F470998

General Info

Members Datasets Scaffolds Average Seq Length
632 245 1264 433

Family's Representative Sequence

Representative Sequence 3300022734|Ga0224571_100014|Ga0224571_1000144
Length 504
Sequence VWPDFRLKKCAYGSECSATVLAAFTLALPVNRVVREPLLSFSERLQEIRIGFERPFWVANISEIFERLSYYAAFASLALYLQERLNFSAEQTGTLTGIFGGMVWFLAIFGGAAADRLGFRRALSIAYLILAAAYFLIGSIGASWLAPVRNAVPLSLFVGFILILPALGISLVKPCVVGTTARASKENVRSIGYSIYYTMVNIGGAAGPFFASWAHRHLGVESVYRIAALSVFAMFFVVLFFFREPRKPGDAPPPSIATVARNFCVVVGNYRLVLPVLMIALLLRIGLWIYPRFSVPWWIWAGLLALVLAGISRFMWFLVLFTGYWIVFWQQYISLPGYIHGYINPQADVEIILVTDGLTVICLTLAVNFLTRKIPAFQAVILGTLITSVAWLILVFRPTIWGAILSLFVLALGEIIQQPRYYEYIALLAPPGQQGTYMGFAFLPIGIGSLIGGWFGGTLMHHFGEVTHQPALMWWVVTGVGVATTALLWIYDRAFRTPSAHQAN

Samples

Sample ID Description Type Environment
1 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 1.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.54
Rhizosphere 93.83
Stem 0
Stem Tuber 0
Unclassified 14.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224571_100014 3300022734 Bacteria 5135
2 MBSR1b_contig_6600482 2162886012 Bacteria 1921
3 Ga0058862_10029412 3300004803 Bacteria 1793
4 Ga0070658_10092204 3300005327 Bacteria 2498
5 Ga0070676_10028309 3300005328 Bacteria 3182
6 Ga0070676_10059762 3300005328 Bacteria 2261
7 Ga0070683_100013744 3300005329 Bacteria 7067
8 Ga0070683_100135090 3300005329 Bacteria 2335
9 Ga0070683_100142706 3300005329 Bacteria 2269
10 Ga0070690_100074547 3300005330 Bacteria 2210
11 Ga0070670_100126791 3300005331 Bacteria 2203
12 Ga0070677_10025424 3300005333 Bacteria 2210
13 Ga0068869_100000935 3300005334 Bacteria 16859
14 Ga0068869_100026102 3300005334 Bacteria 4064
15 Ga0068869_100049617 3300005334 Bacteria 3039
16 Ga0070666_10017700 3300005335 Unclassified 4572
17 Ga0070680_100032705 3300005336 Unclassified 4187
18 Ga0070680_100042133 3300005336 Unclassified 3703
19 Ga0070682_100125805 3300005337 Bacteria 1727
20 Ga0068868_100009121 3300005338 Bacteria 7122
21 Ga0068868_100012948 3300005338 Bacteria 6102
22 Ga0068868_100020426 3300005338 Bacteria 4976
23 Ga0070660_100015331 3300005339 Bacteria 5531
24 Ga0070689_100026875 3300005340 Unclassified 4336
25 Ga0070687_100001840 3300005343 Bacteria 7678
26 Ga0070661_100049154 3300005344 Unclassified 3088
27 Ga0070668_100056334 3300005347 Unclassified 3036
28 Ga0070669_100005119 3300005353 Bacteria 9479
29 Ga0070669_100031734 3300005353 Bacteria 3816
30 Ga0070688_100035593 3300005365 Bacteria 3025
31 Ga0070659_100002666 3300005366 Bacteria 12691
32 Ga0070659_100097895 3300005366 Bacteria 2358
33 Ga0070667_100010780 3300005367 Bacteria 7552
34 Ga0070709_10000432 3300005434 Bacteria 25363
35 Ga0070709_10007570 3300005434 Bacteria 5959
36 Ga0070709_10028881 3300005434 Unclassified 3311
37 Ga0070709_10054597 3300005434 Bacteria 2519
38 Ga0070709_10184898 3300005434 Unclassified 1466
39 Ga0070709_10215571 3300005434 Bacteria 1366
40 Ga0070714_100000075 3300005435 Bacteria 84982
41 Ga0070714_100032486 3300005435 Unclassified 4356
42 Ga0070714_100032495 3300005435 Bacteria 4356
43 Ga0070714_100077341 3300005435 Unclassified 2890
44 Ga0070714_100148876 3300005435 Bacteria 2107
45 Ga0070713_100000134 3300005436 Bacteria 48639
46 Ga0070713_100000441 3300005436 Bacteria 26508
47 Ga0070713_100046738 3300005436 Bacteria 3553
48 Ga0070713_100058739 3300005436 Bacteria 3209
49 Ga0070713_100112660 3300005436 Unclassified 2374
50 Ga0070713_100145814 3300005436 Unclassified 2101
51 Ga0070713_100146976 3300005436 Bacteria 2093
52 Ga0070713_100280545 3300005436 Bacteria 1528
53 Ga0070710_10001549 3300005437 Bacteria 10861
54 Ga0070710_10007286 3300005437 Bacteria 5352
55 Ga0070710_10008124 3300005437 Bacteria 5102
56 Ga0070710_10048569 3300005437 Unclassified 2371
57 Ga0070711_100000271 3300005439 Bacteria 26787
58 Ga0070711_100012589 3300005439 Bacteria 5290
59 Ga0070711_100027595 3300005439 Bacteria 3729
60 Ga0070711_100030638 3300005439 Unclassified 3564
61 Ga0070711_100038547 3300005439 Bacteria 3214
62 Ga0070708_100000459 3300005445 Bacteria 30632
63 Ga0070708_100001910 3300005445 Bacteria 16037
64 Ga0070708_100029284 3300005445 Bacteria 4747
65 Ga0070708_100036062 3300005445 Bacteria 4312
66 Ga0070708_100072085 3300005445 Bacteria 3112
67 Ga0070708_100158898 3300005445 Bacteria 2105
68 Ga0070708_100193065 3300005445 Bacteria 1905
69 Ga0070663_100018203 3300005455 Unclassified 4599
70 Ga0070662_100002683 3300005457 Bacteria 10979
71 Ga0070662_100005317 3300005457 Bacteria 8223
72 Ga0070681_10004600 3300005458 Bacteria 13176
73 Ga0070681_10027456 3300005458 Bacteria 5723
74 Ga0070681_10093116 3300005458 Unclassified 2962
75 Ga0070681_10126523 3300005458 Bacteria 2488
76 Ga0070681_10129032 3300005458 Bacteria 2461
77 Ga0070681_10221003 3300005458 Bacteria 1809
78 Ga0070681_10283119 3300005458 Bacteria 1569
79 Ga0068867_100003854 3300005459 Bacteria 10546
80 Ga0068867_100020665 3300005459 Unclassified 4691
81 Ga0070685_10020596 3300005466 Bacteria 3569
82 Ga0070706_100000278 3300005467 Bacteria 62365
83 Ga0070706_100031452 3300005467 Bacteria 4894
84 Ga0070706_100061599 3300005467 Bacteria 3465
85 Ga0070706_100070466 3300005467 Unclassified 3233
86 Ga0070707_100008218 3300005468 Bacteria 9680
87 Ga0070707_100026653 3300005468 Bacteria 5489
88 Ga0070707_100078830 3300005468 Bacteria 3178
89 Ga0070707_100159976 3300005468 Bacteria 2194
90 Ga0070707_100312934 3300005468 Archaea 1526
91 Ga0070698_100002043 3300005471 Bacteria 22426
92 Ga0070698_100007041 3300005471 Bacteria 12181
93 Ga0070698_100029919 3300005471 Bacteria 5651
94 Ga0070698_100070558 3300005471 Bacteria 3506
95 Ga0070699_100000441 3300005518 Bacteria 39851
96 Ga0070699_100087375 3300005518 Bacteria 2721
97 Ga0070699_100090624 3300005518 Unclassified 2673
98 Ga0070699_100192804 3300005518 Bacteria 1811
99 Ga0070679_100065787 3300005530 Unclassified 3613
100 Ga0070679_100101783 3300005530 Bacteria 2859
101 Ga0070684_100009298 3300005535 Bacteria 7736
102 Ga0070684_100057935 3300005535 Bacteria 3383
103 Ga0070697_100000049 3300005536 Bacteria 90362
104 Ga0070697_100000158 3300005536 Bacteria 55228
105 Ga0070697_100000255 3300005536 Bacteria 43116
106 Ga0070697_100020869 3300005536 Bacteria 5186
107 Ga0070697_100025486 3300005536 Bacteria 4717
108 Ga0070697_100067951 3300005536 Bacteria 2916
109 Ga0070697_100075204 3300005536 Bacteria 2776
110 Ga0070697_100130609 3300005536 Unclassified 2106
111 Ga0068853_100006343 3300005539 Bacteria 9387
112 Ga0068853_100024017 3300005539 Bacteria 5109
113 Ga0068853_100131989 3300005539 Bacteria 2237
114 Ga0070686_100001440 3300005544 Bacteria 13445
115 Ga0070695_100031265 3300005545 Bacteria 3319
116 Ga0070693_100013310 3300005547 Bacteria 4188
117 Ga0070693_100022888 3300005547 Bacteria 3331
118 Ga0070665_100001184 3300005548 Bacteria 31842
119 Ga0070665_100111661 3300005548 Unclassified 2736
120 Ga0070704_100200551 3300005549 Bacteria 1610
121 Ga0068855_100023574 3300005563 Bacteria 7369
122 Ga0068855_100063779 3300005563 Bacteria 4299
123 Ga0068855_100064646 3300005563 Bacteria 4267
124 Ga0068855_100256081 3300005563 Bacteria 1951
125 Ga0068857_100029113 3300005577 Bacteria 4873
126 Ga0068857_100162113 3300005577 Bacteria 2029
127 Ga0068854_100004626 3300005578 Bacteria 8679
128 Ga0068856_100006581 3300005614 Bacteria 11389
129 Ga0068856_100012826 3300005614 Bacteria 8110
130 Ga0068852_100054256 3300005616 Bacteria 3454
131 Ga0068852_100093344 3300005616 Unclassified 2697
132 Ga0068852_100121186 3300005616 Bacteria 2395
133 Ga0068859_100155680 3300005617 Bacteria 2362
134 Ga0068864_100035795 3300005618 Unclassified 4228
135 Ga0068866_10012445 3300005718 Bacteria 3706
136 Ga0068866_10012708 3300005718 Unclassified 3674
137 Ga0068866_10039424 3300005718 Bacteria 2332
138 Ga0068861_100216970 3300005719 Bacteria 1614
139 Ga0068851_10015085 3300005834 Bacteria 3678
140 Ga0068863_100003308 3300005841 Bacteria 15910
141 Ga0068863_100063030 3300005841 Bacteria 3506
142 Ga0068863_100235969 3300005841 Bacteria 1765
143 Ga0068858_100001619 3300005842 Bacteria 22968
144 Ga0068858_100077679 3300005842 Unclassified 3084
145 Ga0068858_100107331 3300005842 Unclassified 2606
146 Ga0068860_100005894 3300005843 Bacteria 12335
147 Ga0068860_100010955 3300005843 Bacteria 8938
148 Ga0068860_100011500 3300005843 Bacteria 8721
149 Ga0068860_100096196 3300005843 Bacteria 2823
150 Ga0068860_100197613 3300005843 Unclassified 1948
151 Ga0068862_100036273 3300005844 Unclassified 4179
152 Ga0070717_10004359 3300006028 Bacteria 10210
153 Ga0070717_10008691 3300006028 Bacteria 7599
154 Ga0070717_10011648 3300006028 Bacteria 6688
155 Ga0070717_10018940 3300006028 Bacteria 5389
156 Ga0070717_10020604 3300006028 Bacteria 5189
157 Ga0070717_10070426 3300006028 Bacteria 2915
158 Ga0070717_10093264 3300006028 Bacteria 2545
159 Ga0070717_10159477 3300006028 Bacteria 1956
160 Ga0070717_10201833 3300006028 Bacteria 1742
161 Ga0070717_10241246 3300006028 Unclassified 1594
162 Ga0070715_10003006 3300006163 Bacteria 5274
163 Ga0070715_10034108 3300006163 Unclassified 2084
164 Ga0070716_100003540 3300006173 Bacteria 7367
165 Ga0070716_100014768 3300006173 Bacteria 4006
166 Ga0070716_100024729 3300006173 Unclassified 3199
167 Ga0070716_100030528 3300006173 Unclassified 2924
168 Ga0070716_100074399 3300006173 Bacteria 2007
169 Ga0070716_100094249 3300006173 Unclassified 1820
170 Ga0070712_100000262 3300006175 Bacteria 29465
171 Ga0070712_100000618 3300006175 Bacteria 20900
172 Ga0070712_100002390 3300006175 Bacteria 11557
173 Ga0070712_100011797 3300006175 Bacteria 5553
174 Ga0070712_100015567 3300006175 Bacteria 4904
175 Ga0070712_100037461 3300006175 Bacteria 3306
176 Ga0070712_100050259 3300006175 Unclassified 2899
177 Ga0070712_100074549 3300006175 Bacteria 2438
178 Ga0070712_100088831 3300006175 Bacteria 2259
179 Ga0070712_100111892 3300006175 Unclassified 2039
180 Ga0097621_100111033 3300006237 Unclassified 2316
181 Ga0068871_100023588 3300006358 Bacteria 4762
182 Ga0068871_100062569 3300006358 Bacteria 3042
183 Ga0068871_100108173 3300006358 Bacteria 2336
184 Ga0075434_100013249 3300006871 Bacteria 7837
185 Ga0075434_100033911 3300006871 Bacteria 5040
186 Ga0075434_100040099 3300006871 Bacteria 4639
187 Ga0075434_100135600 3300006871 Bacteria 2481
188 Ga0075434_100224787 3300006871 Unclassified 1897
189 Ga0068865_100008484 3300006881 Bacteria 6353
190 Ga0068865_100030977 3300006881 Bacteria 3562
191 Ga0075436_100000632 3300006914 Bacteria 23148
192 Ga0075436_100001168 3300006914 Bacteria 17785
193 Ga0075436_100003327 3300006914 Bacteria 11000
194 Ga0075436_100020618 3300006914 Bacteria 4524
195 Ga0075436_100046475 3300006914 Bacteria 2994
196 Ga0097620_100155686 3300006931 Bacteria 2362
197 Ga0075435_100006678 3300007076 Bacteria 8180
198 Ga0075435_100027339 3300007076 Bacteria 4461
199 Ga0075435_100038668 3300007076 Bacteria 3804
200 Ga0075435_100193104 3300007076 Bacteria 1724
201 Ga0099794_10005936 3300007265 Unclassified 4924
202 Ga0099794_10013289 3300007265 Bacteria 3579
203 Ga0099794_10015550 3300007265 Bacteria 3362
204 Ga0099794_10081936 3300007265 Bacteria 1592
205 Ga0099794_10097824 3300007265 Bacteria 1462
206 Ga0099795_10021037 3300007788 Bacteria 2134
207 Ga0099795_10039567 3300007788 Bacteria 1670
208 Ga0105240_10017855 3300009093 Bacteria 9546
209 Ga0105240_10020123 3300009093 Bacteria 8909
210 Ga0105240_10029292 3300009093 Bacteria 7176
211 Ga0105240_10145825 3300009093 Unclassified 2825
212 Ga0105240_10157882 3300009093 Bacteria 2696
213 Ga0105245_10002858 3300009098 Bacteria 15509
214 Ga0105245_10054629 3300009098 Unclassified 3587
215 Ga0105245_10247875 3300009098 Bacteria 1729
216 Ga0105247_10006341 3300009101 Bacteria 7329
217 Ga0105247_10009761 3300009101 Bacteria 5821
218 Ga0105247_10131512 3300009101 Bacteria 1631
219 Ga0105241_10087298 3300009174 Bacteria 2455
220 Ga0105241_10087737 3300009174 Bacteria 2449
221 Ga0105242_10009165 3300009176 Bacteria 7598
222 Ga0105242_10034601 3300009176 Bacteria 4050
223 Ga0105242_10078515 3300009176 Bacteria 2756
224 Ga0105242_10142758 3300009176 Bacteria 2080
225 Ga0105248_10021967 3300009177 Bacteria 7071
226 Ga0105248_10387720 3300009177 Unclassified 1573
227 Ga0105237_10136586 3300009545 Bacteria 2446
228 Ga0105237_10155354 3300009545 Bacteria 2284
229 Ga0105237_10177762 3300009545 Bacteria 2129
230 Ga0105238_10014582 3300009551 Bacteria 7945
231 Ga0105238_10023635 3300009551 Bacteria 6262
232 Ga0105238_10103944 3300009551 Bacteria 2822
233 Ga0105249_10039963 3300009553 Bacteria 4260
234 Ga0099796_10035747 3300010159 Bacteria 1650
235 Ga0105239_10014364 3300010375 Bacteria 8786
236 Ga0105246_10015894 3300011119 Bacteria 4760
237 Ga0157373_10002380 3300013100 Bacteria 14283
238 Ga0157373_10063187 3300013100 Bacteria 2622
239 Ga0157371_10002907 3300013102 Bacteria 16015
240 Ga0157370_10131759 3300013104 Bacteria 2332
241 Ga0157369_10005867 3300013105 Bacteria 14265
242 Ga0157369_10013005 3300013105 Bacteria 9428
243 Ga0157369_10021280 3300013105 Bacteria 7253
244 Ga0157369_10073293 3300013105 Bacteria 3674
245 Ga0157369_10143084 3300013105 Bacteria 2529
246 Ga0157369_10205114 3300013105 Bacteria 2068
247 Ga0157369_10217492 3300013105 Bacteria 2001
248 Ga0157369_10288130 3300013105 Bacteria 1710
249 Ga0157374_10003490 3300013296 Bacteria 13213
250 Ga0157374_10005580 3300013296 Bacteria 10593
251 Ga0157374_10012766 3300013296 Bacteria 7319
252 Ga0157374_10033534 3300013296 Bacteria 4685
253 Ga0157374_10048161 3300013296 Bacteria 3955
254 Ga0157374_10095665 3300013296 Bacteria 2840
255 Ga0157374_10125092 3300013296 Bacteria 2485
256 Ga0157374_10126963 3300013296 Bacteria 2466
257 Ga0157378_10001432 3300013297 Bacteria 21488
258 Ga0157378_10011278 3300013297 Bacteria 7821
259 Ga0157378_10024706 3300013297 Bacteria 5290
260 Ga0157378_10121664 3300013297 Bacteria 2406
261 Ga0163162_10002555 3300013306 Bacteria 17229
262 Ga0163162_10003471 3300013306 Bacteria 15061
263 Ga0163162_10004210 3300013306 Bacteria 13826
264 Ga0163162_10037123 3300013306 Unclassified 4860
265 Ga0157372_10004868 3300013307 Bacteria 14272
266 Ga0157372_10043120 3300013307 Unclassified 4993
267 Ga0157372_10145857 3300013307 Bacteria 2729
268 Ga0157372_10176167 3300013307 Bacteria 2475
269 Ga0157372_10401540 3300013307 Bacteria 1597
270 Ga0157375_10055998 3300013308 Bacteria 3890
271 Ga0157375_10078465 3300013308 Bacteria 3335
272 Ga0163163_10028700 3300014325 Bacteria 5347
273 Ga0163163_10030507 3300014325 Bacteria 5195
274 Ga0163163_10125763 3300014325 Bacteria 2601
275 Ga0163163_10151149 3300014325 Bacteria 2365
276 Ga0157380_10027507 3300014326 Unclassified 4325
277 Ga0157377_10001555 3300014745 Bacteria 9979
278 Ga0157379_10007009 3300014968 Bacteria 9742
279 Ga0157379_10038159 3300014968 Bacteria 4286
280 Ga0157379_10049299 3300014968 Bacteria 3759
281 Ga0157379_10067068 3300014968 Bacteria 3208
282 Ga0157379_10080052 3300014968 Bacteria 2926
283 Ga0157379_10107082 3300014968 Unclassified 2510
284 Ga0157379_10127365 3300014968 Bacteria 2291
285 Ga0157376_10000060 3300014969 Bacteria 95745
286 Ga0157376_10000154 3300014969 Bacteria 47198
287 Ga0157376_10024032 3300014969 Unclassified 4779
288 Ga0163161_10007569 3300017792 Bacteria 7509
289 Ga0213872_10006456 3300021361 Bacteria 5877
290 Ga0213876_10092448 3300021384 Bacteria 1602
291 Ga0228598_1000403 3300024227 Bacteria 8753
292 Ga0228598_1002843 3300024227 Bacteria 3756
293 Ga0228598_1003621 3300024227 Unclassified 3314
294 Ga0207656_10049859 3300025321 Bacteria 1806
295 Ga0207682_10004106 3300025893 Bacteria 6177
296 Ga0207692_10002000 3300025898 Bacteria 7789
297 Ga0207692_10005103 3300025898 Bacteria 5235
298 Ga0207692_10095450 3300025898 Archaea 1621
299 Ga0207680_10094479 3300025903 Bacteria 1909
300 Ga0207680_10103310 3300025903 Bacteria 1835
301 Ga0207647_10002672 3300025904 Bacteria 13456
302 Ga0207647_10002874 3300025904 Bacteria 12974
303 Ga0207685_10003971 3300025905 Bacteria 3683
304 Ga0207699_10000209 3300025906 Bacteria 34945
305 Ga0207699_10059706 3300025906 Unclassified 2287
306 Ga0207699_10064871 3300025906 Bacteria 2211
307 Ga0207699_10117264 3300025906 Bacteria 1716
308 Ga0207645_10001560 3300025907 Bacteria 18746
309 Ga0207643_10000639 3300025908 Bacteria 21958
310 Ga0207705_10112220 3300025909 Bacteria 2015
311 Ga0207684_10001907 3300025910 Bacteria 21656
312 Ga0207684_10011025 3300025910 Archaea 7921
313 Ga0207684_10051684 3300025910 Bacteria 3487
314 Ga0207684_10058463 3300025910 Bacteria 3272
315 Ga0207684_10075525 3300025910 Unclassified 2864
316 Ga0207684_10233032 3300025910 Bacteria 1589
317 Ga0207654_10084445 3300025911 Bacteria 1920
318 Ga0207707_10003911 3300025912 Bacteria 13216
319 Ga0207707_10034516 3300025912 Bacteria 4426
320 Ga0207707_10036898 3300025912 Bacteria 4271
321 Ga0207707_10049869 3300025912 Bacteria 3647
322 Ga0207707_10100252 3300025912 Unclassified 2531
323 Ga0207707_10109175 3300025912 Bacteria 2419
324 Ga0207695_10022649 3300025913 Bacteria 7122
325 Ga0207695_10063591 3300025913 Bacteria 3804
326 Ga0207671_10106037 3300025914 Bacteria 2133
327 Ga0207693_10000026 3300025915 Bacteria 122717
328 Ga0207693_10000275 3300025915 Bacteria 47590
329 Ga0207693_10008118 3300025915 Bacteria 8605
330 Ga0207693_10010071 3300025915 Bacteria 7680
331 Ga0207693_10012507 3300025915 Bacteria 6855
332 Ga0207693_10018551 3300025915 Bacteria 5539
333 Ga0207693_10035572 3300025915 Bacteria 3925
334 Ga0207693_10041776 3300025915 Bacteria 3610
335 Ga0207693_10087737 3300025915 Bacteria 2438
336 Ga0207693_10092417 3300025915 Bacteria 2371
337 Ga0207693_10105397 3300025915 Bacteria 2211
338 Ga0207663_10001653 3300025916 Bacteria 10502
339 Ga0207663_10004323 3300025916 Bacteria 7053
340 Ga0207663_10004728 3300025916 Bacteria 6803
341 Ga0207663_10038407 3300025916 Bacteria 2894
342 Ga0207663_10048374 3300025916 Unclassified 2632
343 Ga0207660_10034823 3300025917 Unclassified 3492
344 Ga0207660_10138298 3300025917 Bacteria 1860
345 Ga0207662_10003901 3300025918 Bacteria 7770
346 Ga0207657_10001261 3300025919 Bacteria 27065
347 Ga0207657_10002326 3300025919 Bacteria 20596
348 Ga0207649_10001661 3300025920 Bacteria 12866
349 Ga0207649_10139622 3300025920 Bacteria 1656
350 Ga0207652_10025153 3300025921 Bacteria 4947
351 Ga0207652_10087659 3300025921 Bacteria 2730
352 Ga0207646_10000042 3300025922 Bacteria 186121
353 Ga0207646_10002334 3300025922 Bacteria 22461
354 Ga0207646_10013181 3300025922 Bacteria 7914
355 Ga0207646_10158854 3300025922 Unclassified 2040
356 Ga0207646_10222927 3300025922 Unclassified 1703
357 Ga0207681_10150981 3300025923 Bacteria 1741
358 Ga0207694_10053209 3300025924 Bacteria 3138
359 Ga0207650_10000177 3300025925 Bacteria 75244
360 Ga0207659_10071638 3300025926 Bacteria 2531
361 Ga0207687_10003150 3300025927 Bacteria 11190
362 Ga0207687_10016050 3300025927 Unclassified 4915
363 Ga0207687_10101419 3300025927 Bacteria 2119
364 Ga0207700_10000111 3300025928 Bacteria 48784
365 Ga0207700_10002704 3300025928 Bacteria 10219
366 Ga0207700_10006979 3300025928 Bacteria 6872
367 Ga0207700_10035827 3300025928 Bacteria 3578
368 Ga0207700_10054363 3300025928 Unclassified 3005
369 Ga0207700_10120951 3300025928 Unclassified 2123
370 Ga0207700_10219282 3300025928 Bacteria 1612
371 Ga0207664_10000096 3300025929 Bacteria 81164
372 Ga0207664_10043578 3300025929 Bacteria 3510
373 Ga0207664_10065633 3300025929 Bacteria 2906
374 Ga0207706_10002495 3300025933 Bacteria 17927
375 Ga0207706_10017718 3300025933 Bacteria 6416
376 Ga0207686_10019667 3300025934 Unclassified 3845
377 Ga0207709_10184486 3300025935 Bacteria 1476
378 Ga0207670_10011311 3300025936 Bacteria 5174
379 Ga0207665_10000020 3300025939 Bacteria 117316
380 Ga0207665_10000358 3300025939 Bacteria 31676
381 Ga0207665_10012284 3300025939 Bacteria 5623
382 Ga0207665_10016555 3300025939 Unclassified 4844
383 Ga0207665_10028100 3300025939 Unclassified 3714
384 Ga0207665_10029162 3300025939 Bacteria 3649
385 Ga0207665_10039690 3300025939 Bacteria 3139
386 Ga0207665_10048698 3300025939 Bacteria 2846
387 Ga0207665_10081144 3300025939 Bacteria 2232
388 Ga0207665_10110240 3300025939 Unclassified 1933
389 Ga0207665_10229505 3300025939 Unclassified 1364
390 Ga0207691_10001447 3300025940 Bacteria 23651
391 Ga0207689_10000542 3300025942 Bacteria 35861
392 Ga0207689_10002307 3300025942 Bacteria 17863
393 Ga0207689_10011534 3300025942 Bacteria 7570
394 Ga0207661_10016213 3300025944 Bacteria 5494
395 Ga0207661_10049526 3300025944 Bacteria 3344
396 Ga0207661_10232048 3300025944 Unclassified 1634
397 Ga0207661_10265781 3300025944 Bacteria 1529
398 Ga0207679_10000143 3300025945 Bacteria 59141
399 Ga0207679_10067368 3300025945 Bacteria 2686
400 Ga0207667_10187775 3300025949 Bacteria 2121
401 Ga0207667_10212799 3300025949 Bacteria 1981
402 Ga0207651_10043637 3300025960 Bacteria 2994
403 Ga0207712_10076292 3300025961 Bacteria 2426
404 Ga0207712_10079437 3300025961 Bacteria 2383
405 Ga0207668_10013931 3300025972 Bacteria 4967
406 Ga0207668_10059933 3300025972 Bacteria 2669
407 Ga0207640_10055679 3300025981 Bacteria 2592
408 Ga0207640_10142511 3300025981 Bacteria 1749
409 Ga0207658_10048547 3300025986 Bacteria 3113
410 Ga0207658_10089359 3300025986 Bacteria 2384
411 Ga0207677_10002399 3300026023 Bacteria 9824
412 Ga0207703_10010977 3300026035 Bacteria 7058
413 Ga0207703_10123555 3300026035 Bacteria 2225
414 Ga0207639_10017818 3300026041 Bacteria 5037
415 Ga0207639_10059580 3300026041 Bacteria 2941
416 Ga0207639_10101562 3300026041 Bacteria 2326
417 Ga0207639_10256880 3300026041 Bacteria 1526
418 Ga0207678_10001668 3300026067 Bacteria 20376
419 Ga0207678_10006402 3300026067 Bacteria 10457
420 Ga0207702_10009550 3300026078 Bacteria 8143
421 Ga0207702_10039405 3300026078 Unclassified 3958
422 Ga0207702_10071365 3300026078 Bacteria 2990
423 Ga0207702_10077565 3300026078 Bacteria 2874
424 Ga0207641_10003028 3300026088 Bacteria 15142
425 Ga0207641_10006073 3300026088 Bacteria 10224
426 Ga0207641_10048986 3300026088 Bacteria 3569
427 Ga0207648_10003472 3300026089 Bacteria 16526
428 Ga0207676_10001159 3300026095 Bacteria 19817
429 Ga0207676_10168672 3300026095 Bacteria 1905
430 Ga0207674_10000195 3300026116 Bacteria 75067
431 Ga0207674_10014217 3300026116 Bacteria 8795
432 Ga0207675_100047635 3300026118 Bacteria 4001
433 Ga0207683_10003688 3300026121 Bacteria 13306
434 Ga0207683_10061772 3300026121 Bacteria 3298
435 Ga0207698_10027346 3300026142 Bacteria 4048
436 Ga0207698_10136980 3300026142 Bacteria 2102
437 Ga0265356_1000478 3300028017 Bacteria 7213
438 Ga0265356_1002736 3300028017 Bacteria 2290
439 Ga0268266_10000194 3300028379 Bacteria 106020
440 Ga0268266_10003235 3300028379 Bacteria 16447
441 Ga0268266_10154680 3300028379 Bacteria 2070
442 Ga0268264_10020572 3300028381 Bacteria 5392
443 Ga0268264_10057514 3300028381 Bacteria 3253
444 Ga0268264_10112259 3300028381 Bacteria 2389
445 Ga0268264_10184935 3300028381 Unclassified 1895
446 Ga0268264_10214426 3300028381 Bacteria 1769
447 Ga0265326_10020463 3300028558 Bacteria 1897
448 Ga0265338_10027722 3300028800 Bacteria 5675
449 Ga0265338_10041379 3300028800 Bacteria 4310
450 Ga0265338_10047557 3300028800 Bacteria 3917
451 Ga0265338_10179151 3300028800 Bacteria 1618
452 Ga0265762_1000047 3300030760 Bacteria 14791
453 Ga0265762_1000119 3300030760 Bacteria 11713
454 Ga0265762_1007590 3300030760 Bacteria 1933
455 Ga0265770_1001698 3300030878 Bacteria 3019
456 Ga0265770_1003739 3300030878 Unclassified 2070
457 Ga0265760_10000006 3300031090 Bacteria 143747
458 Ga0265760_10015758 3300031090 Bacteria 2168
459 Ga0265760_10017220 3300031090 Bacteria 2075
460 Ga0265325_10006235 3300031241 Bacteria 7269
461 Ga0265325_10085767 3300031241 Bacteria 1559
462 Ga0265340_10019054 3300031247 Bacteria 3534
463 Ga0265339_10072670 3300031249 Unclassified 1830
464 Ga0265331_10008178 3300031250 Bacteria 5969
465 Ga0265327_10000801 3300031251 Bacteria 48098
466 Ga0265316_10001555 3300031344 Bacteria 24601
467 Ga0265316_10014157 3300031344 Bacteria 7036
468 Ga0265316_10016458 3300031344 Bacteria 6412
469 Ga0265314_10009668 3300031711 Bacteria 8120
470 Ga0265314_10057306 3300031711 Bacteria 2677
471 Ga0265314_10082068 3300031711 Bacteria 2122
472 Ga0265342_10087103 3300031712 Bacteria 1795
473 Ga0373926_0001253 3300035083 Bacteria 7641
474 Ga0373926_0005769 3300035083 Bacteria 4091
475 Ga0373934_0007225 3300035086 Bacteria 4118
476 Ga0373923_0014936 3300035111 Bacteria 2924
477 Ga0373923_0026671 3300035111 Archaea 2300
478 Ga0373936_0014158 3300035113 Unclassified 3047
479 Ga0373945_0003349 3300035116 Bacteria 5036
480 Ga0373945_0003464 3300035116 Bacteria 4965
481 Ga0373945_0014544 3300035116 Bacteria 2639
482 Ga0373956_0000898 3300035119 Bacteria 12321
483 Ga0373943_0000047 3300035170 Bacteria 41181
484 Ga0373943_0001571 3300035170 Bacteria 10341
485 Ga0373943_0069904 3300035170 Bacteria 1775
486 Ga0373946_0001421 3300035171 Bacteria 8312
487 Ga0373946_0072149 3300035171 Bacteria 1494
488 Ga0373924_0001025 3300035410 Bacteria 8883
489 Ga0373931_0038058 3300035691 Unclassified 2515
490 Ga0373931_0043121 3300035691 Unclassified 2374
491 Ga0373935_0000841 3300035692 Bacteria 16552
492 Ga0373935_0001333 3300035692 Bacteria 13657
493 Ga0373935_0009893 3300035692 Bacteria 5714
494 Ga0373927_0000034 3300035695 Bacteria 103921
495 Ga0373927_0010614 3300035695 Bacteria 6138
496 Ga0373933_0004058 3300035724 Bacteria 8069
497 Ga0373933_0010271 3300035724 Bacteria 5129
498 Ga0373933_0012118 3300035724 Bacteria 4761
499 Ga0373947_0000112 3300035725 Bacteria 40758
500 Ga0373947_0020408 3300035725 Bacteria 3825
501 Ga0373947_0026776 3300035725 Unclassified 3372
502 Ga0373937_0000801 3300036401 Bacteria 26884
503 Ga0373937_0004814 3300036401 Bacteria 11472
504 Ga0373937_0008521 3300036401 Bacteria 8907
505 Ga0373937_0232728 3300036401 Bacteria 1735
506 Ga0373937_0269047 3300036401 Bacteria 1608
507 Ga0373925_0000615 3300037068 Bacteria 33997
508 Ga0373925_0000770 3300037068 Bacteria 29427
509 Ga0373925_0008172 3300037068 Bacteria 7620
510 Ga0373925_0008202 3300037068 Bacteria 7604
511 Ga0373925_0027423 3300037068 Unclassified 4169
512 Ga0373925_0042863 3300037068 Bacteria 3357
513 Ga0373925_0049570 3300037068 Bacteria 3130
514 Ga0373925_0072848 3300037068 Unclassified 2599
515 Ga0373925_0109757 3300037068 Unclassified 2130
516 Ga0373925_0142907 3300037068 Bacteria 1874
517 Ga0373925_0176058 3300037068 Unclassified 1691
518 Ga0373925_0290066 3300037068 Unclassified 1319
519 Ga0395898_0018272 3300037466 Bacteria 7150
520 Ga0395898_0282347 3300037466 Bacteria 1584
521 Ga0395905_0072185 3300037471 Bacteria 3236
522 Ga0395901_0360945 3300038443 Bacteria 1498
523 Ga0436365_0541927 3300039437 Bacteria 5957
524 Ga0436361_0671371 3300039447 Bacteria 40185
525 Ga0436363_0232543 3300039450 Bacteria 5862
526 Ga0436363_1571670 3300039450 Bacteria 6055
527 Ga0451577_0008203 3300042876 Bacteria 10184
528 Ga0451577_0022527 3300042876 Bacteria 5752
529 Ga0451577_0078811 3300042876 Bacteria 2937
530 Ga0451577_0095466 3300042876 Bacteria 2655
531 Ga0453683_0008711 3300044673 Bacteria 6802
532 Ga0453683_0031579 3300044673 Bacteria 3345
533 Ga0453683_0039709 3300044673 Bacteria 2957
534 Ga0453684_0006236 3300044712 Bacteria 22854
535 Ga0453684_0039454 3300044712 Bacteria 6434
536 Ga0453684_0064097 3300044712 Bacteria 4696
537 Ga0453684_0163525 3300044712 Unclassified 2630
538 Ga0453684_0274253 3300044712 Bacteria 1926
539 Ga0451576_0011143 3300045051 Bacteria 10254
540 Ga0466967_0002520 3300045976 Bacteria 11456
541 Ga0466967_0042223 3300045976 Bacteria 3939
542 Ga0466967_0057583 3300045976 Bacteria 3432
543 Ga0466967_0062899 3300045976 Unclassified 3296
544 Ga0466967_0143594 3300045976 Bacteria 2225
545 Ga0495603_0115012 3300046455 Unclassified 1569
546 Ga0495629_0018762 3300046459 Bacteria 4945
547 Ga0495629_0047912 3300046459 Bacteria 2997
548 Ga0495641_0046734 3300046461 Unclassified 1990
549 Ga0495651_0029697 3300046462 Unclassified 4263
550 Ga0495651_0083865 3300046462 Unclassified 2402
551 Ga0495653_0123776 3300046463 Archaea 1839
552 Ga0495580_0000345 3300046472 Bacteria 37884
553 Ga0495580_0001544 3300046472 Bacteria 20251
554 Ga0495580_0002140 3300046472 Bacteria 17326
555 Ga0495580_0012747 3300046472 Bacteria 6443
556 Ga0495580_0033283 3300046472 Bacteria 3715
557 Ga0495580_0050704 3300046472 Bacteria 2934
558 Ga0495580_0052874 3300046472 Bacteria 2868
559 Ga0495580_0139575 3300046472 Bacteria 1680
560 Ga0495582_0001976 3300046473 Bacteria 11502
561 Ga0495582_0003258 3300046473 Bacteria 9113
562 Ga0495582_0005708 3300046473 Bacteria 6931
563 Ga0495639_0009310 3300046475 Bacteria 4212
564 Ga0495639_0073368 3300046475 Unclassified 1584
565 Ga0495664_0005776 3300046477 Bacteria 6810
566 Ga0495664_0054062 3300046477 Unclassified 2388
567 Ga0495628_0076037 3300046516 Bacteria 2614
568 Ga0495630_0039171 3300046517 Bacteria 3545
569 Ga0495630_0059342 3300046517 Unclassified 2870
570 Ga0495640_0037664 3300046533 Unclassified 3410
571 Ga0495587_0008808 3300046536 Bacteria 6475
572 Ga0495658_0007843 3300046683 Bacteria 5287
573 Ga0495658_0022720 3300046683 Bacteria 3321
574 Ga0495669_0007771 3300046684 Bacteria 4502
575 Ga0495669_0024759 3300046684 Bacteria 2614
576 Ga0495613_0029194 3300046689 Bacteria 4102
577 Ga0495581_0030762 3300047315 Unclassified 3110
578 Ga0495674_0034545 3300047319 Bacteria 4572
579 Ga0495684_0010706 3300047471 Bacteria 7093
580 Ga0495684_0032479 3300047471 Bacteria 4008
581 Ga0495593_0074986 3300047673 Unclassified 1754
582 Ga0495602_0008615 3300048088 Bacteria 10651
583 Ga0495602_0153439 3300048088 Bacteria 1807
584 Ga0496100_0071909 3300048903 Bacteria 2311
585 Ga0496100_0088097 3300048903 Bacteria 2112
586 Ga0496101_0096984 3300048904 Unclassified 2201
587 Ga0496102_0000786 3300048905 Bacteria 30824
588 Ga0496102_0030087 3300048905 Bacteria 4860
589 Ga0496102_0129353 3300048905 Bacteria 2362
590 Ga0496102_0241697 3300048905 Bacteria 1702
591 Ga0496103_0067068 3300048906 Bacteria 2240
592 Ga0496104_0020276 3300048907 Bacteria 6092
593 Ga0496104_0097601 3300048907 Bacteria 2813
594 Ga0496104_0105390 3300048907 Unclassified 2702
595 Ga0496104_0177537 3300048907 Bacteria 2040
596 Ga0496104_0269396 3300048907 Bacteria 1615
597 Ga0496105_0008491 3300048908 Bacteria 7980
598 Ga0496106_0051697 3300048909 Bacteria 3099
599 Ga0496106_0112716 3300048909 Bacteria 2119
600 Ga0496107_0048338 3300048910 Bacteria 3064
601 Ga0496108_0000689 3300048911 Bacteria 26147
602 Ga0496108_0013237 3300048911 Bacteria 6724
603 Ga0496109_0001300 3300048912 Bacteria 20670
604 Ga0496110_0042861 3300048913 Bacteria 3950
605 Ga0496112_0003512 3300048915 Bacteria 12990
606 Ga0496112_0006571 3300048915 Bacteria 10232
607 Ga0496112_0027881 3300048915 Bacteria 5448
608 Ga0496112_0072910 3300048915 Bacteria 3394
609 Ga0496112_0123724 3300048915 Bacteria 2557
610 Ga0496112_0154216 3300048915 Bacteria 2264
611 Ga0496112_0215374 3300048915 Bacteria 1877
612 Ga0496113_0003019 3300048916 Bacteria 9971
613 Ga0496113_0004283 3300048916 Bacteria 8742
614 Ga0496113_0183210 3300048916 Bacteria 1660
615 Ga0496114_0118460 3300048917 Bacteria 2275
616 Ga0496115_0013776 3300048918 Bacteria 6122
617 Ga0496115_0028335 3300048918 Bacteria 4389
618 Ga0496115_0076276 3300048918 Bacteria 2724
619 nmdc:mga0n895_12212_c1 3300050512 Bacteria 7696
620 nmdc:mga0n895_5082_c1 3300050512 Bacteria 10925
621 nmdc:mga0rr50_10128_c1 3300050513 Bacteria 5966
622 nmdc:mga0rr50_15526_c2 3300050513 Bacteria 3203
623 nmdc:mga0rr50_204897_c1 3300050513 Unclassified 1623
624 nmdc:mga08x19_24449_c1 3300050514 Bacteria 3755
625 nmdc:mga08x19_2646_c1 3300050514 Bacteria 10832
626 nmdc:mga08x19_81036_c1 3300050514 Bacteria 2131
627 nmdc:mga08x19_8256_c1 3300050514 Bacteria 6190
628 nmdc:mga08x19_83564_c1 3300050514 Unclassified 2099
629 nmdc:mga08x19_907_c1 3300050514 Bacteria 18738
630 nmdc:mga08x19_99414_c1 3300050514 Bacteria 1929
631 Ga0495601_0083602 3300053077 Bacteria 2050
632 Ga0495619_0187814 3300053085 Bacteria 1430
633 Ga0224571_100014
634 MBSR1b_contig_6600482
635 Ga0058862_10029412
636 Ga0070658_10092204
637 Ga0070676_10028309
638 Ga0070676_10059762
639 Ga0070683_100013744
640 Ga0070683_100135090
641 Ga0070683_100142706
642 Ga0070690_100074547
643 Ga0070670_100126791
644 Ga0070677_10025424
645 Ga0068869_100000935
646 Ga0068869_100026102
647 Ga0068869_100049617
648 Ga0070666_10017700
649 Ga0070680_100032705
650 Ga0070680_100042133
651 Ga0070682_100125805
652 Ga0068868_100009121
653 Ga0068868_100012948
654 Ga0068868_100020426
655 Ga0070660_100015331
656 Ga0070689_100026875
657 Ga0070687_100001840
658 Ga0070661_100049154
659 Ga0070668_100056334
660 Ga0070669_100005119
661 Ga0070669_100031734
662 Ga0070688_100035593
663 Ga0070659_100002666
664 Ga0070659_100097895
665 Ga0070667_100010780
666 Ga0070709_10000432
667 Ga0070709_10007570
668 Ga0070709_10028881
669 Ga0070709_10054597
670 Ga0070709_10184898
671 Ga0070709_10215571
672 Ga0070714_100000075
673 Ga0070714_100032486
674 Ga0070714_100032495
675 Ga0070714_100077341
676 Ga0070714_100148876
677 Ga0070713_100000134
678 Ga0070713_100000441
679 Ga0070713_100046738
680 Ga0070713_100058739
681 Ga0070713_100112660
682 Ga0070713_100145814
683 Ga0070713_100146976
684 Ga0070713_100280545
685 Ga0070710_10001549
686 Ga0070710_10007286
687 Ga0070710_10008124
688 Ga0070710_10048569
689 Ga0070711_100000271
690 Ga0070711_100012589
691 Ga0070711_100027595
692 Ga0070711_100030638
693 Ga0070711_100038547
694 Ga0070708_100000459
695 Ga0070708_100001910
696 Ga0070708_100029284
697 Ga0070708_100036062
698 Ga0070708_100072085
699 Ga0070708_100158898
700 Ga0070708_100193065
701 Ga0070663_100018203
702 Ga0070662_100002683
703 Ga0070662_100005317
704 Ga0070681_10004600
705 Ga0070681_10027456
706 Ga0070681_10093116
707 Ga0070681_10126523
708 Ga0070681_10129032
709 Ga0070681_10221003
710 Ga0070681_10283119
711 Ga0068867_100003854
712 Ga0068867_100020665
713 Ga0070685_10020596
714 Ga0070706_100000278
715 Ga0070706_100031452
716 Ga0070706_100061599
717 Ga0070706_100070466
718 Ga0070707_100008218
719 Ga0070707_100026653
720 Ga0070707_100078830
721 Ga0070707_100159976
722 Ga0070707_100312934
723 Ga0070698_100002043
724 Ga0070698_100007041
725 Ga0070698_100029919
726 Ga0070698_100070558
727 Ga0070699_100000441
728 Ga0070699_100087375
729 Ga0070699_100090624
730 Ga0070699_100192804
731 Ga0070679_100065787
732 Ga0070679_100101783
733 Ga0070684_100009298
734 Ga0070684_100057935
735 Ga0070697_100000049
736 Ga0070697_100000158
737 Ga0070697_100000255
738 Ga0070697_100020869
739 Ga0070697_100025486
740 Ga0070697_100067951
741 Ga0070697_100075204
742 Ga0070697_100130609
743 Ga0068853_100006343
744 Ga0068853_100024017
745 Ga0068853_100131989
746 Ga0070686_100001440
747 Ga0070695_100031265
748 Ga0070693_100013310
749 Ga0070693_100022888
750 Ga0070665_100001184
751 Ga0070665_100111661
752 Ga0070704_100200551
753 Ga0068855_100023574
754 Ga0068855_100063779
755 Ga0068855_100064646
756 Ga0068855_100256081
757 Ga0068857_100029113
758 Ga0068857_100162113
759 Ga0068854_100004626
760 Ga0068856_100006581
761 Ga0068856_100012826
762 Ga0068852_100054256
763 Ga0068852_100093344
764 Ga0068852_100121186
765 Ga0068859_100155680
766 Ga0068864_100035795
767 Ga0068866_10012445
768 Ga0068866_10012708
769 Ga0068866_10039424
770 Ga0068861_100216970
771 Ga0068851_10015085
772 Ga0068863_100003308
773 Ga0068863_100063030
774 Ga0068863_100235969
775 Ga0068858_100001619
776 Ga0068858_100077679
777 Ga0068858_100107331
778 Ga0068860_100005894
779 Ga0068860_100010955
780 Ga0068860_100011500
781 Ga0068860_100096196
782 Ga0068860_100197613
783 Ga0068862_100036273
784 Ga0070717_10004359
785 Ga0070717_10008691
786 Ga0070717_10011648
787 Ga0070717_10018940
788 Ga0070717_10020604
789 Ga0070717_10070426
790 Ga0070717_10093264
791 Ga0070717_10159477
792 Ga0070717_10201833
793 Ga0070717_10241246
794 Ga0070715_10003006
795 Ga0070715_10034108
796 Ga0070716_100003540
797 Ga0070716_100014768
798 Ga0070716_100024729
799 Ga0070716_100030528
800 Ga0070716_100074399
801 Ga0070716_100094249
802 Ga0070712_100000262
803 Ga0070712_100000618
804 Ga0070712_100002390
805 Ga0070712_100011797
806 Ga0070712_100015567
807 Ga0070712_100037461
808 Ga0070712_100050259
809 Ga0070712_100074549
810 Ga0070712_100088831
811 Ga0070712_100111892
812 Ga0097621_100111033
813 Ga0068871_100023588
814 Ga0068871_100062569
815 Ga0068871_100108173
816 Ga0075434_100013249
817 Ga0075434_100033911
818 Ga0075434_100040099
819 Ga0075434_100135600
820 Ga0075434_100224787
821 Ga0068865_100008484
822 Ga0068865_100030977
823 Ga0075436_100000632
824 Ga0075436_100001168
825 Ga0075436_100003327
826 Ga0075436_100020618
827 Ga0075436_100046475
828 Ga0097620_100155686
829 Ga0075435_100006678
830 Ga0075435_100027339
831 Ga0075435_100038668
832 Ga0075435_100193104
833 Ga0099794_10005936
834 Ga0099794_10013289
835 Ga0099794_10015550
836 Ga0099794_10081936
837 Ga0099794_10097824
838 Ga0099795_10021037
839 Ga0099795_10039567
840 Ga0105240_10017855
841 Ga0105240_10020123
842 Ga0105240_10029292
843 Ga0105240_10145825
844 Ga0105240_10157882
845 Ga0105245_10002858
846 Ga0105245_10054629
847 Ga0105245_10247875
848 Ga0105247_10006341
849 Ga0105247_10009761
850 Ga0105247_10131512
851 Ga0105241_10087298
852 Ga0105241_10087737
853 Ga0105242_10009165
854 Ga0105242_10034601
855 Ga0105242_10078515
856 Ga0105242_10142758
857 Ga0105248_10021967
858 Ga0105248_10387720
859 Ga0105237_10136586
860 Ga0105237_10155354
861 Ga0105237_10177762
862 Ga0105238_10014582
863 Ga0105238_10023635
864 Ga0105238_10103944
865 Ga0105249_10039963
866 Ga0099796_10035747
867 Ga0105239_10014364
868 Ga0105246_10015894
869 Ga0157373_10002380
870 Ga0157373_10063187
871 Ga0157371_10002907
872 Ga0157370_10131759
873 Ga0157369_10005867
874 Ga0157369_10013005
875 Ga0157369_10021280
876 Ga0157369_10073293
877 Ga0157369_10143084
878 Ga0157369_10205114
879 Ga0157369_10217492
880 Ga0157369_10288130
881 Ga0157374_10003490
882 Ga0157374_10005580
883 Ga0157374_10012766
884 Ga0157374_10033534
885 Ga0157374_10048161
886 Ga0157374_10095665
887 Ga0157374_10125092
888 Ga0157374_10126963
889 Ga0157378_10001432
890 Ga0157378_10011278
891 Ga0157378_10024706
892 Ga0157378_10121664
893 Ga0163162_10002555
894 Ga0163162_10003471
895 Ga0163162_10004210
896 Ga0163162_10037123
897 Ga0157372_10004868
898 Ga0157372_10043120
899 Ga0157372_10145857
900 Ga0157372_10176167
901 Ga0157372_10401540
902 Ga0157375_10055998
903 Ga0157375_10078465
904 Ga0163163_10028700
905 Ga0163163_10030507
906 Ga0163163_10125763
907 Ga0163163_10151149
908 Ga0157380_10027507
909 Ga0157377_10001555
910 Ga0157379_10007009
911 Ga0157379_10038159
912 Ga0157379_10049299
913 Ga0157379_10067068
914 Ga0157379_10080052
915 Ga0157379_10107082
916 Ga0157379_10127365
917 Ga0157376_10000060
918 Ga0157376_10000154
919 Ga0157376_10024032
920 Ga0163161_10007569
921 Ga0213872_10006456
922 Ga0213876_10092448
923 Ga0228598_1000403
924 Ga0228598_1002843
925 Ga0228598_1003621
926 Ga0207656_10049859
927 Ga0207682_10004106
928 Ga0207692_10002000
929 Ga0207692_10005103
930 Ga0207692_10095450
931 Ga0207680_10094479
932 Ga0207680_10103310
933 Ga0207647_10002672
934 Ga0207647_10002874
935 Ga0207685_10003971
936 Ga0207699_10000209
937 Ga0207699_10059706
938 Ga0207699_10064871
939 Ga0207699_10117264
940 Ga0207645_10001560
941 Ga0207643_10000639
942 Ga0207705_10112220
943 Ga0207684_10001907
944 Ga0207684_10011025
945 Ga0207684_10051684
946 Ga0207684_10058463
947 Ga0207684_10075525
948 Ga0207684_10233032
949 Ga0207654_10084445
950 Ga0207707_10003911
951 Ga0207707_10034516
952 Ga0207707_10036898
953 Ga0207707_10049869
954 Ga0207707_10100252
955 Ga0207707_10109175
956 Ga0207695_10022649
957 Ga0207695_10063591
958 Ga0207671_10106037
959 Ga0207693_10000026
960 Ga0207693_10000275
961 Ga0207693_10008118
962 Ga0207693_10010071
963 Ga0207693_10012507
964 Ga0207693_10018551
965 Ga0207693_10035572
966 Ga0207693_10041776
967 Ga0207693_10087737
968 Ga0207693_10092417
969 Ga0207693_10105397
970 Ga0207663_10001653
971 Ga0207663_10004323
972 Ga0207663_10004728
973 Ga0207663_10038407
974 Ga0207663_10048374
975 Ga0207660_10034823
976 Ga0207660_10138298
977 Ga0207662_10003901
978 Ga0207657_10001261
979 Ga0207657_10002326
980 Ga0207649_10001661
981 Ga0207649_10139622
982 Ga0207652_10025153
983 Ga0207652_10087659
984 Ga0207646_10000042
985 Ga0207646_10002334
986 Ga0207646_10013181
987 Ga0207646_10158854
988 Ga0207646_10222927
989 Ga0207681_10150981
990 Ga0207694_10053209
991 Ga0207650_10000177
992 Ga0207659_10071638
993 Ga0207687_10003150
994 Ga0207687_10016050
995 Ga0207687_10101419
996 Ga0207700_10000111
997 Ga0207700_10002704
998 Ga0207700_10006979
999 Ga0207700_10035827
1000 Ga0207700_10054363
1001 Ga0207700_10120951
1002 Ga0207700_10219282
1003 Ga0207664_10000096
1004 Ga0207664_10043578
1005 Ga0207664_10065633
1006 Ga0207706_10002495
1007 Ga0207706_10017718
1008 Ga0207686_10019667
1009 Ga0207709_10184486
1010 Ga0207670_10011311
1011 Ga0207665_10000020
1012 Ga0207665_10000358
1013 Ga0207665_10012284
1014 Ga0207665_10016555
1015 Ga0207665_10028100
1016 Ga0207665_10029162
1017 Ga0207665_10039690
1018 Ga0207665_10048698
1019 Ga0207665_10081144
1020 Ga0207665_10110240
1021 Ga0207665_10229505
1022 Ga0207691_10001447
1023 Ga0207689_10000542
1024 Ga0207689_10002307
1025 Ga0207689_10011534
1026 Ga0207661_10016213
1027 Ga0207661_10049526
1028 Ga0207661_10232048
1029 Ga0207661_10265781
1030 Ga0207679_10000143
1031 Ga0207679_10067368
1032 Ga0207667_10187775
1033 Ga0207667_10212799
1034 Ga0207651_10043637
1035 Ga0207712_10076292
1036 Ga0207712_10079437
1037 Ga0207668_10013931
1038 Ga0207668_10059933
1039 Ga0207640_10055679
1040 Ga0207640_10142511
1041 Ga0207658_10048547
1042 Ga0207658_10089359
1043 Ga0207677_10002399
1044 Ga0207703_10010977
1045 Ga0207703_10123555
1046 Ga0207639_10017818
1047 Ga0207639_10059580
1048 Ga0207639_10101562
1049 Ga0207639_10256880
1050 Ga0207678_10001668
1051 Ga0207678_10006402
1052 Ga0207702_10009550
1053 Ga0207702_10039405
1054 Ga0207702_10071365
1055 Ga0207702_10077565
1056 Ga0207641_10003028
1057 Ga0207641_10006073
1058 Ga0207641_10048986
1059 Ga0207648_10003472
1060 Ga0207676_10001159
1061 Ga0207676_10168672
1062 Ga0207674_10000195
1063 Ga0207674_10014217
1064 Ga0207675_100047635
1065 Ga0207683_10003688
1066 Ga0207683_10061772
1067 Ga0207698_10027346
1068 Ga0207698_10136980
1069 Ga0265356_1000478
1070 Ga0265356_1002736
1071 Ga0268266_10000194
1072 Ga0268266_10003235
1073 Ga0268266_10154680
1074 Ga0268264_10020572
1075 Ga0268264_10057514
1076 Ga0268264_10112259
1077 Ga0268264_10184935
1078 Ga0268264_10214426
1079 Ga0265326_10020463
1080 Ga0265338_10027722
1081 Ga0265338_10041379
1082 Ga0265338_10047557
1083 Ga0265338_10179151
1084 Ga0265762_1000047
1085 Ga0265762_1000119
1086 Ga0265762_1007590
1087 Ga0265770_1001698
1088 Ga0265770_1003739
1089 Ga0265760_10000006
1090 Ga0265760_10015758
1091 Ga0265760_10017220
1092 Ga0265325_10006235
1093 Ga0265325_10085767
1094 Ga0265340_10019054
1095 Ga0265339_10072670
1096 Ga0265331_10008178
1097 Ga0265327_10000801
1098 Ga0265316_10001555
1099 Ga0265316_10014157
1100 Ga0265316_10016458
1101 Ga0265314_10009668
1102 Ga0265314_10057306
1103 Ga0265314_10082068
1104 Ga0265342_10087103
1105 Ga0373926_0001253
1106 Ga0373926_0005769
1107 Ga0373934_0007225
1108 Ga0373923_0014936
1109 Ga0373923_0026671
1110 Ga0373936_0014158
1111 Ga0373945_0003349
1112 Ga0373945_0003464
1113 Ga0373945_0014544
1114 Ga0373956_0000898
1115 Ga0373943_0000047
1116 Ga0373943_0001571
1117 Ga0373943_0069904
1118 Ga0373946_0001421
1119 Ga0373946_0072149
1120 Ga0373924_0001025
1121 Ga0373931_0038058
1122 Ga0373931_0043121
1123 Ga0373935_0000841
1124 Ga0373935_0001333
1125 Ga0373935_0009893
1126 Ga0373927_0000034
1127 Ga0373927_0010614
1128 Ga0373933_0004058
1129 Ga0373933_0010271
1130 Ga0373933_0012118
1131 Ga0373947_0000112
1132 Ga0373947_0020408
1133 Ga0373947_0026776
1134 Ga0373937_0000801
1135 Ga0373937_0004814
1136 Ga0373937_0008521
1137 Ga0373937_0232728
1138 Ga0373937_0269047
1139 Ga0373925_0000615
1140 Ga0373925_0000770
1141 Ga0373925_0008172
1142 Ga0373925_0008202
1143 Ga0373925_0027423
1144 Ga0373925_0042863
1145 Ga0373925_0049570
1146 Ga0373925_0072848
1147 Ga0373925_0109757
1148 Ga0373925_0142907
1149 Ga0373925_0176058
1150 Ga0373925_0290066
1151 Ga0395898_0018272
1152 Ga0395898_0282347
1153 Ga0395905_0072185
1154 Ga0395901_0360945
1155 Ga0436365_0541927
1156 Ga0436361_0671371
1157 Ga0436363_0232543
1158 Ga0436363_1571670
1159 Ga0451577_0008203
1160 Ga0451577_0022527
1161 Ga0451577_0078811
1162 Ga0451577_0095466
1163 Ga0453683_0008711
1164 Ga0453683_0031579
1165 Ga0453683_0039709
1166 Ga0453684_0006236
1167 Ga0453684_0039454
1168 Ga0453684_0064097
1169 Ga0453684_0163525
1170 Ga0453684_0274253
1171 Ga0451576_0011143
1172 Ga0466967_0002520
1173 Ga0466967_0042223
1174 Ga0466967_0057583
1175 Ga0466967_0062899
1176 Ga0466967_0143594
1177 Ga0495603_0115012
1178 Ga0495629_0018762
1179 Ga0495629_0047912
1180 Ga0495641_0046734
1181 Ga0495651_0029697
1182 Ga0495651_0083865
1183 Ga0495653_0123776
1184 Ga0495580_0000345
1185 Ga0495580_0001544
1186 Ga0495580_0002140
1187 Ga0495580_0012747
1188 Ga0495580_0033283
1189 Ga0495580_0050704
1190 Ga0495580_0052874
1191 Ga0495580_0139575
1192 Ga0495582_0001976
1193 Ga0495582_0003258
1194 Ga0495582_0005708
1195 Ga0495639_0009310
1196 Ga0495639_0073368
1197 Ga0495664_0005776
1198 Ga0495664_0054062
1199 Ga0495628_0076037
1200 Ga0495630_0039171
1201 Ga0495630_0059342
1202 Ga0495640_0037664
1203 Ga0495587_0008808
1204 Ga0495658_0007843
1205 Ga0495658_0022720
1206 Ga0495669_0007771
1207 Ga0495669_0024759
1208 Ga0495613_0029194
1209 Ga0495581_0030762
1210 Ga0495674_0034545
1211 Ga0495684_0010706
1212 Ga0495684_0032479
1213 Ga0495593_0074986
1214 Ga0495602_0008615
1215 Ga0495602_0153439
1216 Ga0496100_0071909
1217 Ga0496100_0088097
1218 Ga0496101_0096984
1219 Ga0496102_0000786
1220 Ga0496102_0030087
1221 Ga0496102_0129353
1222 Ga0496102_0241697
1223 Ga0496103_0067068
1224 Ga0496104_0020276
1225 Ga0496104_0097601
1226 Ga0496104_0105390
1227 Ga0496104_0177537
1228 Ga0496104_0269396
1229 Ga0496105_0008491
1230 Ga0496106_0051697
1231 Ga0496106_0112716
1232 Ga0496107_0048338
1233 Ga0496108_0000689
1234 Ga0496108_0013237
1235 Ga0496109_0001300
1236 Ga0496110_0042861
1237 Ga0496112_0003512
1238 Ga0496112_0006571
1239 Ga0496112_0027881
1240 Ga0496112_0072910
1241 Ga0496112_0123724
1242 Ga0496112_0154216
1243 Ga0496112_0215374
1244 Ga0496113_0003019
1245 Ga0496113_0004283
1246 Ga0496113_0183210
1247 Ga0496114_0118460
1248 Ga0496115_0013776
1249 Ga0496115_0028335
1250 Ga0496115_0076276
1251 nmdc:mga0n895_12212_c1
1252 nmdc:mga0n895_5082_c1
1253 nmdc:mga0rr50_10128_c1
1254 nmdc:mga0rr50_15526_c2
1255 nmdc:mga0rr50_204897_c1
1256 nmdc:mga08x19_24449_c1
1257 nmdc:mga08x19_2646_c1
1258 nmdc:mga08x19_81036_c1
1259 nmdc:mga08x19_8256_c1
1260 nmdc:mga08x19_83564_c1
1261 nmdc:mga08x19_907_c1
1262 nmdc:mga08x19_99414_c1
1263 Ga0495601_0083602
1264 Ga0495619_0187814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

34

246

0.81

PF07690

MFS_1

Major Facilitator Superfamily

60

342

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8006 17 459
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.7888 15 456
4uvm-assembly1.cif.gz_A in meso crystal structure of the pot family transporter peptso 0.788 16 448
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.7875 17 459
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.7869 15 456
ID Description Score Start End Superfamily
af_P33026_213_392_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8949 16 197 1.20.1250.20
af_Q2G0C4_214_402_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8727 15 197 1.20.1250.20
af_P21503_200_377_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8727 16 206 1.20.1250.20
af_Q5RGT2_295_489_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8725 17 197 1.20.1250.20
af_P9WJW7_210_393_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8684 15 197 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7W1YCL7-F1-model_v4 MFS transporter 0.9728 303 454 GO:0016020
GO:0022857
AF-A0A2W0ATP0-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9679 1 455 GO:0016020
GO:0022857
AF-A0A2V9BMJ1-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9626 2 197 GO:0016020
GO:0022857
AF-A0A845TZZ3-F1-model_v4 Peptide MFS transporter 0.962 1 197 GO:0016020
GO:0022857
AF-A0A1Q6X9P4-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.959 1 457 GO:0016020
GO:0022857

Map