F470986
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 632 | 305 | 1264 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300006175|Ga0070712_101537571|Ga0070712_1015375712 |
| Length | 109 |
| Sequence | LQASRPGRIPGVSTTTPTRKPVRARPGDGSSDRPWQVVVLNDNHNTFEGVASALSTTLPDVGYEQGLRYADWIHRRGRAVVWSGNRERAEMYHERLVGFGLTMAPIQQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 178 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 179 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 180 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 181 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 182 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 184 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 185 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 186 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 187 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 188 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 189 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 190 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 290 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 303 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 305 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.95 |
| Nodule | 0 |
| Rhizoplane | 8.54 |
| Rhizosphere | 89.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070712_101537571 | 3300006175 | Unclassified | 582 |
| 2 | Ga0070658_10914199 | 3300005327 | Unclassified | 763 |
| 3 | Ga0070683_100070093 | 3300005329 | Bacteria | 3270 |
| 4 | Ga0070683_100446194 | 3300005329 | Bacteria | 1234 |
| 5 | Ga0070683_100915081 | 3300005329 | Bacteria | 841 |
| 6 | Ga0070690_100053254 | 3300005330 | Bacteria | 2589 |
| 7 | Ga0068869_101117487 | 3300005334 | Bacteria | 690 |
| 8 | Ga0070680_100781285 | 3300005336 | Bacteria | 823 |
| 9 | Ga0070682_100015627 | 3300005337 | Bacteria | 4401 |
| 10 | Ga0070682_100099321 | 3300005337 | Bacteria | 1918 |
| 11 | Ga0070682_100249453 | 3300005337 | Bacteria | 1279 |
| 12 | Ga0068868_101153365 | 3300005338 | Unclassified | 715 |
| 13 | Ga0068868_101254222 | 3300005338 | Unclassified | 687 |
| 14 | Ga0068868_102056419 | 3300005338 | Unclassified | 543 |
| 15 | Ga0070689_100181940 | 3300005340 | Bacteria | 1708 |
| 16 | Ga0070691_10685648 | 3300005341 | Bacteria | 614 |
| 17 | Ga0070669_101298932 | 3300005353 | Unclassified | 630 |
| 18 | Ga0070671_100221790 | 3300005355 | Bacteria | 1604 |
| 19 | Ga0070671_100954157 | 3300005355 | Bacteria | 750 |
| 20 | Ga0070671_101302674 | 3300005355 | Bacteria | 641 |
| 21 | Ga0070674_101126275 | 3300005356 | Unclassified | 694 |
| 22 | Ga0070673_101240670 | 3300005364 | Bacteria | 699 |
| 23 | Ga0070659_100011416 | 3300005366 | Bacteria | 6570 |
| 24 | Ga0070709_10378255 | 3300005434 | Bacteria | 1052 |
| 25 | Ga0070714_100025537 | 3300005435 | Bacteria | 4876 |
| 26 | Ga0070714_100026104 | 3300005435 | Bacteria | 4826 |
| 27 | Ga0070714_100091443 | 3300005435 | Bacteria | 2666 |
| 28 | Ga0070714_101094558 | 3300005435 | Bacteria | 776 |
| 29 | Ga0070713_102076329 | 3300005436 | Unclassified | 551 |
| 30 | Ga0070711_100086586 | 3300005439 | Bacteria | 2247 |
| 31 | Ga0070711_100658321 | 3300005439 | Unclassified | 879 |
| 32 | Ga0070705_100032102 | 3300005440 | Bacteria | 2914 |
| 33 | Ga0070705_100130208 | 3300005440 | Unclassified | 1640 |
| 34 | Ga0070705_101307985 | 3300005440 | Bacteria | 601 |
| 35 | Ga0070694_100059679 | 3300005444 | Bacteria | 2599 |
| 36 | Ga0070708_101887756 | 3300005445 | Bacteria | 554 |
| 37 | Ga0070678_100014559 | 3300005456 | Bacteria | 4969 |
| 38 | Ga0070678_100891293 | 3300005456 | Bacteria | 813 |
| 39 | Ga0070678_101114858 | 3300005456 | Bacteria | 729 |
| 40 | Ga0070681_10131888 | 3300005458 | Bacteria | 2431 |
| 41 | Ga0070681_11525564 | 3300005458 | Bacteria | 593 |
| 42 | Ga0068867_100246986 | 3300005459 | Bacteria | 1450 |
| 43 | Ga0068867_101401577 | 3300005459 | Bacteria | 648 |
| 44 | Ga0070685_10968139 | 3300005466 | Unclassified | 637 |
| 45 | Ga0070706_101496837 | 3300005467 | Unclassified | 617 |
| 46 | Ga0070707_101527298 | 3300005468 | Unclassified | 635 |
| 47 | Ga0070698_100100528 | 3300005471 | Bacteria | 2864 |
| 48 | Ga0070698_100642939 | 3300005471 | Bacteria | 1002 |
| 49 | Ga0070698_100782518 | 3300005471 | Bacteria | 898 |
| 50 | Ga0070698_101216834 | 3300005471 | Bacteria | 703 |
| 51 | Ga0070699_100484617 | 3300005518 | Bacteria | 1122 |
| 52 | Ga0070679_100033049 | 3300005530 | Bacteria | 5120 |
| 53 | Ga0070679_100959651 | 3300005530 | Bacteria | 799 |
| 54 | Ga0070684_101187815 | 3300005535 | Bacteria | 717 |
| 55 | Ga0070684_101266948 | 3300005535 | Unclassified | 694 |
| 56 | Ga0070697_100800286 | 3300005536 | Unclassified | 834 |
| 57 | Ga0068853_100410500 | 3300005539 | Bacteria | 1269 |
| 58 | Ga0068853_101369059 | 3300005539 | Bacteria | 684 |
| 59 | Ga0070686_101811503 | 3300005544 | Unclassified | 520 |
| 60 | Ga0070695_100649644 | 3300005545 | Bacteria | 833 |
| 61 | Ga0070693_100083132 | 3300005547 | Bacteria | 1913 |
| 62 | Ga0070693_100624525 | 3300005547 | Bacteria | 781 |
| 63 | Ga0070693_100648306 | 3300005547 | Unclassified | 768 |
| 64 | Ga0070693_100952386 | 3300005547 | Unclassified | 646 |
| 65 | Ga0070665_100220084 | 3300005548 | Bacteria | 1899 |
| 66 | Ga0070704_100338605 | 3300005549 | Bacteria | 1266 |
| 67 | Ga0068855_100009022 | 3300005563 | Bacteria | 12051 |
| 68 | Ga0070664_100526247 | 3300005564 | Bacteria | 1092 |
| 69 | Ga0070664_100708584 | 3300005564 | Bacteria | 938 |
| 70 | Ga0068857_100259826 | 3300005577 | Bacteria | 1593 |
| 71 | Ga0068857_101438845 | 3300005577 | Bacteria | 671 |
| 72 | Ga0068854_100062919 | 3300005578 | Bacteria | 2692 |
| 73 | Ga0068854_100098328 | 3300005578 | Bacteria | 2190 |
| 74 | Ga0068854_101037175 | 3300005578 | Bacteria | 728 |
| 75 | Ga0068856_100094384 | 3300005614 | Bacteria | 2978 |
| 76 | Ga0070702_100077472 | 3300005615 | Bacteria | 1982 |
| 77 | Ga0070702_100110118 | 3300005615 | Bacteria | 1706 |
| 78 | Ga0070702_100110184 | 3300005615 | Bacteria | 1706 |
| 79 | Ga0070702_100356808 | 3300005615 | Unclassified | 1032 |
| 80 | Ga0068852_100545223 | 3300005616 | Bacteria | 1159 |
| 81 | Ga0068852_100748112 | 3300005616 | Bacteria | 990 |
| 82 | Ga0068852_101009832 | 3300005616 | Bacteria | 851 |
| 83 | Ga0068859_100796532 | 3300005617 | Bacteria | 1033 |
| 84 | Ga0068864_100815796 | 3300005618 | Bacteria | 918 |
| 85 | Ga0068866_10025396 | 3300005718 | Bacteria | 2785 |
| 86 | Ga0068866_11255425 | 3300005718 | Unclassified | 537 |
| 87 | Ga0068861_100520013 | 3300005719 | Bacteria | 1079 |
| 88 | Ga0068851_10454090 | 3300005834 | Bacteria | 762 |
| 89 | Ga0068870_10358074 | 3300005840 | Bacteria | 938 |
| 90 | Ga0068870_10398738 | 3300005840 | Unclassified | 895 |
| 91 | Ga0068858_100788087 | 3300005842 | Unclassified | 927 |
| 92 | Ga0068858_101325349 | 3300005842 | Bacteria | 709 |
| 93 | Ga0068860_100370570 | 3300005843 | Unclassified | 1412 |
| 94 | Ga0081538_10000221 | 3300005981 | Bacteria | 64192 |
| 95 | Ga0081538_10004784 | 3300005981 | Bacteria | 12370 |
| 96 | Ga0081538_10019803 | 3300005981 | Bacteria | 4979 |
| 97 | Ga0081538_10032755 | 3300005981 | Bacteria | 3474 |
| 98 | Ga0081539_10002360 | 3300005985 | Bacteria | 27096 |
| 99 | Ga0070717_10450521 | 3300006028 | Unclassified | 1160 |
| 100 | Ga0070717_12098336 | 3300006028 | Bacteria | 509 |
| 101 | Ga0075368_10563616 | 3300006042 | Bacteria | 513 |
| 102 | Ga0075363_100104727 | 3300006048 | Bacteria | 1568 |
| 103 | Ga0075363_100316875 | 3300006048 | Bacteria | 907 |
| 104 | Ga0075432_10018806 | 3300006058 | Bacteria | 2358 |
| 105 | Ga0075432_10055332 | 3300006058 | Bacteria | 1405 |
| 106 | Ga0070715_10004326 | 3300006163 | Bacteria | 4641 |
| 107 | Ga0070716_100310276 | 3300006173 | Bacteria | 1101 |
| 108 | Ga0070716_100371692 | 3300006173 | Bacteria | 1019 |
| 109 | Ga0070712_100162474 | 3300006175 | Bacteria | 1726 |
| 110 | Ga0070712_101946650 | 3300006175 | Bacteria | 515 |
| 111 | Ga0097621_100203728 | 3300006237 | Bacteria | 1719 |
| 112 | Ga0097621_100297255 | 3300006237 | Bacteria | 1425 |
| 113 | Ga0068871_100003053 | 3300006358 | Bacteria | 11492 |
| 114 | Ga0068871_101704950 | 3300006358 | Unclassified | 598 |
| 115 | Ga0075431_100822078 | 3300006847 | Unclassified | 902 |
| 116 | Ga0075433_10109537 | 3300006852 | Bacteria | 2450 |
| 117 | Ga0075433_10243476 | 3300006852 | Bacteria | 1596 |
| 118 | Ga0075434_100004473 | 3300006871 | Bacteria | 12612 |
| 119 | Ga0075434_100311894 | 3300006871 | Bacteria | 1593 |
| 120 | Ga0068865_100700361 | 3300006881 | Archaea | 865 |
| 121 | Ga0075436_100010145 | 3300006914 | Bacteria | 6450 |
| 122 | Ga0075436_100017084 | 3300006914 | Bacteria | 4966 |
| 123 | Ga0097620_100796578 | 3300006931 | Bacteria | 1033 |
| 124 | Ga0075435_100000660 | 3300007076 | Bacteria | 21225 |
| 125 | Ga0075435_100068209 | 3300007076 | Bacteria | 2897 |
| 126 | Ga0075435_100265407 | 3300007076 | Bacteria | 1463 |
| 127 | Ga0105240_10015755 | 3300009093 | Bacteria | 10259 |
| 128 | Ga0105240_11919872 | 3300009093 | Bacteria | 616 |
| 129 | Ga0111539_10007815 | 3300009094 | Bacteria | 13653 |
| 130 | Ga0111539_10076408 | 3300009094 | Bacteria | 3943 |
| 131 | Ga0105245_10042601 | 3300009098 | Bacteria | 4051 |
| 132 | Ga0105245_10067016 | 3300009098 | Bacteria | 3251 |
| 133 | Ga0105245_10073253 | 3300009098 | Bacteria | 3114 |
| 134 | Ga0105245_11372997 | 3300009098 | Bacteria | 756 |
| 135 | Ga0105247_10010497 | 3300009101 | Bacteria | 5598 |
| 136 | Ga0105247_10910997 | 3300009101 | Unclassified | 680 |
| 137 | Ga0105247_11651727 | 3300009101 | Bacteria | 528 |
| 138 | Ga0114129_10003593 | 3300009147 | Bacteria | 21816 |
| 139 | Ga0114129_10005368 | 3300009147 | Bacteria | 18087 |
| 140 | Ga0114129_11876190 | 3300009147 | Unclassified | 727 |
| 141 | Ga0105243_10003201 | 3300009148 | Bacteria | 13406 |
| 142 | Ga0105243_10121387 | 3300009148 | Bacteria | 2203 |
| 143 | Ga0105243_10371174 | 3300009148 | Bacteria | 1320 |
| 144 | Ga0105243_11756236 | 3300009148 | Bacteria | 650 |
| 145 | Ga0105241_10070011 | 3300009174 | Bacteria | 2721 |
| 146 | Ga0105241_10555762 | 3300009174 | Unclassified | 1031 |
| 147 | Ga0105242_10877677 | 3300009176 | Bacteria | 895 |
| 148 | Ga0105248_10009991 | 3300009177 | Bacteria | 10447 |
| 149 | Ga0105248_11387424 | 3300009177 | Unclassified | 795 |
| 150 | Ga0105248_12260070 | 3300009177 | Unclassified | 619 |
| 151 | Ga0105238_10046683 | 3300009551 | Bacteria | 4369 |
| 152 | Ga0105238_10653240 | 3300009551 | Unclassified | 1062 |
| 153 | Ga0105238_12080785 | 3300009551 | Bacteria | 602 |
| 154 | Ga0105249_10696436 | 3300009553 | Bacteria | 1076 |
| 155 | Ga0105249_13364556 | 3300009553 | Unclassified | 515 |
| 156 | Ga0105239_10294886 | 3300010375 | Bacteria | 1826 |
| 157 | Ga0105246_10358597 | 3300011119 | Bacteria | 1197 |
| 158 | Ga0105246_10573209 | 3300011119 | Bacteria | 971 |
| 159 | Ga0157320_1005703 | 3300012481 | Bacteria | 839 |
| 160 | Ga0157373_11342264 | 3300013100 | Bacteria | 542 |
| 161 | Ga0157371_10235239 | 3300013102 | Unclassified | 1317 |
| 162 | Ga0157371_10975721 | 3300013102 | Bacteria | 645 |
| 163 | Ga0157369_10248357 | 3300013105 | Unclassified | 1858 |
| 164 | Ga0157369_10393398 | 3300013105 | Bacteria | 1438 |
| 165 | Ga0157378_10037121 | 3300013297 | Bacteria | 4315 |
| 166 | Ga0163162_11103661 | 3300013306 | Unclassified | 899 |
| 167 | Ga0157372_10629417 | 3300013307 | Bacteria | 1250 |
| 168 | Ga0157372_11455357 | 3300013307 | Bacteria | 789 |
| 169 | Ga0157372_12342189 | 3300013307 | Bacteria | 613 |
| 170 | Ga0157372_13430583 | 3300013307 | Unclassified | 504 |
| 171 | Ga0157375_10349169 | 3300013308 | Bacteria | 1645 |
| 172 | Ga0157375_10415626 | 3300013308 | Bacteria | 1511 |
| 173 | Ga0157375_13148358 | 3300013308 | Unclassified | 550 |
| 174 | Ga0163163_11606992 | 3300014325 | Unclassified | 711 |
| 175 | Ga0157380_10600552 | 3300014326 | Bacteria | 1089 |
| 176 | Ga0182008_10000361 | 3300014497 | Bacteria | 35414 |
| 177 | Ga0157377_10054903 | 3300014745 | Bacteria | 2257 |
| 178 | Ga0157377_11184551 | 3300014745 | Unclassified | 590 |
| 179 | Ga0157377_11198483 | 3300014745 | Unclassified | 588 |
| 180 | Ga0157379_10090223 | 3300014968 | Bacteria | 2750 |
| 181 | Ga0157379_10367048 | 3300014968 | Bacteria | 1320 |
| 182 | Ga0157379_10913177 | 3300014968 | Bacteria | 833 |
| 183 | Ga0157376_10032621 | 3300014969 | Bacteria | 4184 |
| 184 | Ga0157376_10920434 | 3300014969 | Unclassified | 893 |
| 185 | Ga0157376_10925038 | 3300014969 | Bacteria | 891 |
| 186 | Ga0163161_11390802 | 3300017792 | Bacteria | 613 |
| 187 | Ga0197907_11390726 | 3300020069 | Unclassified | 605 |
| 188 | Ga0206354_11622190 | 3300020081 | Bacteria | 948 |
| 189 | Ga0207656_10574744 | 3300025321 | Bacteria | 575 |
| 190 | Ga0207653_10133653 | 3300025885 | Bacteria | 902 |
| 191 | Ga0207642_10042546 | 3300025899 | Bacteria | 1997 |
| 192 | Ga0207642_10056177 | 3300025899 | Bacteria | 1805 |
| 193 | Ga0207642_10795967 | 3300025899 | Bacteria | 601 |
| 194 | Ga0207688_10422624 | 3300025901 | Bacteria | 828 |
| 195 | Ga0207680_10055573 | 3300025903 | Bacteria | 2386 |
| 196 | Ga0207699_10161912 | 3300025906 | Bacteria | 1490 |
| 197 | Ga0207699_10604724 | 3300025906 | Bacteria | 798 |
| 198 | Ga0207699_10624245 | 3300025906 | Bacteria | 786 |
| 199 | Ga0207643_10127125 | 3300025908 | Bacteria | 1514 |
| 200 | Ga0207643_10298093 | 3300025908 | Bacteria | 1003 |
| 201 | Ga0207654_10464120 | 3300025911 | Bacteria | 890 |
| 202 | Ga0207707_10084003 | 3300025912 | Bacteria | 2780 |
| 203 | Ga0207707_10682685 | 3300025912 | Bacteria | 863 |
| 204 | Ga0207695_10019579 | 3300025913 | Bacteria | 7788 |
| 205 | Ga0207671_10543537 | 3300025914 | Unclassified | 926 |
| 206 | Ga0207693_10081154 | 3300025915 | Bacteria | 2539 |
| 207 | Ga0207693_10979109 | 3300025915 | Bacteria | 647 |
| 208 | Ga0207663_11043109 | 3300025916 | Bacteria | 656 |
| 209 | Ga0207660_10678880 | 3300025917 | Bacteria | 840 |
| 210 | Ga0207660_10991148 | 3300025917 | Unclassified | 685 |
| 211 | Ga0207660_11175484 | 3300025917 | Bacteria | 624 |
| 212 | Ga0207662_10747641 | 3300025918 | Bacteria | 687 |
| 213 | Ga0207657_10177939 | 3300025919 | Bacteria | 1721 |
| 214 | Ga0207652_10020819 | 3300025921 | Bacteria | 5406 |
| 215 | Ga0207652_10468373 | 3300025921 | Bacteria | 1135 |
| 216 | Ga0207652_10834385 | 3300025921 | Bacteria | 817 |
| 217 | Ga0207646_10384721 | 3300025922 | Unclassified | 1267 |
| 218 | Ga0207646_10676874 | 3300025922 | Bacteria | 923 |
| 219 | Ga0207646_11292028 | 3300025922 | Unclassified | 637 |
| 220 | Ga0207694_10426371 | 3300025924 | Unclassified | 1105 |
| 221 | Ga0207694_10865037 | 3300025924 | Unclassified | 764 |
| 222 | Ga0207687_10055763 | 3300025927 | Bacteria | 2770 |
| 223 | Ga0207687_10554334 | 3300025927 | Unclassified | 965 |
| 224 | Ga0207664_10037798 | 3300025929 | Bacteria | 3739 |
| 225 | Ga0207664_10110506 | 3300025929 | Bacteria | 2285 |
| 226 | Ga0207664_10345922 | 3300025929 | Bacteria | 1315 |
| 227 | Ga0207644_10526483 | 3300025931 | Bacteria | 977 |
| 228 | Ga0207644_10625233 | 3300025931 | Bacteria | 895 |
| 229 | Ga0207706_10142570 | 3300025933 | Bacteria | 2108 |
| 230 | Ga0207686_10119821 | 3300025934 | Bacteria | 1789 |
| 231 | Ga0207686_11566826 | 3300025934 | Unclassified | 544 |
| 232 | Ga0207709_10010548 | 3300025935 | Bacteria | 5088 |
| 233 | Ga0207709_10161088 | 3300025935 | Archaea | 1565 |
| 234 | Ga0207709_10317336 | 3300025935 | Bacteria | 1165 |
| 235 | Ga0207670_10350117 | 3300025936 | Bacteria | 1169 |
| 236 | Ga0207669_10283982 | 3300025937 | Bacteria | 1250 |
| 237 | Ga0207669_11246475 | 3300025937 | Bacteria | 631 |
| 238 | Ga0207704_10881664 | 3300025938 | Unclassified | 751 |
| 239 | Ga0207704_11005072 | 3300025938 | Unclassified | 705 |
| 240 | Ga0207665_10228475 | 3300025939 | Bacteria | 1367 |
| 241 | Ga0207665_11008240 | 3300025939 | Unclassified | 662 |
| 242 | Ga0207711_10009223 | 3300025941 | Bacteria | 8239 |
| 243 | Ga0207661_10011570 | 3300025944 | Bacteria | 6400 |
| 244 | Ga0207661_10199002 | 3300025944 | Bacteria | 1760 |
| 245 | Ga0207679_10328132 | 3300025945 | Bacteria | 1327 |
| 246 | Ga0207679_10675732 | 3300025945 | Unclassified | 936 |
| 247 | Ga0207667_10132577 | 3300025949 | Bacteria | 2566 |
| 248 | Ga0207667_10408232 | 3300025949 | Bacteria | 1383 |
| 249 | Ga0207651_10345238 | 3300025960 | Bacteria | 1252 |
| 250 | Ga0207712_10783825 | 3300025961 | Bacteria | 837 |
| 251 | Ga0207640_10051691 | 3300025981 | Bacteria | 2673 |
| 252 | Ga0207640_10053201 | 3300025981 | Bacteria | 2642 |
| 253 | Ga0207640_10344961 | 3300025981 | Unclassified | 1194 |
| 254 | Ga0207677_10168990 | 3300026023 | Unclassified | 1708 |
| 255 | Ga0207677_10223622 | 3300026023 | Bacteria | 1511 |
| 256 | Ga0207677_10407783 | 3300026023 | Bacteria | 1154 |
| 257 | Ga0207677_11621192 | 3300026023 | Unclassified | 599 |
| 258 | Ga0207703_10726179 | 3300026035 | Unclassified | 945 |
| 259 | Ga0207703_10811220 | 3300026035 | Bacteria | 894 |
| 260 | Ga0207639_10822450 | 3300026041 | Unclassified | 866 |
| 261 | Ga0207639_11811982 | 3300026041 | Unclassified | 571 |
| 262 | Ga0207678_11108805 | 3300026067 | Unclassified | 701 |
| 263 | Ga0207708_10104712 | 3300026075 | Bacteria | 2192 |
| 264 | Ga0207702_10024617 | 3300026078 | Bacteria | 4996 |
| 265 | Ga0207702_10163196 | 3300026078 | Bacteria | 2036 |
| 266 | Ga0207702_10696649 | 3300026078 | Bacteria | 1001 |
| 267 | Ga0207648_10022889 | 3300026089 | Bacteria | 5604 |
| 268 | Ga0207648_11704906 | 3300026089 | Unclassified | 592 |
| 269 | Ga0207676_10284917 | 3300026095 | Bacteria | 1502 |
| 270 | Ga0207674_10032416 | 3300026116 | Bacteria | 5481 |
| 271 | Ga0207675_100206264 | 3300026118 | Bacteria | 1889 |
| 272 | Ga0207675_101541248 | 3300026118 | Bacteria | 685 |
| 273 | Ga0207683_10001018 | 3300026121 | Bacteria | 25542 |
| 274 | Ga0207683_10024729 | 3300026121 | Bacteria | 5175 |
| 275 | Ga0207683_11256825 | 3300026121 | Bacteria | 686 |
| 276 | Ga0207698_10167354 | 3300026142 | Bacteria | 1931 |
| 277 | Ga0207698_10607230 | 3300026142 | Bacteria | 1079 |
| 278 | Ga0207428_10250180 | 3300027907 | Bacteria | 1322 |
| 279 | Ga0207428_11083316 | 3300027907 | Bacteria | 561 |
| 280 | Ga0268266_11102337 | 3300028379 | Bacteria | 768 |
| 281 | Ga0268265_11701427 | 3300028380 | Bacteria | 637 |
| 282 | Ga0268264_10901705 | 3300028381 | Bacteria | 887 |
| 283 | Ga0265319_1018240 | 3300028563 | Bacteria | 2648 |
| 284 | Ga0265339_10186504 | 3300031249 | Bacteria | 1031 |
| 285 | Ga0265327_10113675 | 3300031251 | Unclassified | 1290 |
| 286 | Ga0265327_10182125 | 3300031251 | Bacteria | 960 |
| 287 | Ga0265327_10297070 | 3300031251 | Bacteria | 712 |
| 288 | Ga0307408_100304850 | 3300031548 | Bacteria | 1336 |
| 289 | Ga0307413_10389860 | 3300031824 | Bacteria | 1088 |
| 290 | Ga0307407_11343693 | 3300031903 | Bacteria | 562 |
| 291 | Ga0307412_10644694 | 3300031911 | Bacteria | 903 |
| 292 | Ga0307416_100706351 | 3300032002 | Bacteria | 1098 |
| 293 | Ga0373944_0096341 | 3300035089 | Unclassified | 995 |
| 294 | Ga0373956_0423083 | 3300035119 | Bacteria | 636 |
| 295 | Ga0373946_0111394 | 3300035171 | Unclassified | 1239 |
| 296 | Ga0373955_0477251 | 3300035172 | Bacteria | 761 |
| 297 | Ga0316574_0024404 | 3300035398 | Bacteria | 3618 |
| 298 | Ga0373935_0534905 | 3300035692 | Bacteria | 853 |
| 299 | Ga0373935_0770798 | 3300035692 | Bacteria | 709 |
| 300 | Ga0373947_1235917 | 3300035725 | Unclassified | 509 |
| 301 | Ga0373937_0298981 | 3300036401 | Archaea | 1521 |
| 302 | Ga0373937_0476382 | 3300036401 | Bacteria | 1186 |
| 303 | Ga0373925_0207978 | 3300037068 | Bacteria | 1558 |
| 304 | Ga0373925_1702723 | 3300037068 | Unclassified | 515 |
| 305 | Ga0395900_0298910 | 3300037418 | Bacteria | 1597 |
| 306 | Ga0395898_0570807 | 3300037466 | Unclassified | 1074 |
| 307 | Ga0395898_0953614 | 3300037466 | Bacteria | 795 |
| 308 | Ga0395898_1271103 | 3300037466 | Bacteria | 666 |
| 309 | Ga0395898_1497752 | 3300037466 | Bacteria | 601 |
| 310 | Ga0395905_0689865 | 3300037471 | Bacteria | 923 |
| 311 | Ga0436364_0117682 | 3300037853 | Bacteria | 1102 |
| 312 | Ga0436364_1256770 | 3300037853 | Bacteria | 903 |
| 313 | Ga0395901_0734120 | 3300038443 | Bacteria | 982 |
| 314 | Ga0395901_0762232 | 3300038443 | Bacteria | 960 |
| 315 | Ga0395901_1118383 | 3300038443 | Bacteria | 757 |
| 316 | Ga0395901_1328778 | 3300038443 | Bacteria | 680 |
| 317 | Ga0436363_0707026 | 3300039450 | Bacteria | 1905 |
| 318 | Ga0439438_024862 | 3300041405 | Bacteria | 1637 |
| 319 | Ga0439438_090063 | 3300041405 | Bacteria | 748 |
| 320 | Ga0439447_112720 | 3300041407 | Bacteria | 624 |
| 321 | Ga0439461_0058942 | 3300041410 | Bacteria | 868 |
| 322 | Ga0439466_0061828 | 3300041411 | Unclassified | 1205 |
| 323 | Ga0439466_0206254 | 3300041411 | Bacteria | 597 |
| 324 | Ga0439465_0085901 | 3300041413 | Bacteria | 1072 |
| 325 | Ga0451791_0585133 | 3300041451 | Bacteria | 1174 |
| 326 | Ga0451853_3277767 | 3300041512 | Unclassified | 961 |
| 327 | Ga0439431_0006136 | 3300041997 | Bacteria | 2655 |
| 328 | Ga0439431_0117579 | 3300041997 | Bacteria | 740 |
| 329 | Ga0439445_0122398 | 3300042004 | Bacteria | 747 |
| 330 | Ga0439445_0146044 | 3300042004 | Bacteria | 687 |
| 331 | Ga0439455_0118718 | 3300042012 | Bacteria | 740 |
| 332 | Ga0450907_045084 | 3300042146 | Bacteria | 756 |
| 333 | Ga0439446_0127744 | 3300042156 | Unclassified | 822 |
| 334 | Ga0439446_0155135 | 3300042156 | Bacteria | 755 |
| 335 | Ga0439458_0113846 | 3300042157 | Unclassified | 709 |
| 336 | Ga0450918_028506 | 3300042531 | Bacteria | 983 |
| 337 | Ga0466965_0088820 | 3300044683 | Bacteria | 1570 |
| 338 | Ga0466963_0008195 | 3300044694 | Bacteria | 6261 |
| 339 | Ga0466963_0019581 | 3300044694 | Bacteria | 4247 |
| 340 | Ga0466963_0044331 | 3300044694 | Bacteria | 2928 |
| 341 | Ga0466963_0058630 | 3300044694 | Bacteria | 2567 |
| 342 | Ga0466964_0000074 | 3300044706 | Bacteria | 22392 |
| 343 | Ga0466964_0060419 | 3300044706 | Bacteria | 1576 |
| 344 | Ga0466964_0764393 | 3300044706 | Unclassified | 543 |
| 345 | Ga0466971_0084796 | 3300044719 | Bacteria | 1447 |
| 346 | Ga0466971_0264443 | 3300044719 | Bacteria | 821 |
| 347 | Ga0466968_0134441 | 3300044735 | Unclassified | 1127 |
| 348 | Ga0466968_0289544 | 3300044735 | Bacteria | 785 |
| 349 | Ga0466968_0336294 | 3300044735 | Bacteria | 731 |
| 350 | Ga0466968_0439109 | 3300044735 | Unclassified | 644 |
| 351 | Ga0466968_0545460 | 3300044735 | Bacteria | 581 |
| 352 | Ga0466957_0006182 | 3300044842 | Bacteria | 6760 |
| 353 | Ga0466957_0139750 | 3300044842 | Bacteria | 1559 |
| 354 | Ga0466957_1212676 | 3300044842 | Bacteria | 546 |
| 355 | Ga0466960_0020917 | 3300044901 | Bacteria | 2906 |
| 356 | Ga0466960_0120225 | 3300044901 | Bacteria | 1375 |
| 357 | Ga0466960_0364623 | 3300044901 | Bacteria | 826 |
| 358 | Ga0466960_0479444 | 3300044901 | Bacteria | 726 |
| 359 | Ga0466960_0488440 | 3300044901 | Bacteria | 720 |
| 360 | Ga0466960_0945234 | 3300044901 | Bacteria | 527 |
| 361 | Ga0466958_0038363 | 3300045836 | Bacteria | 2874 |
| 362 | Ga0466958_0131457 | 3300045836 | Bacteria | 1572 |
| 363 | Ga0466958_0453071 | 3300045836 | Bacteria | 831 |
| 364 | Ga0466958_0622502 | 3300045836 | Bacteria | 702 |
| 365 | Ga0466967_0000085 | 3300045976 | Bacteria | 34226 |
| 366 | Ga0466967_0011298 | 3300045976 | Bacteria | 6752 |
| 367 | Ga0466967_0020251 | 3300045976 | Bacteria | 5371 |
| 368 | Ga0466967_0096466 | 3300045976 | Bacteria | 2697 |
| 369 | Ga0466967_0190495 | 3300045976 | Bacteria | 1938 |
| 370 | Ga0466967_0197231 | 3300045976 | Bacteria | 1905 |
| 371 | Ga0466967_0323051 | 3300045976 | Bacteria | 1489 |
| 372 | Ga0466967_0679461 | 3300045976 | Bacteria | 1019 |
| 373 | Ga0466967_1399067 | 3300045976 | Bacteria | 697 |
| 374 | Ga0495592_0274122 | 3300046454 | Bacteria | 1106 |
| 375 | Ga0495592_0751947 | 3300046454 | Unclassified | 582 |
| 376 | Ga0495603_0064684 | 3300046455 | Bacteria | 2156 |
| 377 | Ga0495651_0460834 | 3300046462 | Unclassified | 820 |
| 378 | Ga0495653_0282852 | 3300046463 | Bacteria | 1088 |
| 379 | Ga0495653_0913060 | 3300046463 | Unclassified | 523 |
| 380 | Ga0495582_0100252 | 3300046473 | Bacteria | 1621 |
| 381 | Ga0495584_0210291 | 3300046491 | Bacteria | 989 |
| 382 | Ga0495594_0651625 | 3300046499 | Bacteria | 596 |
| 383 | Ga0495607_0273148 | 3300046501 | Bacteria | 805 |
| 384 | Ga0495608_0042798 | 3300046511 | Bacteria | 3028 |
| 385 | Ga0495616_0074977 | 3300046513 | Bacteria | 1629 |
| 386 | Ga0495618_0156803 | 3300046514 | Bacteria | 1453 |
| 387 | Ga0495620_0214505 | 3300046515 | Bacteria | 738 |
| 388 | Ga0495628_0230556 | 3300046516 | Bacteria | 1388 |
| 389 | Ga0495631_0195647 | 3300046518 | Bacteria | 865 |
| 390 | Ga0495642_0439786 | 3300046528 | Bacteria | 576 |
| 391 | Ga0495652_0597984 | 3300046529 | Unclassified | 753 |
| 392 | Ga0495652_1115613 | 3300046529 | Unclassified | 511 |
| 393 | Ga0495587_0185079 | 3300046536 | Bacteria | 1180 |
| 394 | Ga0495587_0350800 | 3300046536 | Bacteria | 822 |
| 395 | Ga0495587_0667181 | 3300046536 | Unclassified | 571 |
| 396 | Ga0495609_0305128 | 3300046538 | Bacteria | 648 |
| 397 | Ga0495609_0312056 | 3300046538 | Bacteria | 639 |
| 398 | Ga0495645_0090953 | 3300046543 | Bacteria | 2180 |
| 399 | Ga0495667_0058393 | 3300046559 | Archaea | 2535 |
| 400 | Ga0495667_0288955 | 3300046559 | Bacteria | 1040 |
| 401 | Ga0495667_0289237 | 3300046559 | Unclassified | 1039 |
| 402 | Ga0495667_0693375 | 3300046559 | Bacteria | 631 |
| 403 | Ga0495656_0055380 | 3300046615 | Bacteria | 1710 |
| 404 | Ga0495656_0204299 | 3300046615 | Bacteria | 982 |
| 405 | Ga0495611_0112324 | 3300046648 | Bacteria | 1269 |
| 406 | Ga0495611_0447751 | 3300046648 | Bacteria | 589 |
| 407 | Ga0495635_0149151 | 3300046663 | Bacteria | 1592 |
| 408 | Ga0495635_0464492 | 3300046663 | Bacteria | 836 |
| 409 | Ga0495635_0717470 | 3300046663 | Unclassified | 647 |
| 410 | Ga0495661_0098631 | 3300046665 | Bacteria | 1649 |
| 411 | Ga0495588_0314623 | 3300046674 | Bacteria | 824 |
| 412 | Ga0495657_0288026 | 3300046675 | Unclassified | 982 |
| 413 | Ga0495657_0387931 | 3300046675 | Unclassified | 823 |
| 414 | Ga0495657_0878148 | 3300046675 | Unclassified | 510 |
| 415 | Ga0495599_0063778 | 3300046678 | Bacteria | 2302 |
| 416 | Ga0495623_0108370 | 3300046679 | Bacteria | 1686 |
| 417 | Ga0495647_0251352 | 3300046681 | Bacteria | 787 |
| 418 | Ga0495658_0098316 | 3300046683 | Bacteria | 1743 |
| 419 | Ga0495613_0860318 | 3300046689 | Unclassified | 589 |
| 420 | Ga0495670_0481399 | 3300046691 | Bacteria | 673 |
| 421 | Ga0495600_0521628 | 3300046809 | Unclassified | 728 |
| 422 | Ga0495581_0344103 | 3300047315 | Unclassified | 870 |
| 423 | Ga0495581_0738431 | 3300047315 | Bacteria | 567 |
| 424 | Ga0495604_0133818 | 3300047317 | Bacteria | 1779 |
| 425 | Ga0495674_0084511 | 3300047319 | Bacteria | 2720 |
| 426 | Ga0495674_0273332 | 3300047319 | Bacteria | 1386 |
| 427 | Ga0495674_0736897 | 3300047319 | Unclassified | 771 |
| 428 | Ga0495674_1064855 | 3300047319 | Unclassified | 617 |
| 429 | Ga0495676_0110527 | 3300047321 | Bacteria | 2017 |
| 430 | Ga0495680_0088030 | 3300047322 | Bacteria | 2335 |
| 431 | Ga0495680_0231598 | 3300047322 | Unclassified | 1315 |
| 432 | Ga0495680_0538932 | 3300047322 | Unclassified | 788 |
| 433 | Ga0495684_0079703 | 3300047471 | Bacteria | 2486 |
| 434 | Ga0495684_0387076 | 3300047471 | Unclassified | 985 |
| 435 | Ga0495593_0348454 | 3300047673 | Unclassified | 740 |
| 436 | Ga0495602_0287807 | 3300048088 | Unclassified | 1208 |
| 437 | Ga0495602_0735767 | 3300048088 | Unclassified | 667 |
| 438 | Ga0495602_0791690 | 3300048088 | Unclassified | 637 |
| 439 | Ga0496100_0010783 | 3300048903 | Bacteria | 5185 |
| 440 | Ga0496100_0013930 | 3300048903 | Bacteria | 4654 |
| 441 | Ga0496100_1199516 | 3300048903 | Unclassified | 599 |
| 442 | Ga0496101_0015201 | 3300048904 | Bacteria | 5181 |
| 443 | Ga0496101_0019335 | 3300048904 | Bacteria | 4649 |
| 444 | Ga0496101_0584309 | 3300048904 | Bacteria | 883 |
| 445 | Ga0496101_1374275 | 3300048904 | Bacteria | 551 |
| 446 | Ga0496102_0151621 | 3300048905 | Bacteria | 2178 |
| 447 | Ga0496102_0580302 | 3300048905 | Bacteria | 1044 |
| 448 | Ga0496102_0848732 | 3300048905 | Unclassified | 835 |
| 449 | Ga0496102_1410453 | 3300048905 | Bacteria | 615 |
| 450 | Ga0496104_0010883 | 3300048907 | Bacteria | 8137 |
| 451 | Ga0496104_0112440 | 3300048907 | Bacteria | 2611 |
| 452 | Ga0496104_0618463 | 3300048907 | Unclassified | 993 |
| 453 | Ga0496104_1712220 | 3300048907 | Bacteria | 531 |
| 454 | Ga0496105_0088723 | 3300048908 | Bacteria | 2555 |
| 455 | Ga0496105_0122417 | 3300048908 | Bacteria | 2145 |
| 456 | Ga0496105_0203759 | 3300048908 | Bacteria | 1614 |
| 457 | Ga0496105_0843203 | 3300048908 | Unclassified | 694 |
| 458 | Ga0496105_1245874 | 3300048908 | Bacteria | 546 |
| 459 | Ga0496105_1368934 | 3300048908 | Bacteria | 514 |
| 460 | Ga0496106_0002385 | 3300048909 | Bacteria | 13997 |
| 461 | Ga0496106_0243722 | 3300048909 | Bacteria | 1436 |
| 462 | Ga0496106_0823736 | 3300048909 | Bacteria | 735 |
| 463 | Ga0496106_1088012 | 3300048909 | Bacteria | 627 |
| 464 | Ga0496107_0004303 | 3300048910 | Bacteria | 9634 |
| 465 | Ga0496107_0032595 | 3300048910 | Bacteria | 3724 |
| 466 | Ga0496108_0105986 | 3300048911 | Bacteria | 2400 |
| 467 | Ga0496108_0117442 | 3300048911 | Bacteria | 2279 |
| 468 | Ga0496108_0612590 | 3300048911 | Bacteria | 948 |
| 469 | Ga0496108_1801576 | 3300048911 | Bacteria | 501 |
| 470 | Ga0496109_0018827 | 3300048912 | Bacteria | 6075 |
| 471 | Ga0496109_0027027 | 3300048912 | Bacteria | 5120 |
| 472 | Ga0496109_0059523 | 3300048912 | Bacteria | 3490 |
| 473 | Ga0496109_0648305 | 3300048912 | Bacteria | 993 |
| 474 | Ga0496109_1116642 | 3300048912 | Bacteria | 725 |
| 475 | Ga0496109_1804567 | 3300048912 | Bacteria | 545 |
| 476 | Ga0496110_0012994 | 3300048913 | Bacteria | 6868 |
| 477 | Ga0496110_1297524 | 3300048913 | Bacteria | 637 |
| 478 | Ga0496111_0314600 | 3300048914 | Unclassified | 1160 |
| 479 | Ga0496112_0030532 | 3300048915 | Bacteria | 5216 |
| 480 | Ga0496112_0422261 | 3300048915 | Unclassified | 1272 |
| 481 | Ga0496112_1547590 | 3300048915 | Unclassified | 577 |
| 482 | Ga0496113_0122586 | 3300048916 | Bacteria | 2034 |
| 483 | Ga0496113_0136445 | 3300048916 | Bacteria | 1928 |
| 484 | Ga0496113_0389711 | 3300048916 | Bacteria | 1118 |
| 485 | Ga0496113_1583686 | 3300048916 | Bacteria | 504 |
| 486 | Ga0496114_0002539 | 3300048917 | Bacteria | 13928 |
| 487 | Ga0496114_0003443 | 3300048917 | Bacteria | 12139 |
| 488 | Ga0496114_0422075 | 3300048917 | Unclassified | 1181 |
| 489 | Ga0496114_1688214 | 3300048917 | Unclassified | 521 |
| 490 | Ga0496115_0263923 | 3300048918 | Bacteria | 1416 |
| 491 | Ga0496115_0998381 | 3300048918 | Bacteria | 640 |
| 492 | Ga0496119_0544323 | 3300048922 | Bacteria | 535 |
| 493 | Ga0501031_0014017 | 3300049568 | Bacteria | 5218 |
| 494 | Ga0501031_0045604 | 3300049568 | Bacteria | 2860 |
| 495 | Ga0501031_0075164 | 3300049568 | Bacteria | 2200 |
| 496 | Ga0501031_0918093 | 3300049568 | Bacteria | 560 |
| 497 | Ga0501032_0043422 | 3300049569 | Bacteria | 3045 |
| 498 | Ga0501033_0206573 | 3300049570 | Bacteria | 1402 |
| 499 | Ga0501033_0247851 | 3300049570 | Bacteria | 1263 |
| 500 | Ga0501034_0790579 | 3300049571 | Unclassified | 842 |
| 501 | Ga0501034_1542401 | 3300049571 | Bacteria | 538 |
| 502 | Ga0501036_0007855 | 3300049572 | Bacteria | 8726 |
| 503 | Ga0501036_0051786 | 3300049572 | Bacteria | 3477 |
| 504 | Ga0501036_0246521 | 3300049572 | Bacteria | 1497 |
| 505 | Ga0501038_0018767 | 3300049574 | Bacteria | 6243 |
| 506 | Ga0501038_0115124 | 3300049574 | Bacteria | 2223 |
| 507 | Ga0501038_1103656 | 3300049574 | Bacteria | 579 |
| 508 | Ga0501039_0001712 | 3300049575 | Bacteria | 16164 |
| 509 | Ga0501039_0437870 | 3300049575 | Unclassified | 1027 |
| 510 | Ga0501039_0471698 | 3300049575 | Bacteria | 985 |
| 511 | Ga0501039_0540282 | 3300049575 | Bacteria | 915 |
| 512 | Ga0501040_0000277 | 3300049576 | Bacteria | 29945 |
| 513 | Ga0501040_0296282 | 3300049576 | Bacteria | 1156 |
| 514 | Ga0501040_0324999 | 3300049576 | Bacteria | 1100 |
| 515 | Ga0501040_0858621 | 3300049576 | Bacteria | 657 |
| 516 | Ga0501041_0008506 | 3300049577 | Bacteria | 6039 |
| 517 | Ga0501041_0011520 | 3300049577 | Bacteria | 5228 |
| 518 | Ga0501041_0248793 | 3300049577 | Bacteria | 1117 |
| 519 | Ga0501041_0737965 | 3300049577 | Bacteria | 631 |
| 520 | Ga0501042_0012096 | 3300049578 | Bacteria | 5839 |
| 521 | Ga0501042_0018925 | 3300049578 | Bacteria | 4775 |
| 522 | Ga0501042_0206569 | 3300049578 | Bacteria | 1416 |
| 523 | Ga0501042_0331458 | 3300049578 | Bacteria | 1100 |
| 524 | Ga0501043_0048139 | 3300049579 | Bacteria | 3352 |
| 525 | Ga0501043_0162329 | 3300049579 | Bacteria | 1746 |
| 526 | Ga0501043_0364872 | 3300049579 | Bacteria | 1096 |
| 527 | Ga0501046_0071522 | 3300049580 | Bacteria | 2695 |
| 528 | Ga0501046_0446527 | 3300049580 | Bacteria | 930 |
| 529 | Ga0501046_0474142 | 3300049580 | Bacteria | 898 |
| 530 | Ga0501047_0009779 | 3300049581 | Bacteria | 9063 |
| 531 | Ga0501047_0146144 | 3300049581 | Bacteria | 2241 |
| 532 | Ga0501047_0222024 | 3300049581 | Bacteria | 1746 |
| 533 | Ga0501048_0000708 | 3300049582 | Bacteria | 24352 |
| 534 | Ga0501048_0004389 | 3300049582 | Bacteria | 10742 |
| 535 | Ga0501048_0171186 | 3300049582 | Bacteria | 1538 |
| 536 | Ga0501067_0003599 | 3300049583 | Bacteria | 8533 |
| 537 | Ga0501067_0011607 | 3300049583 | Bacteria | 4879 |
| 538 | Ga0501067_0060330 | 3300049583 | Bacteria | 2099 |
| 539 | Ga0501067_0232370 | 3300049583 | Bacteria | 1026 |
| 540 | Ga0501068_0000257 | 3300049584 | Bacteria | 26197 |
| 541 | Ga0501068_0033018 | 3300049584 | Bacteria | 3080 |
| 542 | Ga0501068_0057026 | 3300049584 | Bacteria | 2368 |
| 543 | Ga0501068_0099103 | 3300049584 | Bacteria | 1805 |
| 544 | Ga0501068_0385055 | 3300049584 | Bacteria | 903 |
| 545 | Ga0501069_0000272 | 3300049585 | Bacteria | 23453 |
| 546 | Ga0501069_0048331 | 3300049585 | Bacteria | 2362 |
| 547 | Ga0501069_0088038 | 3300049585 | Bacteria | 1755 |
| 548 | Ga0501069_0092337 | 3300049585 | Unclassified | 1712 |
| 549 | Ga0501069_0253045 | 3300049585 | Bacteria | 1028 |
| 550 | Ga0501070_0104502 | 3300049586 | Bacteria | 2342 |
| 551 | Ga0501070_0289239 | 3300049586 | Bacteria | 1336 |
| 552 | Ga0501070_1206482 | 3300049586 | Bacteria | 580 |
| 553 | Ga0501071_0002683 | 3300049587 | Bacteria | 10896 |
| 554 | Ga0501071_0027266 | 3300049587 | Bacteria | 4018 |
| 555 | Ga0501071_0360914 | 3300049587 | Bacteria | 1106 |
| 556 | Ga0501072_0027255 | 3300049588 | Bacteria | 4458 |
| 557 | Ga0501072_0059069 | 3300049588 | Bacteria | 3023 |
| 558 | Ga0501072_0129832 | 3300049588 | Bacteria | 2008 |
| 559 | Ga0501074_0008236 | 3300049590 | Bacteria | 7559 |
| 560 | Ga0501074_0027140 | 3300049590 | Bacteria | 4151 |
| 561 | Ga0501074_0264233 | 3300049590 | Bacteria | 1223 |
| 562 | Ga0501075_0013959 | 3300049591 | Bacteria | 5747 |
| 563 | Ga0501075_0056510 | 3300049591 | Bacteria | 2954 |
| 564 | Ga0501075_0196741 | 3300049591 | Bacteria | 1537 |
| 565 | Ga0501076_0002850 | 3300049592 | Bacteria | 11964 |
| 566 | Ga0501076_0420603 | 3300049592 | Bacteria | 1099 |
| 567 | Ga0501077_0048537 | 3300049593 | Bacteria | 2697 |
| 568 | Ga0501077_0147070 | 3300049593 | Bacteria | 1495 |
| 569 | Ga0501077_0502494 | 3300049593 | Bacteria | 777 |
| 570 | Ga0501248_033947 | 3300049678 | Unclassified | 596 |
| 571 | Ga0501079_0009452 | 3300049741 | Bacteria | 7391 |
| 572 | Ga0501079_0086486 | 3300049741 | Bacteria | 2426 |
| 573 | Ga0501079_0133805 | 3300049741 | Bacteria | 1930 |
| 574 | Ga0501080_0046331 | 3300049742 | Bacteria | 4048 |
| 575 | Ga0501080_0089150 | 3300049742 | Bacteria | 2865 |
| 576 | Ga0501080_0166164 | 3300049742 | Bacteria | 2036 |
| 577 | Ga0501080_0718356 | 3300049742 | Bacteria | 880 |
| 578 | Ga0501080_0881800 | 3300049742 | Bacteria | 781 |
| 579 | Ga0501081_0006855 | 3300049743 | Bacteria | 7407 |
| 580 | Ga0501081_0284709 | 3300049743 | Bacteria | 1210 |
| 581 | Ga0501083_0107789 | 3300049744 | Bacteria | 1833 |
| 582 | Ga0501083_0204044 | 3300049744 | Bacteria | 1289 |
| 583 | Ga0501083_0404405 | 3300049744 | Bacteria | 888 |
| 584 | Ga0501083_0630014 | 3300049744 | Viruses | 698 |
| 585 | Ga0501035_0158690 | 3300049822 | Bacteria | 1959 |
| 586 | Ga0501035_0583702 | 3300049822 | Unclassified | 912 |
| 587 | Ga0501044_0197992 | 3300049823 | Bacteria | 1968 |
| 588 | Ga0501044_0499480 | 3300049823 | Bacteria | 1118 |
| 589 | Ga0501045_0040353 | 3300049824 | Bacteria | 3397 |
| 590 | Ga0501045_0114141 | 3300049824 | Bacteria | 2003 |
| 591 | Ga0501045_1273416 | 3300049824 | Bacteria | 535 |
| 592 | nmdc:mga03n38_141692_c1 | 3300050490 | Bacteria | 1201 |
| 593 | nmdc:mga03n38_52403_c1 | 3300050490 | Bacteria | 1826 |
| 594 | nmdc:mga0yw44_190871_c1 | 3300050492 | Bacteria | 1351 |
| 595 | nmdc:mga05p37_37671_c1 | 3300050507 | Bacteria | 5931 |
| 596 | nmdc:mga06r32_1235444_c1 | 3300050510 | Unclassified | 693 |
| 597 | nmdc:mga08y16_260485_c1 | 3300050511 | Bacteria | 1791 |
| 598 | nmdc:mga08y16_288196_c1 | 3300050511 | Bacteria | 1693 |
| 599 | nmdc:mga0n895_125476_c1 | 3300050512 | Bacteria | 2590 |
| 600 | nmdc:mga0n895_24130_c1 | 3300050512 | Bacteria | 5728 |
| 601 | nmdc:mga0n895_24973_c1 | 3300050512 | Bacteria | 5640 |
| 602 | nmdc:mga0n895_362939_c1 | 3300050512 | Bacteria | 1467 |
| 603 | nmdc:mga0rr50_57090_c1 | 3300050513 | Bacteria | 2919 |
| 604 | nmdc:mga0rr50_65171_c1 | 3300050513 | Bacteria | 2759 |
| 605 | nmdc:mga0rr50_72928_c1 | 3300050513 | Bacteria | 2623 |
| 606 | nmdc:mga08x19_342840_c1 | 3300050514 | Bacteria | 1042 |
| 607 | nmdc:mga08x19_71783_c1 | 3300050514 | Bacteria | 2258 |
| 608 | nmdc:mga08x19_87484_c1 | 3300050514 | Bacteria | 2053 |
| 609 | nmdc:mga08x19_927575_c1 | 3300050514 | Bacteria | 618 |
| 610 | nmdc:mga0a205_144391_c1 | 3300050515 | Bacteria | 2280 |
| 611 | nmdc:mga0a205_467458_c1 | 3300050515 | Unclassified | 1120 |
| 612 | nmdc:mga0a205_89817_c1 | 3300050515 | Bacteria | 2969 |
| 613 | Ga0495612_0232440 | 3300053078 | Unclassified | 818 |
| 614 | Ga0495612_0264138 | 3300053078 | Unclassified | 767 |
| 615 | Ga0495595_0064817 | 3300053084 | Archaea | 1718 |
| 616 | Ga0495595_0728355 | 3300053084 | Unclassified | 508 |
| 617 | Ga0495619_0090926 | 3300053085 | Bacteria | 2066 |
| 618 | Ga0495619_0300034 | 3300053085 | Bacteria | 1113 |
| 619 | Ga0501084_0004754 | 3300054114 | Bacteria | 11098 |
| 620 | Ga0501084_0049774 | 3300054114 | Bacteria | 3507 |
| 621 | Ga0501084_0057952 | 3300054114 | Bacteria | 3241 |
| 622 | Ga0501084_0497594 | 3300054114 | Bacteria | 1030 |
| 623 | Ga0590077_049871 | 3300059426 | Bacteria | 938 |
| 624 | Ga0590077_055034 | 3300059426 | Bacteria | 897 |
| 625 | Ga0590077_064131 | 3300059426 | Unclassified | 835 |
| 626 | Ga0501082_0018931 | 3300060353 | Bacteria | 5932 |
| 627 | Ga0501082_0135570 | 3300060353 | Bacteria | 2136 |
| 628 | Ga0466962_0167499 | 3300061719 | Bacteria | 1069 |
| 629 | Ga0530510_0018090 | 3300061734 | Bacteria | 4995 |
| 630 | Ga0530510_0029857 | 3300061734 | Bacteria | 3914 |
| 631 | Ga0530510_0030029 | 3300061734 | Bacteria | 3903 |
| 632 | Ga0530510_0143076 | 3300061734 | Bacteria | 1763 |
| 633 | Ga0070712_101537571 | |||
| 634 | Ga0070658_10914199 | |||
| 635 | Ga0070683_100070093 | |||
| 636 | Ga0070683_100446194 | |||
| 637 | Ga0070683_100915081 | |||
| 638 | Ga0070690_100053254 | |||
| 639 | Ga0068869_101117487 | |||
| 640 | Ga0070680_100781285 | |||
| 641 | Ga0070682_100015627 | |||
| 642 | Ga0070682_100099321 | |||
| 643 | Ga0070682_100249453 | |||
| 644 | Ga0068868_101153365 | |||
| 645 | Ga0068868_101254222 | |||
| 646 | Ga0068868_102056419 | |||
| 647 | Ga0070689_100181940 | |||
| 648 | Ga0070691_10685648 | |||
| 649 | Ga0070669_101298932 | |||
| 650 | Ga0070671_100221790 | |||
| 651 | Ga0070671_100954157 | |||
| 652 | Ga0070671_101302674 | |||
| 653 | Ga0070674_101126275 | |||
| 654 | Ga0070673_101240670 | |||
| 655 | Ga0070659_100011416 | |||
| 656 | Ga0070709_10378255 | |||
| 657 | Ga0070714_100025537 | |||
| 658 | Ga0070714_100026104 | |||
| 659 | Ga0070714_100091443 | |||
| 660 | Ga0070714_101094558 | |||
| 661 | Ga0070713_102076329 | |||
| 662 | Ga0070711_100086586 | |||
| 663 | Ga0070711_100658321 | |||
| 664 | Ga0070705_100032102 | |||
| 665 | Ga0070705_100130208 | |||
| 666 | Ga0070705_101307985 | |||
| 667 | Ga0070694_100059679 | |||
| 668 | Ga0070708_101887756 | |||
| 669 | Ga0070678_100014559 | |||
| 670 | Ga0070678_100891293 | |||
| 671 | Ga0070678_101114858 | |||
| 672 | Ga0070681_10131888 | |||
| 673 | Ga0070681_11525564 | |||
| 674 | Ga0068867_100246986 | |||
| 675 | Ga0068867_101401577 | |||
| 676 | Ga0070685_10968139 | |||
| 677 | Ga0070706_101496837 | |||
| 678 | Ga0070707_101527298 | |||
| 679 | Ga0070698_100100528 | |||
| 680 | Ga0070698_100642939 | |||
| 681 | Ga0070698_100782518 | |||
| 682 | Ga0070698_101216834 | |||
| 683 | Ga0070699_100484617 | |||
| 684 | Ga0070679_100033049 | |||
| 685 | Ga0070679_100959651 | |||
| 686 | Ga0070684_101187815 | |||
| 687 | Ga0070684_101266948 | |||
| 688 | Ga0070697_100800286 | |||
| 689 | Ga0068853_100410500 | |||
| 690 | Ga0068853_101369059 | |||
| 691 | Ga0070686_101811503 | |||
| 692 | Ga0070695_100649644 | |||
| 693 | Ga0070693_100083132 | |||
| 694 | Ga0070693_100624525 | |||
| 695 | Ga0070693_100648306 | |||
| 696 | Ga0070693_100952386 | |||
| 697 | Ga0070665_100220084 | |||
| 698 | Ga0070704_100338605 | |||
| 699 | Ga0068855_100009022 | |||
| 700 | Ga0070664_100526247 | |||
| 701 | Ga0070664_100708584 | |||
| 702 | Ga0068857_100259826 | |||
| 703 | Ga0068857_101438845 | |||
| 704 | Ga0068854_100062919 | |||
| 705 | Ga0068854_100098328 | |||
| 706 | Ga0068854_101037175 | |||
| 707 | Ga0068856_100094384 | |||
| 708 | Ga0070702_100077472 | |||
| 709 | Ga0070702_100110118 | |||
| 710 | Ga0070702_100110184 | |||
| 711 | Ga0070702_100356808 | |||
| 712 | Ga0068852_100545223 | |||
| 713 | Ga0068852_100748112 | |||
| 714 | Ga0068852_101009832 | |||
| 715 | Ga0068859_100796532 | |||
| 716 | Ga0068864_100815796 | |||
| 717 | Ga0068866_10025396 | |||
| 718 | Ga0068866_11255425 | |||
| 719 | Ga0068861_100520013 | |||
| 720 | Ga0068851_10454090 | |||
| 721 | Ga0068870_10358074 | |||
| 722 | Ga0068870_10398738 | |||
| 723 | Ga0068858_100788087 | |||
| 724 | Ga0068858_101325349 | |||
| 725 | Ga0068860_100370570 | |||
| 726 | Ga0081538_10000221 | |||
| 727 | Ga0081538_10004784 | |||
| 728 | Ga0081538_10019803 | |||
| 729 | Ga0081538_10032755 | |||
| 730 | Ga0081539_10002360 | |||
| 731 | Ga0070717_10450521 | |||
| 732 | Ga0070717_12098336 | |||
| 733 | Ga0075368_10563616 | |||
| 734 | Ga0075363_100104727 | |||
| 735 | Ga0075363_100316875 | |||
| 736 | Ga0075432_10018806 | |||
| 737 | Ga0075432_10055332 | |||
| 738 | Ga0070715_10004326 | |||
| 739 | Ga0070716_100310276 | |||
| 740 | Ga0070716_100371692 | |||
| 741 | Ga0070712_100162474 | |||
| 742 | Ga0070712_101946650 | |||
| 743 | Ga0097621_100203728 | |||
| 744 | Ga0097621_100297255 | |||
| 745 | Ga0068871_100003053 | |||
| 746 | Ga0068871_101704950 | |||
| 747 | Ga0075431_100822078 | |||
| 748 | Ga0075433_10109537 | |||
| 749 | Ga0075433_10243476 | |||
| 750 | Ga0075434_100004473 | |||
| 751 | Ga0075434_100311894 | |||
| 752 | Ga0068865_100700361 | |||
| 753 | Ga0075436_100010145 | |||
| 754 | Ga0075436_100017084 | |||
| 755 | Ga0097620_100796578 | |||
| 756 | Ga0075435_100000660 | |||
| 757 | Ga0075435_100068209 | |||
| 758 | Ga0075435_100265407 | |||
| 759 | Ga0105240_10015755 | |||
| 760 | Ga0105240_11919872 | |||
| 761 | Ga0111539_10007815 | |||
| 762 | Ga0111539_10076408 | |||
| 763 | Ga0105245_10042601 | |||
| 764 | Ga0105245_10067016 | |||
| 765 | Ga0105245_10073253 | |||
| 766 | Ga0105245_11372997 | |||
| 767 | Ga0105247_10010497 | |||
| 768 | Ga0105247_10910997 | |||
| 769 | Ga0105247_11651727 | |||
| 770 | Ga0114129_10003593 | |||
| 771 | Ga0114129_10005368 | |||
| 772 | Ga0114129_11876190 | |||
| 773 | Ga0105243_10003201 | |||
| 774 | Ga0105243_10121387 | |||
| 775 | Ga0105243_10371174 | |||
| 776 | Ga0105243_11756236 | |||
| 777 | Ga0105241_10070011 | |||
| 778 | Ga0105241_10555762 | |||
| 779 | Ga0105242_10877677 | |||
| 780 | Ga0105248_10009991 | |||
| 781 | Ga0105248_11387424 | |||
| 782 | Ga0105248_12260070 | |||
| 783 | Ga0105238_10046683 | |||
| 784 | Ga0105238_10653240 | |||
| 785 | Ga0105238_12080785 | |||
| 786 | Ga0105249_10696436 | |||
| 787 | Ga0105249_13364556 | |||
| 788 | Ga0105239_10294886 | |||
| 789 | Ga0105246_10358597 | |||
| 790 | Ga0105246_10573209 | |||
| 791 | Ga0157320_1005703 | |||
| 792 | Ga0157373_11342264 | |||
| 793 | Ga0157371_10235239 | |||
| 794 | Ga0157371_10975721 | |||
| 795 | Ga0157369_10248357 | |||
| 796 | Ga0157369_10393398 | |||
| 797 | Ga0157378_10037121 | |||
| 798 | Ga0163162_11103661 | |||
| 799 | Ga0157372_10629417 | |||
| 800 | Ga0157372_11455357 | |||
| 801 | Ga0157372_12342189 | |||
| 802 | Ga0157372_13430583 | |||
| 803 | Ga0157375_10349169 | |||
| 804 | Ga0157375_10415626 | |||
| 805 | Ga0157375_13148358 | |||
| 806 | Ga0163163_11606992 | |||
| 807 | Ga0157380_10600552 | |||
| 808 | Ga0182008_10000361 | |||
| 809 | Ga0157377_10054903 | |||
| 810 | Ga0157377_11184551 | |||
| 811 | Ga0157377_11198483 | |||
| 812 | Ga0157379_10090223 | |||
| 813 | Ga0157379_10367048 | |||
| 814 | Ga0157379_10913177 | |||
| 815 | Ga0157376_10032621 | |||
| 816 | Ga0157376_10920434 | |||
| 817 | Ga0157376_10925038 | |||
| 818 | Ga0163161_11390802 | |||
| 819 | Ga0197907_11390726 | |||
| 820 | Ga0206354_11622190 | |||
| 821 | Ga0207656_10574744 | |||
| 822 | Ga0207653_10133653 | |||
| 823 | Ga0207642_10042546 | |||
| 824 | Ga0207642_10056177 | |||
| 825 | Ga0207642_10795967 | |||
| 826 | Ga0207688_10422624 | |||
| 827 | Ga0207680_10055573 | |||
| 828 | Ga0207699_10161912 | |||
| 829 | Ga0207699_10604724 | |||
| 830 | Ga0207699_10624245 | |||
| 831 | Ga0207643_10127125 | |||
| 832 | Ga0207643_10298093 | |||
| 833 | Ga0207654_10464120 | |||
| 834 | Ga0207707_10084003 | |||
| 835 | Ga0207707_10682685 | |||
| 836 | Ga0207695_10019579 | |||
| 837 | Ga0207671_10543537 | |||
| 838 | Ga0207693_10081154 | |||
| 839 | Ga0207693_10979109 | |||
| 840 | Ga0207663_11043109 | |||
| 841 | Ga0207660_10678880 | |||
| 842 | Ga0207660_10991148 | |||
| 843 | Ga0207660_11175484 | |||
| 844 | Ga0207662_10747641 | |||
| 845 | Ga0207657_10177939 | |||
| 846 | Ga0207652_10020819 | |||
| 847 | Ga0207652_10468373 | |||
| 848 | Ga0207652_10834385 | |||
| 849 | Ga0207646_10384721 | |||
| 850 | Ga0207646_10676874 | |||
| 851 | Ga0207646_11292028 | |||
| 852 | Ga0207694_10426371 | |||
| 853 | Ga0207694_10865037 | |||
| 854 | Ga0207687_10055763 | |||
| 855 | Ga0207687_10554334 | |||
| 856 | Ga0207664_10037798 | |||
| 857 | Ga0207664_10110506 | |||
| 858 | Ga0207664_10345922 | |||
| 859 | Ga0207644_10526483 | |||
| 860 | Ga0207644_10625233 | |||
| 861 | Ga0207706_10142570 | |||
| 862 | Ga0207686_10119821 | |||
| 863 | Ga0207686_11566826 | |||
| 864 | Ga0207709_10010548 | |||
| 865 | Ga0207709_10161088 | |||
| 866 | Ga0207709_10317336 | |||
| 867 | Ga0207670_10350117 | |||
| 868 | Ga0207669_10283982 | |||
| 869 | Ga0207669_11246475 | |||
| 870 | Ga0207704_10881664 | |||
| 871 | Ga0207704_11005072 | |||
| 872 | Ga0207665_10228475 | |||
| 873 | Ga0207665_11008240 | |||
| 874 | Ga0207711_10009223 | |||
| 875 | Ga0207661_10011570 | |||
| 876 | Ga0207661_10199002 | |||
| 877 | Ga0207679_10328132 | |||
| 878 | Ga0207679_10675732 | |||
| 879 | Ga0207667_10132577 | |||
| 880 | Ga0207667_10408232 | |||
| 881 | Ga0207651_10345238 | |||
| 882 | Ga0207712_10783825 | |||
| 883 | Ga0207640_10051691 | |||
| 884 | Ga0207640_10053201 | |||
| 885 | Ga0207640_10344961 | |||
| 886 | Ga0207677_10168990 | |||
| 887 | Ga0207677_10223622 | |||
| 888 | Ga0207677_10407783 | |||
| 889 | Ga0207677_11621192 | |||
| 890 | Ga0207703_10726179 | |||
| 891 | Ga0207703_10811220 | |||
| 892 | Ga0207639_10822450 | |||
| 893 | Ga0207639_11811982 | |||
| 894 | Ga0207678_11108805 | |||
| 895 | Ga0207708_10104712 | |||
| 896 | Ga0207702_10024617 | |||
| 897 | Ga0207702_10163196 | |||
| 898 | Ga0207702_10696649 | |||
| 899 | Ga0207648_10022889 | |||
| 900 | Ga0207648_11704906 | |||
| 901 | Ga0207676_10284917 | |||
| 902 | Ga0207674_10032416 | |||
| 903 | Ga0207675_100206264 | |||
| 904 | Ga0207675_101541248 | |||
| 905 | Ga0207683_10001018 | |||
| 906 | Ga0207683_10024729 | |||
| 907 | Ga0207683_11256825 | |||
| 908 | Ga0207698_10167354 | |||
| 909 | Ga0207698_10607230 | |||
| 910 | Ga0207428_10250180 | |||
| 911 | Ga0207428_11083316 | |||
| 912 | Ga0268266_11102337 | |||
| 913 | Ga0268265_11701427 | |||
| 914 | Ga0268264_10901705 | |||
| 915 | Ga0265319_1018240 | |||
| 916 | Ga0265339_10186504 | |||
| 917 | Ga0265327_10113675 | |||
| 918 | Ga0265327_10182125 | |||
| 919 | Ga0265327_10297070 | |||
| 920 | Ga0307408_100304850 | |||
| 921 | Ga0307413_10389860 | |||
| 922 | Ga0307407_11343693 | |||
| 923 | Ga0307412_10644694 | |||
| 924 | Ga0307416_100706351 | |||
| 925 | Ga0373944_0096341 | |||
| 926 | Ga0373956_0423083 | |||
| 927 | Ga0373946_0111394 | |||
| 928 | Ga0373955_0477251 | |||
| 929 | Ga0316574_0024404 | |||
| 930 | Ga0373935_0534905 | |||
| 931 | Ga0373935_0770798 | |||
| 932 | Ga0373947_1235917 | |||
| 933 | Ga0373937_0298981 | |||
| 934 | Ga0373937_0476382 | |||
| 935 | Ga0373925_0207978 | |||
| 936 | Ga0373925_1702723 | |||
| 937 | Ga0395900_0298910 | |||
| 938 | Ga0395898_0570807 | |||
| 939 | Ga0395898_0953614 | |||
| 940 | Ga0395898_1271103 | |||
| 941 | Ga0395898_1497752 | |||
| 942 | Ga0395905_0689865 | |||
| 943 | Ga0436364_0117682 | |||
| 944 | Ga0436364_1256770 | |||
| 945 | Ga0395901_0734120 | |||
| 946 | Ga0395901_0762232 | |||
| 947 | Ga0395901_1118383 | |||
| 948 | Ga0395901_1328778 | |||
| 949 | Ga0436363_0707026 | |||
| 950 | Ga0439438_024862 | |||
| 951 | Ga0439438_090063 | |||
| 952 | Ga0439447_112720 | |||
| 953 | Ga0439461_0058942 | |||
| 954 | Ga0439466_0061828 | |||
| 955 | Ga0439466_0206254 | |||
| 956 | Ga0439465_0085901 | |||
| 957 | Ga0451791_0585133 | |||
| 958 | Ga0451853_3277767 | |||
| 959 | Ga0439431_0006136 | |||
| 960 | Ga0439431_0117579 | |||
| 961 | Ga0439445_0122398 | |||
| 962 | Ga0439445_0146044 | |||
| 963 | Ga0439455_0118718 | |||
| 964 | Ga0450907_045084 | |||
| 965 | Ga0439446_0127744 | |||
| 966 | Ga0439446_0155135 | |||
| 967 | Ga0439458_0113846 | |||
| 968 | Ga0450918_028506 | |||
| 969 | Ga0466965_0088820 | |||
| 970 | Ga0466963_0008195 | |||
| 971 | Ga0466963_0019581 | |||
| 972 | Ga0466963_0044331 | |||
| 973 | Ga0466963_0058630 | |||
| 974 | Ga0466964_0000074 | |||
| 975 | Ga0466964_0060419 | |||
| 976 | Ga0466964_0764393 | |||
| 977 | Ga0466971_0084796 | |||
| 978 | Ga0466971_0264443 | |||
| 979 | Ga0466968_0134441 | |||
| 980 | Ga0466968_0289544 | |||
| 981 | Ga0466968_0336294 | |||
| 982 | Ga0466968_0439109 | |||
| 983 | Ga0466968_0545460 | |||
| 984 | Ga0466957_0006182 | |||
| 985 | Ga0466957_0139750 | |||
| 986 | Ga0466957_1212676 | |||
| 987 | Ga0466960_0020917 | |||
| 988 | Ga0466960_0120225 | |||
| 989 | Ga0466960_0364623 | |||
| 990 | Ga0466960_0479444 | |||
| 991 | Ga0466960_0488440 | |||
| 992 | Ga0466960_0945234 | |||
| 993 | Ga0466958_0038363 | |||
| 994 | Ga0466958_0131457 | |||
| 995 | Ga0466958_0453071 | |||
| 996 | Ga0466958_0622502 | |||
| 997 | Ga0466967_0000085 | |||
| 998 | Ga0466967_0011298 | |||
| 999 | Ga0466967_0020251 | |||
| 1000 | Ga0466967_0096466 | |||
| 1001 | Ga0466967_0190495 | |||
| 1002 | Ga0466967_0197231 | |||
| 1003 | Ga0466967_0323051 | |||
| 1004 | Ga0466967_0679461 | |||
| 1005 | Ga0466967_1399067 | |||
| 1006 | Ga0495592_0274122 | |||
| 1007 | Ga0495592_0751947 | |||
| 1008 | Ga0495603_0064684 | |||
| 1009 | Ga0495651_0460834 | |||
| 1010 | Ga0495653_0282852 | |||
| 1011 | Ga0495653_0913060 | |||
| 1012 | Ga0495582_0100252 | |||
| 1013 | Ga0495584_0210291 | |||
| 1014 | Ga0495594_0651625 | |||
| 1015 | Ga0495607_0273148 | |||
| 1016 | Ga0495608_0042798 | |||
| 1017 | Ga0495616_0074977 | |||
| 1018 | Ga0495618_0156803 | |||
| 1019 | Ga0495620_0214505 | |||
| 1020 | Ga0495628_0230556 | |||
| 1021 | Ga0495631_0195647 | |||
| 1022 | Ga0495642_0439786 | |||
| 1023 | Ga0495652_0597984 | |||
| 1024 | Ga0495652_1115613 | |||
| 1025 | Ga0495587_0185079 | |||
| 1026 | Ga0495587_0350800 | |||
| 1027 | Ga0495587_0667181 | |||
| 1028 | Ga0495609_0305128 | |||
| 1029 | Ga0495609_0312056 | |||
| 1030 | Ga0495645_0090953 | |||
| 1031 | Ga0495667_0058393 | |||
| 1032 | Ga0495667_0288955 | |||
| 1033 | Ga0495667_0289237 | |||
| 1034 | Ga0495667_0693375 | |||
| 1035 | Ga0495656_0055380 | |||
| 1036 | Ga0495656_0204299 | |||
| 1037 | Ga0495611_0112324 | |||
| 1038 | Ga0495611_0447751 | |||
| 1039 | Ga0495635_0149151 | |||
| 1040 | Ga0495635_0464492 | |||
| 1041 | Ga0495635_0717470 | |||
| 1042 | Ga0495661_0098631 | |||
| 1043 | Ga0495588_0314623 | |||
| 1044 | Ga0495657_0288026 | |||
| 1045 | Ga0495657_0387931 | |||
| 1046 | Ga0495657_0878148 | |||
| 1047 | Ga0495599_0063778 | |||
| 1048 | Ga0495623_0108370 | |||
| 1049 | Ga0495647_0251352 | |||
| 1050 | Ga0495658_0098316 | |||
| 1051 | Ga0495613_0860318 | |||
| 1052 | Ga0495670_0481399 | |||
| 1053 | Ga0495600_0521628 | |||
| 1054 | Ga0495581_0344103 | |||
| 1055 | Ga0495581_0738431 | |||
| 1056 | Ga0495604_0133818 | |||
| 1057 | Ga0495674_0084511 | |||
| 1058 | Ga0495674_0273332 | |||
| 1059 | Ga0495674_0736897 | |||
| 1060 | Ga0495674_1064855 | |||
| 1061 | Ga0495676_0110527 | |||
| 1062 | Ga0495680_0088030 | |||
| 1063 | Ga0495680_0231598 | |||
| 1064 | Ga0495680_0538932 | |||
| 1065 | Ga0495684_0079703 | |||
| 1066 | Ga0495684_0387076 | |||
| 1067 | Ga0495593_0348454 | |||
| 1068 | Ga0495602_0287807 | |||
| 1069 | Ga0495602_0735767 | |||
| 1070 | Ga0495602_0791690 | |||
| 1071 | Ga0496100_0010783 | |||
| 1072 | Ga0496100_0013930 | |||
| 1073 | Ga0496100_1199516 | |||
| 1074 | Ga0496101_0015201 | |||
| 1075 | Ga0496101_0019335 | |||
| 1076 | Ga0496101_0584309 | |||
| 1077 | Ga0496101_1374275 | |||
| 1078 | Ga0496102_0151621 | |||
| 1079 | Ga0496102_0580302 | |||
| 1080 | Ga0496102_0848732 | |||
| 1081 | Ga0496102_1410453 | |||
| 1082 | Ga0496104_0010883 | |||
| 1083 | Ga0496104_0112440 | |||
| 1084 | Ga0496104_0618463 | |||
| 1085 | Ga0496104_1712220 | |||
| 1086 | Ga0496105_0088723 | |||
| 1087 | Ga0496105_0122417 | |||
| 1088 | Ga0496105_0203759 | |||
| 1089 | Ga0496105_0843203 | |||
| 1090 | Ga0496105_1245874 | |||
| 1091 | Ga0496105_1368934 | |||
| 1092 | Ga0496106_0002385 | |||
| 1093 | Ga0496106_0243722 | |||
| 1094 | Ga0496106_0823736 | |||
| 1095 | Ga0496106_1088012 | |||
| 1096 | Ga0496107_0004303 | |||
| 1097 | Ga0496107_0032595 | |||
| 1098 | Ga0496108_0105986 | |||
| 1099 | Ga0496108_0117442 | |||
| 1100 | Ga0496108_0612590 | |||
| 1101 | Ga0496108_1801576 | |||
| 1102 | Ga0496109_0018827 | |||
| 1103 | Ga0496109_0027027 | |||
| 1104 | Ga0496109_0059523 | |||
| 1105 | Ga0496109_0648305 | |||
| 1106 | Ga0496109_1116642 | |||
| 1107 | Ga0496109_1804567 | |||
| 1108 | Ga0496110_0012994 | |||
| 1109 | Ga0496110_1297524 | |||
| 1110 | Ga0496111_0314600 | |||
| 1111 | Ga0496112_0030532 | |||
| 1112 | Ga0496112_0422261 | |||
| 1113 | Ga0496112_1547590 | |||
| 1114 | Ga0496113_0122586 | |||
| 1115 | Ga0496113_0136445 | |||
| 1116 | Ga0496113_0389711 | |||
| 1117 | Ga0496113_1583686 | |||
| 1118 | Ga0496114_0002539 | |||
| 1119 | Ga0496114_0003443 | |||
| 1120 | Ga0496114_0422075 | |||
| 1121 | Ga0496114_1688214 | |||
| 1122 | Ga0496115_0263923 | |||
| 1123 | Ga0496115_0998381 | |||
| 1124 | Ga0496119_0544323 | |||
| 1125 | Ga0501031_0014017 | |||
| 1126 | Ga0501031_0045604 | |||
| 1127 | Ga0501031_0075164 | |||
| 1128 | Ga0501031_0918093 | |||
| 1129 | Ga0501032_0043422 | |||
| 1130 | Ga0501033_0206573 | |||
| 1131 | Ga0501033_0247851 | |||
| 1132 | Ga0501034_0790579 | |||
| 1133 | Ga0501034_1542401 | |||
| 1134 | Ga0501036_0007855 | |||
| 1135 | Ga0501036_0051786 | |||
| 1136 | Ga0501036_0246521 | |||
| 1137 | Ga0501038_0018767 | |||
| 1138 | Ga0501038_0115124 | |||
| 1139 | Ga0501038_1103656 | |||
| 1140 | Ga0501039_0001712 | |||
| 1141 | Ga0501039_0437870 | |||
| 1142 | Ga0501039_0471698 | |||
| 1143 | Ga0501039_0540282 | |||
| 1144 | Ga0501040_0000277 | |||
| 1145 | Ga0501040_0296282 | |||
| 1146 | Ga0501040_0324999 | |||
| 1147 | Ga0501040_0858621 | |||
| 1148 | Ga0501041_0008506 | |||
| 1149 | Ga0501041_0011520 | |||
| 1150 | Ga0501041_0248793 | |||
| 1151 | Ga0501041_0737965 | |||
| 1152 | Ga0501042_0012096 | |||
| 1153 | Ga0501042_0018925 | |||
| 1154 | Ga0501042_0206569 | |||
| 1155 | Ga0501042_0331458 | |||
| 1156 | Ga0501043_0048139 | |||
| 1157 | Ga0501043_0162329 | |||
| 1158 | Ga0501043_0364872 | |||
| 1159 | Ga0501046_0071522 | |||
| 1160 | Ga0501046_0446527 | |||
| 1161 | Ga0501046_0474142 | |||
| 1162 | Ga0501047_0009779 | |||
| 1163 | Ga0501047_0146144 | |||
| 1164 | Ga0501047_0222024 | |||
| 1165 | Ga0501048_0000708 | |||
| 1166 | Ga0501048_0004389 | |||
| 1167 | Ga0501048_0171186 | |||
| 1168 | Ga0501067_0003599 | |||
| 1169 | Ga0501067_0011607 | |||
| 1170 | Ga0501067_0060330 | |||
| 1171 | Ga0501067_0232370 | |||
| 1172 | Ga0501068_0000257 | |||
| 1173 | Ga0501068_0033018 | |||
| 1174 | Ga0501068_0057026 | |||
| 1175 | Ga0501068_0099103 | |||
| 1176 | Ga0501068_0385055 | |||
| 1177 | Ga0501069_0000272 | |||
| 1178 | Ga0501069_0048331 | |||
| 1179 | Ga0501069_0088038 | |||
| 1180 | Ga0501069_0092337 | |||
| 1181 | Ga0501069_0253045 | |||
| 1182 | Ga0501070_0104502 | |||
| 1183 | Ga0501070_0289239 | |||
| 1184 | Ga0501070_1206482 | |||
| 1185 | Ga0501071_0002683 | |||
| 1186 | Ga0501071_0027266 | |||
| 1187 | Ga0501071_0360914 | |||
| 1188 | Ga0501072_0027255 | |||
| 1189 | Ga0501072_0059069 | |||
| 1190 | Ga0501072_0129832 | |||
| 1191 | Ga0501074_0008236 | |||
| 1192 | Ga0501074_0027140 | |||
| 1193 | Ga0501074_0264233 | |||
| 1194 | Ga0501075_0013959 | |||
| 1195 | Ga0501075_0056510 | |||
| 1196 | Ga0501075_0196741 | |||
| 1197 | Ga0501076_0002850 | |||
| 1198 | Ga0501076_0420603 | |||
| 1199 | Ga0501077_0048537 | |||
| 1200 | Ga0501077_0147070 | |||
| 1201 | Ga0501077_0502494 | |||
| 1202 | Ga0501248_033947 | |||
| 1203 | Ga0501079_0009452 | |||
| 1204 | Ga0501079_0086486 | |||
| 1205 | Ga0501079_0133805 | |||
| 1206 | Ga0501080_0046331 | |||
| 1207 | Ga0501080_0089150 | |||
| 1208 | Ga0501080_0166164 | |||
| 1209 | Ga0501080_0718356 | |||
| 1210 | Ga0501080_0881800 | |||
| 1211 | Ga0501081_0006855 | |||
| 1212 | Ga0501081_0284709 | |||
| 1213 | Ga0501083_0107789 | |||
| 1214 | Ga0501083_0204044 | |||
| 1215 | Ga0501083_0404405 | |||
| 1216 | Ga0501083_0630014 | |||
| 1217 | Ga0501035_0158690 | |||
| 1218 | Ga0501035_0583702 | |||
| 1219 | Ga0501044_0197992 | |||
| 1220 | Ga0501044_0499480 | |||
| 1221 | Ga0501045_0040353 | |||
| 1222 | Ga0501045_0114141 | |||
| 1223 | Ga0501045_1273416 | |||
| 1224 | nmdc:mga03n38_141692_c1 | |||
| 1225 | nmdc:mga03n38_52403_c1 | |||
| 1226 | nmdc:mga0yw44_190871_c1 | |||
| 1227 | nmdc:mga05p37_37671_c1 | |||
| 1228 | nmdc:mga06r32_1235444_c1 | |||
| 1229 | nmdc:mga08y16_260485_c1 | |||
| 1230 | nmdc:mga08y16_288196_c1 | |||
| 1231 | nmdc:mga0n895_125476_c1 | |||
| 1232 | nmdc:mga0n895_24130_c1 | |||
| 1233 | nmdc:mga0n895_24973_c1 | |||
| 1234 | nmdc:mga0n895_362939_c1 | |||
| 1235 | nmdc:mga0rr50_57090_c1 | |||
| 1236 | nmdc:mga0rr50_65171_c1 | |||
| 1237 | nmdc:mga0rr50_72928_c1 | |||
| 1238 | nmdc:mga08x19_342840_c1 | |||
| 1239 | nmdc:mga08x19_71783_c1 | |||
| 1240 | nmdc:mga08x19_87484_c1 | |||
| 1241 | nmdc:mga08x19_927575_c1 | |||
| 1242 | nmdc:mga0a205_144391_c1 | |||
| 1243 | nmdc:mga0a205_467458_c1 | |||
| 1244 | nmdc:mga0a205_89817_c1 | |||
| 1245 | Ga0495612_0232440 | |||
| 1246 | Ga0495612_0264138 | |||
| 1247 | Ga0495595_0064817 | |||
| 1248 | Ga0495595_0728355 | |||
| 1249 | Ga0495619_0090926 | |||
| 1250 | Ga0495619_0300034 | |||
| 1251 | Ga0501084_0004754 | |||
| 1252 | Ga0501084_0049774 | |||
| 1253 | Ga0501084_0057952 | |||
| 1254 | Ga0501084_0497594 | |||
| 1255 | Ga0590077_049871 | |||
| 1256 | Ga0590077_055034 | |||
| 1257 | Ga0590077_064131 | |||
| 1258 | Ga0501082_0018931 | |||
| 1259 | Ga0501082_0135570 | |||
| 1260 | Ga0466962_0167499 | |||
| 1261 | Ga0530510_0018090 | |||
| 1262 | Ga0530510_0029857 | |||
| 1263 | Ga0530510_0030029 | |||
| 1264 | Ga0530510_0143076 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d34-assembly1.cif.gz_B | atclps1-peptide complex | 0.9331 | 22 | 101 |
| 7d34-assembly1.cif.gz_B | atclps1-peptide complex | 0.9221 | 22 | 101 |
| 4o2x-assembly2.cif.gz_B | structure of a malarial protein | 0.9158 | 25 | 97 |
| 4o2x-assembly1.cif.gz_A | structure of a malarial protein | 0.9125 | 24 | 97 |
| 3dnj-assembly2.cif.gz_A | the structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide | 0.8967 | 26 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IEB2_84_184_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.934 | 23 | 101 | 3.30.1390.10 |
| af_A0A0R0IJ84_76_154_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.8942 | 14 | 99 | 3.30.1390.10 |
| af_P0A8Q6_1_106_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.8858 | 22 | 100 | 3.30.1390.10 |
| af_A0A0R0IJ84_76_154_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.8834 | 14 | 99 | 3.30.1390.10 |
| 3o1fA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.8645 | 25 | 95 | 3.30.1390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538CPT5-F1-model_v4 | Clp protease ClpS | 0.9714 | 28 | 98 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A2W4VXJ9-F1-model_v4 | Clp protease ClpS | 0.9624 | 28 | 100 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A4P5VM14-F1-model_v4 | ATP-dependent Clp protease adapter protein ClpS | 0.9572 | 22 | 99 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A7S1BRN6-F1-model_v4 | Adaptor protein ClpS core domain-containing protein | 0.9529 | 26 | 101 |
GO:0006508
GO:0030163 |
| AF-W7KBU9-F1-model_v4 | Adaptor protein ClpS core domain-containing protein | 0.9521 | 26 | 100 |
GO:0006508
GO:0030163 |