127_c1 nmdc:mga07m45_194127_c1_368_775 135
613 3300050496 nmdc:mga07m45_248297_c1 nmdc:mga07m45_248297_c1_504_920 135
614 3300050496 nmdc:mga07m45_53527_c1 nmdc:mga07m45_53527_c1_1776_2183 135
615 3300050496 nmdc:mga07m45_7712_c1 nmdc:mga07m45_7712_c1_2904_3323 135
616 3300050508 nmdc:mga09592_1147841_c1 nmdc:mga09592_1147841_c1_164_571 135
617 3300050509 nmdc:mga0qj67_121054_c1 nmdc:mga0qj67_121054_c1_365_772 135
618 3300050510 nmdc:mga06r32_870120_c1 nmdc:mga06r32_870120_c1_114_521 135
619 3300050516 nmdc:mga0sz30_1492_c1 nmdc:mga0sz30_1492_c1_6324_6731 135
620 3300050516 nmdc:mga0sz30_15817_c1 nmdc:mga0sz30_15817_c1_2361_2777 135
621 3300050516 nmdc:mga0sz30_17537_c2 nmdc:mga0sz30_17537_c2_1528_1938 135
622 3300050516 nmdc:mga0sz30_525675_c1 nmdc:mga0sz30_525675_c1_74_490 135
623 3300050516 nmdc:mga0sz30_59470_c1 nmdc:mga0sz30_59470_c1_1121_1528 135
624 3300050516 nmdc:mga0sz30_92366_c1 nmdc:mga0sz30_92366_c1_665_1081 135
625 3300053079 Ga0500610_0046885 Ga0500610_0046885_619_1050 135
626 3300053080 Ga0500635_0015897 Ga0500635_0015897_255_671 135
627 3300053083 Ga0495655_0038555 Ga0495655_0038555_347_763 135
628 3300053090 Ga0500646_0014290 Ga0500646_0014290_1441_1869 135
629 3300053104 Ga0500556_0048606 Ga0500556_0048606_690_1103 135
630 3300053131 Ga0500652_058831 Ga0500652_058831_718_1134 135
631 3300061719 Ga0466962_0055922 Ga0466962_0055922_839_1249 135
632 iso_pu_bacteria 2643221687 2644485905 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10825

DUF2752

Protein of unknown function (DUF2752)

54

102

0.97

Feature Viewer

pLDDT pTM Quality
59.23 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map