F470986

General Info

Members Datasets Scaffolds Average Seq Length
632 305 1264 99

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_101537571|Ga0070712_1015375712
Length 109
Sequence LQASRPGRIPGVSTTTPTRKPVRARPGDGSSDRPWQVVVLNDNHNTFEGVASALSTTLPDVGYEQGLRYADWIHRRGRAVVWSGNRERAEMYHERLVGFGLTMAPIQQA

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
178 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
179 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
180 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
181 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
182 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
186 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
187 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
190 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
281 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
299 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
300 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
305 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 8.54
Rhizosphere 89.72
Stem 0
Stem Tuber 0
Unclassified 18.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_101537571 3300006175 Unclassified 582
2 Ga0070658_10914199 3300005327 Unclassified 763
3 Ga0070683_100070093 3300005329 Bacteria 3270
4 Ga0070683_100446194 3300005329 Bacteria 1234
5 Ga0070683_100915081 3300005329 Bacteria 841
6 Ga0070690_100053254 3300005330 Bacteria 2589
7 Ga0068869_101117487 3300005334 Bacteria 690
8 Ga0070680_100781285 3300005336 Bacteria 823
9 Ga0070682_100015627 3300005337 Bacteria 4401
10 Ga0070682_100099321 3300005337 Bacteria 1918
11 Ga0070682_100249453 3300005337 Bacteria 1279
12 Ga0068868_101153365 3300005338 Unclassified 715
13 Ga0068868_101254222 3300005338 Unclassified 687
14 Ga0068868_102056419 3300005338 Unclassified 543
15 Ga0070689_100181940 3300005340 Bacteria 1708
16 Ga0070691_10685648 3300005341 Bacteria 614
17 Ga0070669_101298932 3300005353 Unclassified 630
18 Ga0070671_100221790 3300005355 Bacteria 1604
19 Ga0070671_100954157 3300005355 Bacteria 750
20 Ga0070671_101302674 3300005355 Bacteria 641
21 Ga0070674_101126275 3300005356 Unclassified 694
22 Ga0070673_101240670 3300005364 Bacteria 699
23 Ga0070659_100011416 3300005366 Bacteria 6570
24 Ga0070709_10378255 3300005434 Bacteria 1052
25 Ga0070714_100025537 3300005435 Bacteria 4876
26 Ga0070714_100026104 3300005435 Bacteria 4826
27 Ga0070714_100091443 3300005435 Bacteria 2666
28 Ga0070714_101094558 3300005435 Bacteria 776
29 Ga0070713_102076329 3300005436 Unclassified 551
30 Ga0070711_100086586 3300005439 Bacteria 2247
31 Ga0070711_100658321 3300005439 Unclassified 879
32 Ga0070705_100032102 3300005440 Bacteria 2914
33 Ga0070705_100130208 3300005440 Unclassified 1640
34 Ga0070705_101307985 3300005440 Bacteria 601
35 Ga0070694_100059679 3300005444 Bacteria 2599
36 Ga0070708_101887756 3300005445 Bacteria 554
37 Ga0070678_100014559 3300005456 Bacteria 4969
38 Ga0070678_100891293 3300005456 Bacteria 813
39 Ga0070678_101114858 3300005456 Bacteria 729
40 Ga0070681_10131888 3300005458 Bacteria 2431
41 Ga0070681_11525564 3300005458 Bacteria 593
42 Ga0068867_100246986 3300005459 Bacteria 1450
43 Ga0068867_101401577 3300005459 Bacteria 648
44 Ga0070685_10968139 3300005466 Unclassified 637
45 Ga0070706_101496837 3300005467 Unclassified 617
46 Ga0070707_101527298 3300005468 Unclassified 635
47 Ga0070698_100100528 3300005471 Bacteria 2864
48 Ga0070698_100642939 3300005471 Bacteria 1002
49 Ga0070698_100782518 3300005471 Bacteria 898
50 Ga0070698_101216834 3300005471 Bacteria 703
51 Ga0070699_100484617 3300005518 Bacteria 1122
52 Ga0070679_100033049 3300005530 Bacteria 5120
53 Ga0070679_100959651 3300005530 Bacteria 799
54 Ga0070684_101187815 3300005535 Bacteria 717
55 Ga0070684_101266948 3300005535 Unclassified 694
56 Ga0070697_100800286 3300005536 Unclassified 834
57 Ga0068853_100410500 3300005539 Bacteria 1269
58 Ga0068853_101369059 3300005539 Bacteria 684
59 Ga0070686_101811503 3300005544 Unclassified 520
60 Ga0070695_100649644 3300005545 Bacteria 833
61 Ga0070693_100083132 3300005547 Bacteria 1913
62 Ga0070693_100624525 3300005547 Bacteria 781
63 Ga0070693_100648306 3300005547 Unclassified 768
64 Ga0070693_100952386 3300005547 Unclassified 646
65 Ga0070665_100220084 3300005548 Bacteria 1899
66 Ga0070704_100338605 3300005549 Bacteria 1266
67 Ga0068855_100009022 3300005563 Bacteria 12051
68 Ga0070664_100526247 3300005564 Bacteria 1092
69 Ga0070664_100708584 3300005564 Bacteria 938
70 Ga0068857_100259826 3300005577 Bacteria 1593
71 Ga0068857_101438845 3300005577 Bacteria 671
72 Ga0068854_100062919 3300005578 Bacteria 2692
73 Ga0068854_100098328 3300005578 Bacteria 2190
74 Ga0068854_101037175 3300005578 Bacteria 728
75 Ga0068856_100094384 3300005614 Bacteria 2978
76 Ga0070702_100077472 3300005615 Bacteria 1982
77 Ga0070702_100110118 3300005615 Bacteria 1706
78 Ga0070702_100110184 3300005615 Bacteria 1706
79 Ga0070702_100356808 3300005615 Unclassified 1032
80 Ga0068852_100545223 3300005616 Bacteria 1159
81 Ga0068852_100748112 3300005616 Bacteria 990
82 Ga0068852_101009832 3300005616 Bacteria 851
83 Ga0068859_100796532 3300005617 Bacteria 1033
84 Ga0068864_100815796 3300005618 Bacteria 918
85 Ga0068866_10025396 3300005718 Bacteria 2785
86 Ga0068866_11255425 3300005718 Unclassified 537
87 Ga0068861_100520013 3300005719 Bacteria 1079
88 Ga0068851_10454090 3300005834 Bacteria 762
89 Ga0068870_10358074 3300005840 Bacteria 938
90 Ga0068870_10398738 3300005840 Unclassified 895
91 Ga0068858_100788087 3300005842 Unclassified 927
92 Ga0068858_101325349 3300005842 Bacteria 709
93 Ga0068860_100370570 3300005843 Unclassified 1412
94 Ga0081538_10000221 3300005981 Bacteria 64192
95 Ga0081538_10004784 3300005981 Bacteria 12370
96 Ga0081538_10019803 3300005981 Bacteria 4979
97 Ga0081538_10032755 3300005981 Bacteria 3474
98 Ga0081539_10002360 3300005985 Bacteria 27096
99 Ga0070717_10450521 3300006028 Unclassified 1160
100 Ga0070717_12098336 3300006028 Bacteria 509
101 Ga0075368_10563616 3300006042 Bacteria 513
102 Ga0075363_100104727 3300006048 Bacteria 1568
103 Ga0075363_100316875 3300006048 Bacteria 907
104 Ga0075432_10018806 3300006058 Bacteria 2358
105 Ga0075432_10055332 3300006058 Bacteria 1405
106 Ga0070715_10004326 3300006163 Bacteria 4641
107 Ga0070716_100310276 3300006173 Bacteria 1101
108 Ga0070716_100371692 3300006173 Bacteria 1019
109 Ga0070712_100162474 3300006175 Bacteria 1726
110 Ga0070712_101946650 3300006175 Bacteria 515
111 Ga0097621_100203728 3300006237 Bacteria 1719
112 Ga0097621_100297255 3300006237 Bacteria 1425
113 Ga0068871_100003053 3300006358 Bacteria 11492
114 Ga0068871_101704950 3300006358 Unclassified 598
115 Ga0075431_100822078 3300006847 Unclassified 902
116 Ga0075433_10109537 3300006852 Bacteria 2450
117 Ga0075433_10243476 3300006852 Bacteria 1596
118 Ga0075434_100004473 3300006871 Bacteria 12612
119 Ga0075434_100311894 3300006871 Bacteria 1593
120 Ga0068865_100700361 3300006881 Archaea 865
121 Ga0075436_100010145 3300006914 Bacteria 6450
122 Ga0075436_100017084 3300006914 Bacteria 4966
123 Ga0097620_100796578 3300006931 Bacteria 1033
124 Ga0075435_100000660 3300007076 Bacteria 21225
125 Ga0075435_100068209 3300007076 Bacteria 2897
126 Ga0075435_100265407 3300007076 Bacteria 1463
127 Ga0105240_10015755 3300009093 Bacteria 10259
128 Ga0105240_11919872 3300009093 Bacteria 616
129 Ga0111539_10007815 3300009094 Bacteria 13653
130 Ga0111539_10076408 3300009094 Bacteria 3943
131 Ga0105245_10042601 3300009098 Bacteria 4051
132 Ga0105245_10067016 3300009098 Bacteria 3251
133 Ga0105245_10073253 3300009098 Bacteria 3114
134 Ga0105245_11372997 3300009098 Bacteria 756
135 Ga0105247_10010497 3300009101 Bacteria 5598
136 Ga0105247_10910997 3300009101 Unclassified 680
137 Ga0105247_11651727 3300009101 Bacteria 528
138 Ga0114129_10003593 3300009147 Bacteria 21816
139 Ga0114129_10005368 3300009147 Bacteria 18087
140 Ga0114129_11876190 3300009147 Unclassified 727
141 Ga0105243_10003201 3300009148 Bacteria 13406
142 Ga0105243_10121387 3300009148 Bacteria 2203
143 Ga0105243_10371174 3300009148 Bacteria 1320
144 Ga0105243_11756236 3300009148 Bacteria 650
145 Ga0105241_10070011 3300009174 Bacteria 2721
146 Ga0105241_10555762 3300009174 Unclassified 1031
147 Ga0105242_10877677 3300009176 Bacteria 895
148 Ga0105248_10009991 3300009177 Bacteria 10447
149 Ga0105248_11387424 3300009177 Unclassified 795
150 Ga0105248_12260070 3300009177 Unclassified 619
151 Ga0105238_10046683 3300009551 Bacteria 4369
152 Ga0105238_10653240 3300009551 Unclassified 1062
153 Ga0105238_12080785 3300009551 Bacteria 602
154 Ga0105249_10696436 3300009553 Bacteria 1076
155 Ga0105249_13364556 3300009553 Unclassified 515
156 Ga0105239_10294886 3300010375 Bacteria 1826
157 Ga0105246_10358597 3300011119 Bacteria 1197
158 Ga0105246_10573209 3300011119 Bacteria 971
159 Ga0157320_1005703 3300012481 Bacteria 839
160 Ga0157373_11342264 3300013100 Bacteria 542
161 Ga0157371_10235239 3300013102 Unclassified 1317
162 Ga0157371_10975721 3300013102 Bacteria 645
163 Ga0157369_10248357 3300013105 Unclassified 1858
164 Ga0157369_10393398 3300013105 Bacteria 1438
165 Ga0157378_10037121 3300013297 Bacteria 4315
166 Ga0163162_11103661 3300013306 Unclassified 899
167 Ga0157372_10629417 3300013307 Bacteria 1250
168 Ga0157372_11455357 3300013307 Bacteria 789
169 Ga0157372_12342189 3300013307 Bacteria 613
170 Ga0157372_13430583 3300013307 Unclassified 504
171 Ga0157375_10349169 3300013308 Bacteria 1645
172 Ga0157375_10415626 3300013308 Bacteria 1511
173 Ga0157375_13148358 3300013308 Unclassified 550
174 Ga0163163_11606992 3300014325 Unclassified 711
175 Ga0157380_10600552 3300014326 Bacteria 1089
176 Ga0182008_10000361 3300014497 Bacteria 35414
177 Ga0157377_10054903 3300014745 Bacteria 2257
178 Ga0157377_11184551 3300014745 Unclassified 590
179 Ga0157377_11198483 3300014745 Unclassified 588
180 Ga0157379_10090223 3300014968 Bacteria 2750
181 Ga0157379_10367048 3300014968 Bacteria 1320
182 Ga0157379_10913177 3300014968 Bacteria 833
183 Ga0157376_10032621 3300014969 Bacteria 4184
184 Ga0157376_10920434 3300014969 Unclassified 893
185 Ga0157376_10925038 3300014969 Bacteria 891
186 Ga0163161_11390802 3300017792 Bacteria 613
187 Ga0197907_11390726 3300020069 Unclassified 605
188 Ga0206354_11622190 3300020081 Bacteria 948
189 Ga0207656_10574744 3300025321 Bacteria 575
190 Ga0207653_10133653 3300025885 Bacteria 902
191 Ga0207642_10042546 3300025899 Bacteria 1997
192 Ga0207642_10056177 3300025899 Bacteria 1805
193 Ga0207642_10795967 3300025899 Bacteria 601
194 Ga0207688_10422624 3300025901 Bacteria 828
195 Ga0207680_10055573 3300025903 Bacteria 2386
196 Ga0207699_10161912 3300025906 Bacteria 1490
197 Ga0207699_10604724 3300025906 Bacteria 798
198 Ga0207699_10624245 3300025906 Bacteria 786
199 Ga0207643_10127125 3300025908 Bacteria 1514
200 Ga0207643_10298093 3300025908 Bacteria 1003
201 Ga0207654_10464120 3300025911 Bacteria 890
202 Ga0207707_10084003 3300025912 Bacteria 2780
203 Ga0207707_10682685 3300025912 Bacteria 863
204 Ga0207695_10019579 3300025913 Bacteria 7788
205 Ga0207671_10543537 3300025914 Unclassified 926
206 Ga0207693_10081154 3300025915 Bacteria 2539
207 Ga0207693_10979109 3300025915 Bacteria 647
208 Ga0207663_11043109 3300025916 Bacteria 656
209 Ga0207660_10678880 3300025917 Bacteria 840
210 Ga0207660_10991148 3300025917 Unclassified 685
211 Ga0207660_11175484 3300025917 Bacteria 624
212 Ga0207662_10747641 3300025918 Bacteria 687
213 Ga0207657_10177939 3300025919 Bacteria 1721
214 Ga0207652_10020819 3300025921 Bacteria 5406
215 Ga0207652_10468373 3300025921 Bacteria 1135
216 Ga0207652_10834385 3300025921 Bacteria 817
217 Ga0207646_10384721 3300025922 Unclassified 1267
218 Ga0207646_10676874 3300025922 Bacteria 923
219 Ga0207646_11292028 3300025922 Unclassified 637
220 Ga0207694_10426371 3300025924 Unclassified 1105
221 Ga0207694_10865037 3300025924 Unclassified 764
222 Ga0207687_10055763 3300025927 Bacteria 2770
223 Ga0207687_10554334 3300025927 Unclassified 965
224 Ga0207664_10037798 3300025929 Bacteria 3739
225 Ga0207664_10110506 3300025929 Bacteria 2285
226 Ga0207664_10345922 3300025929 Bacteria 1315
227 Ga0207644_10526483 3300025931 Bacteria 977
228 Ga0207644_10625233 3300025931 Bacteria 895
229 Ga0207706_10142570 3300025933 Bacteria 2108
230 Ga0207686_10119821 3300025934 Bacteria 1789
231 Ga0207686_11566826 3300025934 Unclassified 544
232 Ga0207709_10010548 3300025935 Bacteria 5088
233 Ga0207709_10161088 3300025935 Archaea 1565
234 Ga0207709_10317336 3300025935 Bacteria 1165
235 Ga0207670_10350117 3300025936 Bacteria 1169
236 Ga0207669_10283982 3300025937 Bacteria 1250
237 Ga0207669_11246475 3300025937 Bacteria 631
238 Ga0207704_10881664 3300025938 Unclassified 751
239 Ga0207704_11005072 3300025938 Unclassified 705
240 Ga0207665_10228475 3300025939 Bacteria 1367
241 Ga0207665_11008240 3300025939 Unclassified 662
242 Ga0207711_10009223 3300025941 Bacteria 8239
243 Ga0207661_10011570 3300025944 Bacteria 6400
244 Ga0207661_10199002 3300025944 Bacteria 1760
245 Ga0207679_10328132 3300025945 Bacteria 1327
246 Ga0207679_10675732 3300025945 Unclassified 936
247 Ga0207667_10132577 3300025949 Bacteria 2566
248 Ga0207667_10408232 3300025949 Bacteria 1383
249 Ga0207651_10345238 3300025960 Bacteria 1252
250 Ga0207712_10783825 3300025961 Bacteria 837
251 Ga0207640_10051691 3300025981 Bacteria 2673
252 Ga0207640_10053201 3300025981 Bacteria 2642
253 Ga0207640_10344961 3300025981 Unclassified 1194
254 Ga0207677_10168990 3300026023 Unclassified 1708
255 Ga0207677_10223622 3300026023 Bacteria 1511
256 Ga0207677_10407783 3300026023 Bacteria 1154
257 Ga0207677_11621192 3300026023 Unclassified 599
258 Ga0207703_10726179 3300026035 Unclassified 945
259 Ga0207703_10811220 3300026035 Bacteria 894
260 Ga0207639_10822450 3300026041 Unclassified 866
261 Ga0207639_11811982 3300026041 Unclassified 571
262 Ga0207678_11108805 3300026067 Unclassified 701
263 Ga0207708_10104712 3300026075 Bacteria 2192
264 Ga0207702_10024617 3300026078 Bacteria 4996
265 Ga0207702_10163196 3300026078 Bacteria 2036
266 Ga0207702_10696649 3300026078 Bacteria 1001
267 Ga0207648_10022889 3300026089 Bacteria 5604
268 Ga0207648_11704906 3300026089 Unclassified 592
269 Ga0207676_10284917 3300026095 Bacteria 1502
270 Ga0207674_10032416 3300026116 Bacteria 5481
271 Ga0207675_100206264 3300026118 Bacteria 1889
272 Ga0207675_101541248 3300026118 Bacteria 685
273 Ga0207683_10001018 3300026121 Bacteria 25542
274 Ga0207683_10024729 3300026121 Bacteria 5175
275 Ga0207683_11256825 3300026121 Bacteria 686
276 Ga0207698_10167354 3300026142 Bacteria 1931
277 Ga0207698_10607230 3300026142 Bacteria 1079
278 Ga0207428_10250180 3300027907 Bacteria 1322
279 Ga0207428_11083316 3300027907 Bacteria 561
280 Ga0268266_11102337 3300028379 Bacteria 768
281 Ga0268265_11701427 3300028380 Bacteria 637
282 Ga0268264_10901705 3300028381 Bacteria 887
283 Ga0265319_1018240 3300028563 Bacteria 2648
284 Ga0265339_10186504 3300031249 Bacteria 1031
285 Ga0265327_10113675 3300031251 Unclassified 1290
286 Ga0265327_10182125 3300031251 Bacteria 960
287 Ga0265327_10297070 3300031251 Bacteria 712
288 Ga0307408_100304850 3300031548 Bacteria 1336
289 Ga0307413_10389860 3300031824 Bacteria 1088
290 Ga0307407_11343693 3300031903 Bacteria 562
291 Ga0307412_10644694 3300031911 Bacteria 903
292 Ga0307416_100706351 3300032002 Bacteria 1098
293 Ga0373944_0096341 3300035089 Unclassified 995
294 Ga0373956_0423083 3300035119 Bacteria 636
295 Ga0373946_0111394 3300035171 Unclassified 1239
296 Ga0373955_0477251 3300035172 Bacteria 761
297 Ga0316574_0024404 3300035398 Bacteria 3618
298 Ga0373935_0534905 3300035692 Bacteria 853
299 Ga0373935_0770798 3300035692 Bacteria 709
300 Ga0373947_1235917 3300035725 Unclassified 509
301 Ga0373937_0298981 3300036401 Archaea 1521
302 Ga0373937_0476382 3300036401 Bacteria 1186
303 Ga0373925_0207978 3300037068 Bacteria 1558
304 Ga0373925_1702723 3300037068 Unclassified 515
305 Ga0395900_0298910 3300037418 Bacteria 1597
306 Ga0395898_0570807 3300037466 Unclassified 1074
307 Ga0395898_0953614 3300037466 Bacteria 795
308 Ga0395898_1271103 3300037466 Bacteria 666
309 Ga0395898_1497752 3300037466 Bacteria 601
310 Ga0395905_0689865 3300037471 Bacteria 923
311 Ga0436364_0117682 3300037853 Bacteria 1102
312 Ga0436364_1256770 3300037853 Bacteria 903
313 Ga0395901_0734120 3300038443 Bacteria 982
314 Ga0395901_0762232 3300038443 Bacteria 960
315 Ga0395901_1118383 3300038443 Bacteria 757
316 Ga0395901_1328778 3300038443 Bacteria 680
317 Ga0436363_0707026 3300039450 Bacteria 1905
318 Ga0439438_024862 3300041405 Bacteria 1637
319 Ga0439438_090063 3300041405 Bacteria 748
320 Ga0439447_112720 3300041407 Bacteria 624
321 Ga0439461_0058942 3300041410 Bacteria 868
322 Ga0439466_0061828 3300041411 Unclassified 1205
323 Ga0439466_0206254 3300041411 Bacteria 597
324 Ga0439465_0085901 3300041413 Bacteria 1072
325 Ga0451791_0585133 3300041451 Bacteria 1174
326 Ga0451853_3277767 3300041512 Unclassified 961
327 Ga0439431_0006136 3300041997 Bacteria 2655
328 Ga0439431_0117579 3300041997 Bacteria 740
329 Ga0439445_0122398 3300042004 Bacteria 747
330 Ga0439445_0146044 3300042004 Bacteria 687
331 Ga0439455_0118718 3300042012 Bacteria 740
332 Ga0450907_045084 3300042146 Bacteria 756
333 Ga0439446_0127744 3300042156 Unclassified 822
334 Ga0439446_0155135 3300042156 Bacteria 755
335 Ga0439458_0113846 3300042157 Unclassified 709
336 Ga0450918_028506 3300042531 Bacteria 983
337 Ga0466965_0088820 3300044683 Bacteria 1570
338 Ga0466963_0008195 3300044694 Bacteria 6261
339 Ga0466963_0019581 3300044694 Bacteria 4247
340 Ga0466963_0044331 3300044694 Bacteria 2928
341 Ga0466963_0058630 3300044694 Bacteria 2567
342 Ga0466964_0000074 3300044706 Bacteria 22392
343 Ga0466964_0060419 3300044706 Bacteria 1576
344 Ga0466964_0764393 3300044706 Unclassified 543
345 Ga0466971_0084796 3300044719 Bacteria 1447
346 Ga0466971_0264443 3300044719 Bacteria 821
347 Ga0466968_0134441 3300044735 Unclassified 1127
348 Ga0466968_0289544 3300044735 Bacteria 785
349 Ga0466968_0336294 3300044735 Bacteria 731
350 Ga0466968_0439109 3300044735 Unclassified 644
351 Ga0466968_0545460 3300044735 Bacteria 581
352 Ga0466957_0006182 3300044842 Bacteria 6760
353 Ga0466957_0139750 3300044842 Bacteria 1559
354 Ga0466957_1212676 3300044842 Bacteria 546
355 Ga0466960_0020917 3300044901 Bacteria 2906
356 Ga0466960_0120225 3300044901 Bacteria 1375
357 Ga0466960_0364623 3300044901 Bacteria 826
358 Ga0466960_0479444 3300044901 Bacteria 726
359 Ga0466960_0488440 3300044901 Bacteria 720
360 Ga0466960_0945234 3300044901 Bacteria 527
361 Ga0466958_0038363 3300045836 Bacteria 2874
362 Ga0466958_0131457 3300045836 Bacteria 1572
363 Ga0466958_0453071 3300045836 Bacteria 831
364 Ga0466958_0622502 3300045836 Bacteria 702
365 Ga0466967_0000085 3300045976 Bacteria 34226
366 Ga0466967_0011298 3300045976 Bacteria 6752
367 Ga0466967_0020251 3300045976 Bacteria 5371
368 Ga0466967_0096466 3300045976 Bacteria 2697
369 Ga0466967_0190495 3300045976 Bacteria 1938
370 Ga0466967_0197231 3300045976 Bacteria 1905
371 Ga0466967_0323051 3300045976 Bacteria 1489
372 Ga0466967_0679461 3300045976 Bacteria 1019
373 Ga0466967_1399067 3300045976 Bacteria 697
374 Ga0495592_0274122 3300046454 Bacteria 1106
375 Ga0495592_0751947 3300046454 Unclassified 582
376 Ga0495603_0064684 3300046455 Bacteria 2156
377 Ga0495651_0460834 3300046462 Unclassified 820
378 Ga0495653_0282852 3300046463 Bacteria 1088
379 Ga0495653_0913060 3300046463 Unclassified 523
380 Ga0495582_0100252 3300046473 Bacteria 1621
381 Ga0495584_0210291 3300046491 Bacteria 989
382 Ga0495594_0651625 3300046499 Bacteria 596
383 Ga0495607_0273148 3300046501 Bacteria 805
384 Ga0495608_0042798 3300046511 Bacteria 3028
385 Ga0495616_0074977 3300046513 Bacteria 1629
386 Ga0495618_0156803 3300046514 Bacteria 1453
387 Ga0495620_0214505 3300046515 Bacteria 738
388 Ga0495628_0230556 3300046516 Bacteria 1388
389 Ga0495631_0195647 3300046518 Bacteria 865
390 Ga0495642_0439786 3300046528 Bacteria 576
391 Ga0495652_0597984 3300046529 Unclassified 753
392 Ga0495652_1115613 3300046529 Unclassified 511
393 Ga0495587_0185079 3300046536 Bacteria 1180
394 Ga0495587_0350800 3300046536 Bacteria 822
395 Ga0495587_0667181 3300046536 Unclassified 571
396 Ga0495609_0305128 3300046538 Bacteria 648
397 Ga0495609_0312056 3300046538 Bacteria 639
398 Ga0495645_0090953 3300046543 Bacteria 2180
399 Ga0495667_0058393 3300046559 Archaea 2535
400 Ga0495667_0288955 3300046559 Bacteria 1040
401 Ga0495667_0289237 3300046559 Unclassified 1039
402 Ga0495667_0693375 3300046559 Bacteria 631
403 Ga0495656_0055380 3300046615 Bacteria 1710
404 Ga0495656_0204299 3300046615 Bacteria 982
405 Ga0495611_0112324 3300046648 Bacteria 1269
406 Ga0495611_0447751 3300046648 Bacteria 589
407 Ga0495635_0149151 3300046663 Bacteria 1592
408 Ga0495635_0464492 3300046663 Bacteria 836
409 Ga0495635_0717470 3300046663 Unclassified 647
410 Ga0495661_0098631 3300046665 Bacteria 1649
411 Ga0495588_0314623 3300046674 Bacteria 824
412 Ga0495657_0288026 3300046675 Unclassified 982
413 Ga0495657_0387931 3300046675 Unclassified 823
414 Ga0495657_0878148 3300046675 Unclassified 510
415 Ga0495599_0063778 3300046678 Bacteria 2302
416 Ga0495623_0108370 3300046679 Bacteria 1686
417 Ga0495647_0251352 3300046681 Bacteria 787
418 Ga0495658_0098316 3300046683 Bacteria 1743
419 Ga0495613_0860318 3300046689 Unclassified 589
420 Ga0495670_0481399 3300046691 Bacteria 673
421 Ga0495600_0521628 3300046809 Unclassified 728
422 Ga0495581_0344103 3300047315 Unclassified 870
423 Ga0495581_0738431 3300047315 Bacteria 567
424 Ga0495604_0133818 3300047317 Bacteria 1779
425 Ga0495674_0084511 3300047319 Bacteria 2720
426 Ga0495674_0273332 3300047319 Bacteria 1386
427 Ga0495674_0736897 3300047319 Unclassified 771
428 Ga0495674_1064855 3300047319 Unclassified 617
429 Ga0495676_0110527 3300047321 Bacteria 2017
430 Ga0495680_0088030 3300047322 Bacteria 2335
431 Ga0495680_0231598 3300047322 Unclassified 1315
432 Ga0495680_0538932 3300047322 Unclassified 788
433 Ga0495684_0079703 3300047471 Bacteria 2486
434 Ga0495684_0387076 3300047471 Unclassified 985
435 Ga0495593_0348454 3300047673 Unclassified 740
436 Ga0495602_0287807 3300048088 Unclassified 1208
437 Ga0495602_0735767 3300048088 Unclassified 667
438 Ga0495602_0791690 3300048088 Unclassified 637
439 Ga0496100_0010783 3300048903 Bacteria 5185
440 Ga0496100_0013930 3300048903 Bacteria 4654
441 Ga0496100_1199516 3300048903 Unclassified 599
442 Ga0496101_0015201 3300048904 Bacteria 5181
443 Ga0496101_0019335 3300048904 Bacteria 4649
444 Ga0496101_0584309 3300048904 Bacteria 883
445 Ga0496101_1374275 3300048904 Bacteria 551
446 Ga0496102_0151621 3300048905 Bacteria 2178
447 Ga0496102_0580302 3300048905 Bacteria 1044
448 Ga0496102_0848732 3300048905 Unclassified 835
449 Ga0496102_1410453 3300048905 Bacteria 615
450 Ga0496104_0010883 3300048907 Bacteria 8137
451 Ga0496104_0112440 3300048907 Bacteria 2611
452 Ga0496104_0618463 3300048907 Unclassified 993
453 Ga0496104_1712220 3300048907 Bacteria 531
454 Ga0496105_0088723 3300048908 Bacteria 2555
455 Ga0496105_0122417 3300048908 Bacteria 2145
456 Ga0496105_0203759 3300048908 Bacteria 1614
457 Ga0496105_0843203 3300048908 Unclassified 694
458 Ga0496105_1245874 3300048908 Bacteria 546
459 Ga0496105_1368934 3300048908 Bacteria 514
460 Ga0496106_0002385 3300048909 Bacteria 13997
461 Ga0496106_0243722 3300048909 Bacteria 1436
462 Ga0496106_0823736 3300048909 Bacteria 735
463 Ga0496106_1088012 3300048909 Bacteria 627
464 Ga0496107_0004303 3300048910 Bacteria 9634
465 Ga0496107_0032595 3300048910 Bacteria 3724
466 Ga0496108_0105986 3300048911 Bacteria 2400
467 Ga0496108_0117442 3300048911 Bacteria 2279
468 Ga0496108_0612590 3300048911 Bacteria 948
469 Ga0496108_1801576 3300048911 Bacteria 501
470 Ga0496109_0018827 3300048912 Bacteria 6075
471 Ga0496109_0027027 3300048912 Bacteria 5120
472 Ga0496109_0059523 3300048912 Bacteria 3490
473 Ga0496109_0648305 3300048912 Bacteria 993
474 Ga0496109_1116642 3300048912 Bacteria 725
475 Ga0496109_1804567 3300048912 Bacteria 545
476 Ga0496110_0012994 3300048913 Bacteria 6868
477 Ga0496110_1297524 3300048913 Bacteria 637
478 Ga0496111_0314600 3300048914 Unclassified 1160
479 Ga0496112_0030532 3300048915 Bacteria 5216
480 Ga0496112_0422261 3300048915 Unclassified 1272
481 Ga0496112_1547590 3300048915 Unclassified 577
482 Ga0496113_0122586 3300048916 Bacteria 2034
483 Ga0496113_0136445 3300048916 Bacteria 1928
484 Ga0496113_0389711 3300048916 Bacteria 1118
485 Ga0496113_1583686 3300048916 Bacteria 504
486 Ga0496114_0002539 3300048917 Bacteria 13928
487 Ga0496114_0003443 3300048917 Bacteria 12139
488 Ga0496114_0422075 3300048917 Unclassified 1181
489 Ga0496114_1688214 3300048917 Unclassified 521
490 Ga0496115_0263923 3300048918 Bacteria 1416
491 Ga0496115_0998381 3300048918 Bacteria 640
492 Ga0496119_0544323 3300048922 Bacteria 535
493 Ga0501031_0014017 3300049568 Bacteria 5218
494 Ga0501031_0045604 3300049568 Bacteria 2860
495 Ga0501031_0075164 3300049568 Bacteria 2200
496 Ga0501031_0918093 3300049568 Bacteria 560
497 Ga0501032_0043422 3300049569 Bacteria 3045
498 Ga0501033_0206573 3300049570 Bacteria 1402
499 Ga0501033_0247851 3300049570 Bacteria 1263
500 Ga0501034_0790579 3300049571 Unclassified 842
501 Ga0501034_1542401 3300049571 Bacteria 538
502 Ga0501036_0007855 3300049572 Bacteria 8726
503 Ga0501036_0051786 3300049572 Bacteria 3477
504 Ga0501036_0246521 3300049572 Bacteria 1497
505 Ga0501038_0018767 3300049574 Bacteria 6243
506 Ga0501038_0115124 3300049574 Bacteria 2223
507 Ga0501038_1103656 3300049574 Bacteria 579
508 Ga0501039_0001712 3300049575 Bacteria 16164
509 Ga0501039_0437870 3300049575 Unclassified 1027
510 Ga0501039_0471698 3300049575 Bacteria 985
511 Ga0501039_0540282 3300049575 Bacteria 915
512 Ga0501040_0000277 3300049576 Bacteria 29945
513 Ga0501040_0296282 3300049576 Bacteria 1156
514 Ga0501040_0324999 3300049576 Bacteria 1100
515 Ga0501040_0858621 3300049576 Bacteria 657
516 Ga0501041_0008506 3300049577 Bacteria 6039
517 Ga0501041_0011520 3300049577 Bacteria 5228
518 Ga0501041_0248793 3300049577 Bacteria 1117
519 Ga0501041_0737965 3300049577 Bacteria 631
520 Ga0501042_0012096 3300049578 Bacteria 5839
521 Ga0501042_0018925 3300049578 Bacteria 4775
522 Ga0501042_0206569 3300049578 Bacteria 1416
523 Ga0501042_0331458 3300049578 Bacteria 1100
524 Ga0501043_0048139 3300049579 Bacteria 3352
525 Ga0501043_0162329 3300049579 Bacteria 1746
526 Ga0501043_0364872 3300049579 Bacteria 1096
527 Ga0501046_0071522 3300049580 Bacteria 2695
528 Ga0501046_0446527 3300049580 Bacteria 930
529 Ga0501046_0474142 3300049580 Bacteria 898
530 Ga0501047_0009779 3300049581 Bacteria 9063
531 Ga0501047_0146144 3300049581 Bacteria 2241
532 Ga0501047_0222024 3300049581 Bacteria 1746
533 Ga0501048_0000708 3300049582 Bacteria 24352
534 Ga0501048_0004389 3300049582 Bacteria 10742
535 Ga0501048_0171186 3300049582 Bacteria 1538
536 Ga0501067_0003599 3300049583 Bacteria 8533
537 Ga0501067_0011607 3300049583 Bacteria 4879
538 Ga0501067_0060330 3300049583 Bacteria 2099
539 Ga0501067_0232370 3300049583 Bacteria 1026
540 Ga0501068_0000257 3300049584 Bacteria 26197
541 Ga0501068_0033018 3300049584 Bacteria 3080
542 Ga0501068_0057026 3300049584 Bacteria 2368
543 Ga0501068_0099103 3300049584 Bacteria 1805
544 Ga0501068_0385055 3300049584 Bacteria 903
545 Ga0501069_0000272 3300049585 Bacteria 23453
546 Ga0501069_0048331 3300049585 Bacteria 2362
547 Ga0501069_0088038 3300049585 Bacteria 1755
548 Ga0501069_0092337 3300049585 Unclassified 1712
549 Ga0501069_0253045 3300049585 Bacteria 1028
550 Ga0501070_0104502 3300049586 Bacteria 2342
551 Ga0501070_0289239 3300049586 Bacteria 1336
552 Ga0501070_1206482 3300049586 Bacteria 580
553 Ga0501071_0002683 3300049587 Bacteria 10896
554 Ga0501071_0027266 3300049587 Bacteria 4018
555 Ga0501071_0360914 3300049587 Bacteria 1106
556 Ga0501072_0027255 3300049588 Bacteria 4458
557 Ga0501072_0059069 3300049588 Bacteria 3023
558 Ga0501072_0129832 3300049588 Bacteria 2008
559 Ga0501074_0008236 3300049590 Bacteria 7559
560 Ga0501074_0027140 3300049590 Bacteria 4151
561 Ga0501074_0264233 3300049590 Bacteria 1223
562 Ga0501075_0013959 3300049591 Bacteria 5747
563 Ga0501075_0056510 3300049591 Bacteria 2954
564 Ga0501075_0196741 3300049591 Bacteria 1537
565 Ga0501076_0002850 3300049592 Bacteria 11964
566 Ga0501076_0420603 3300049592 Bacteria 1099
567 Ga0501077_0048537 3300049593 Bacteria 2697
568 Ga0501077_0147070 3300049593 Bacteria 1495
569 Ga0501077_0502494 3300049593 Bacteria 777
570 Ga0501248_033947 3300049678 Unclassified 596
571 Ga0501079_0009452 3300049741 Bacteria 7391
572 Ga0501079_0086486 3300049741 Bacteria 2426
573 Ga0501079_0133805 3300049741 Bacteria 1930
574 Ga0501080_0046331 3300049742 Bacteria 4048
575 Ga0501080_0089150 3300049742 Bacteria 2865
576 Ga0501080_0166164 3300049742 Bacteria 2036
577 Ga0501080_0718356 3300049742 Bacteria 880
578 Ga0501080_0881800 3300049742 Bacteria 781
579 Ga0501081_0006855 3300049743 Bacteria 7407
580 Ga0501081_0284709 3300049743 Bacteria 1210
581 Ga0501083_0107789 3300049744 Bacteria 1833
582 Ga0501083_0204044 3300049744 Bacteria 1289
583 Ga0501083_0404405 3300049744 Bacteria 888
584 Ga0501083_0630014 3300049744 Viruses 698
585 Ga0501035_0158690 3300049822 Bacteria 1959
586 Ga0501035_0583702 3300049822 Unclassified 912
587 Ga0501044_0197992 3300049823 Bacteria 1968
588 Ga0501044_0499480 3300049823 Bacteria 1118
589 Ga0501045_0040353 3300049824 Bacteria 3397
590 Ga0501045_0114141 3300049824 Bacteria 2003
591 Ga0501045_1273416 3300049824 Bacteria 535
592 nmdc:mga03n38_141692_c1 3300050490 Bacteria 1201
593 nmdc:mga03n38_52403_c1 3300050490 Bacteria 1826
594 nmdc:mga0yw44_190871_c1 3300050492 Bacteria 1351
595 nmdc:mga05p37_37671_c1 3300050507 Bacteria 5931
596 nmdc:mga06r32_1235444_c1 3300050510 Unclassified 693
597 nmdc:mga08y16_260485_c1 3300050511 Bacteria 1791
598 nmdc:mga08y16_288196_c1 3300050511 Bacteria 1693
599 nmdc:mga0n895_125476_c1 3300050512 Bacteria 2590
600 nmdc:mga0n895_24130_c1 3300050512 Bacteria 5728
601 nmdc:mga0n895_24973_c1 3300050512 Bacteria 5640
602 nmdc:mga0n895_362939_c1 3300050512 Bacteria 1467
603 nmdc:mga0rr50_57090_c1 3300050513 Bacteria 2919
604 nmdc:mga0rr50_65171_c1 3300050513 Bacteria 2759
605 nmdc:mga0rr50_72928_c1 3300050513 Bacteria 2623
606 nmdc:mga08x19_342840_c1 3300050514 Bacteria 1042
607 nmdc:mga08x19_71783_c1 3300050514 Bacteria 2258
608 nmdc:mga08x19_87484_c1 3300050514 Bacteria 2053
609 nmdc:mga08x19_927575_c1 3300050514 Bacteria 618
610 nmdc:mga0a205_144391_c1 3300050515 Bacteria 2280
611 nmdc:mga0a205_467458_c1 3300050515 Unclassified 1120
612 nmdc:mga0a205_89817_c1 3300050515 Bacteria 2969
613 Ga0495612_0232440 3300053078 Unclassified 818
614 Ga0495612_0264138 3300053078 Unclassified 767
615 Ga0495595_0064817 3300053084 Archaea 1718
616 Ga0495595_0728355 3300053084 Unclassified 508
617 Ga0495619_0090926 3300053085 Bacteria 2066
618 Ga0495619_0300034 3300053085 Bacteria 1113
619 Ga0501084_0004754 3300054114 Bacteria 11098
620 Ga0501084_0049774 3300054114 Bacteria 3507
621 Ga0501084_0057952 3300054114 Bacteria 3241
622 Ga0501084_0497594 3300054114 Bacteria 1030
623 Ga0590077_049871 3300059426 Bacteria 938
624 Ga0590077_055034 3300059426 Bacteria 897
625 Ga0590077_064131 3300059426 Unclassified 835
626 Ga0501082_0018931 3300060353 Bacteria 5932
627 Ga0501082_0135570 3300060353 Bacteria 2136
628 Ga0466962_0167499 3300061719 Bacteria 1069
629 Ga0530510_0018090 3300061734 Bacteria 4995
630 Ga0530510_0029857 3300061734 Bacteria 3914
631 Ga0530510_0030029 3300061734 Bacteria 3903
632 Ga0530510_0143076 3300061734 Bacteria 1763
633 Ga0070712_101537571
634 Ga0070658_10914199
635 Ga0070683_100070093
636 Ga0070683_100446194
637 Ga0070683_100915081
638 Ga0070690_100053254
639 Ga0068869_101117487
640 Ga0070680_100781285
641 Ga0070682_100015627
642 Ga0070682_100099321
643 Ga0070682_100249453
644 Ga0068868_101153365
645 Ga0068868_101254222
646 Ga0068868_102056419
647 Ga0070689_100181940
648 Ga0070691_10685648
649 Ga0070669_101298932
650 Ga0070671_100221790
651 Ga0070671_100954157
652 Ga0070671_101302674
653 Ga0070674_101126275
654 Ga0070673_101240670
655 Ga0070659_100011416
656 Ga0070709_10378255
657 Ga0070714_100025537
658 Ga0070714_100026104
659 Ga0070714_100091443
660 Ga0070714_101094558
661 Ga0070713_102076329
662 Ga0070711_100086586
663 Ga0070711_100658321
664 Ga0070705_100032102
665 Ga0070705_100130208
666 Ga0070705_101307985
667 Ga0070694_100059679
668 Ga0070708_101887756
669 Ga0070678_100014559
670 Ga0070678_100891293
671 Ga0070678_101114858
672 Ga0070681_10131888
673 Ga0070681_11525564
674 Ga0068867_100246986
675 Ga0068867_101401577
676 Ga0070685_10968139
677 Ga0070706_101496837
678 Ga0070707_101527298
679 Ga0070698_100100528
680 Ga0070698_100642939
681 Ga0070698_100782518
682 Ga0070698_101216834
683 Ga0070699_100484617
684 Ga0070679_100033049
685 Ga0070679_100959651
686 Ga0070684_101187815
687 Ga0070684_101266948
688 Ga0070697_100800286
689 Ga0068853_100410500
690 Ga0068853_101369059
691 Ga0070686_101811503
692 Ga0070695_100649644
693 Ga0070693_100083132
694 Ga0070693_100624525
695 Ga0070693_100648306
696 Ga0070693_100952386
697 Ga0070665_100220084
698 Ga0070704_100338605
699 Ga0068855_100009022
700 Ga0070664_100526247
701 Ga0070664_100708584
702 Ga0068857_100259826
703 Ga0068857_101438845
704 Ga0068854_100062919
705 Ga0068854_100098328
706 Ga0068854_101037175
707 Ga0068856_100094384
708 Ga0070702_100077472
709 Ga0070702_100110118
710 Ga0070702_100110184
711 Ga0070702_100356808
712 Ga0068852_100545223
713 Ga0068852_100748112
714 Ga0068852_101009832
715 Ga0068859_100796532
716 Ga0068864_100815796
717 Ga0068866_10025396
718 Ga0068866_11255425
719 Ga0068861_100520013
720 Ga0068851_10454090
721 Ga0068870_10358074
722 Ga0068870_10398738
723 Ga0068858_100788087
724 Ga0068858_101325349
725 Ga0068860_100370570
726 Ga0081538_10000221
727 Ga0081538_10004784
728 Ga0081538_10019803
729 Ga0081538_10032755
730 Ga0081539_10002360
731 Ga0070717_10450521
732 Ga0070717_12098336
733 Ga0075368_10563616
734 Ga0075363_100104727
735 Ga0075363_100316875
736 Ga0075432_10018806
737 Ga0075432_10055332
738 Ga0070715_10004326
739 Ga0070716_100310276
740 Ga0070716_100371692
741 Ga0070712_100162474
742 Ga0070712_101946650
743 Ga0097621_100203728
744 Ga0097621_100297255
745 Ga0068871_100003053
746 Ga0068871_101704950
747 Ga0075431_100822078
748 Ga0075433_10109537
749 Ga0075433_10243476
750 Ga0075434_100004473
751 Ga0075434_100311894
752 Ga0068865_100700361
753 Ga0075436_100010145
754 Ga0075436_100017084
755 Ga0097620_100796578
756 Ga0075435_100000660
757 Ga0075435_100068209
758 Ga0075435_100265407
759 Ga0105240_10015755
760 Ga0105240_11919872
761 Ga0111539_10007815
762 Ga0111539_10076408
763 Ga0105245_10042601
764 Ga0105245_10067016
765 Ga0105245_10073253
766 Ga0105245_11372997
767 Ga0105247_10010497
768 Ga0105247_10910997
769 Ga0105247_11651727
770 Ga0114129_10003593
771 Ga0114129_10005368
772 Ga0114129_11876190
773 Ga0105243_10003201
774 Ga0105243_10121387
775 Ga0105243_10371174
776 Ga0105243_11756236
777 Ga0105241_10070011
778 Ga0105241_10555762
779 Ga0105242_10877677
780 Ga0105248_10009991
781 Ga0105248_11387424
782 Ga0105248_12260070
783 Ga0105238_10046683
784 Ga0105238_10653240
785 Ga0105238_12080785
786 Ga0105249_10696436
787 Ga0105249_13364556
788 Ga0105239_10294886
789 Ga0105246_10358597
790 Ga0105246_10573209
791 Ga0157320_1005703
792 Ga0157373_11342264
793 Ga0157371_10235239
794 Ga0157371_10975721
795 Ga0157369_10248357
796 Ga0157369_10393398
797 Ga0157378_10037121
798 Ga0163162_11103661
799 Ga0157372_10629417
800 Ga0157372_11455357
801 Ga0157372_12342189
802 Ga0157372_13430583
803 Ga0157375_10349169
804 Ga0157375_10415626
805 Ga0157375_13148358
806 Ga0163163_11606992
807 Ga0157380_10600552
808 Ga0182008_10000361
809 Ga0157377_10054903
810 Ga0157377_11184551
811 Ga0157377_11198483
812 Ga0157379_10090223
813 Ga0157379_10367048
814 Ga0157379_10913177
815 Ga0157376_10032621
816 Ga0157376_10920434
817 Ga0157376_10925038
818 Ga0163161_11390802
819 Ga0197907_11390726
820 Ga0206354_11622190
821 Ga0207656_10574744
822 Ga0207653_10133653
823 Ga0207642_10042546
824 Ga0207642_10056177
825 Ga0207642_10795967
826 Ga0207688_10422624
827 Ga0207680_10055573
828 Ga0207699_10161912
829 Ga0207699_10604724
830 Ga0207699_10624245
831 Ga0207643_10127125
832 Ga0207643_10298093
833 Ga0207654_10464120
834 Ga0207707_10084003
835 Ga0207707_10682685
836 Ga0207695_10019579
837 Ga0207671_10543537
838 Ga0207693_10081154
839 Ga0207693_10979109
840 Ga0207663_11043109
841 Ga0207660_10678880
842 Ga0207660_10991148
843 Ga0207660_11175484
844 Ga0207662_10747641
845 Ga0207657_10177939
846 Ga0207652_10020819
847 Ga0207652_10468373
848 Ga0207652_10834385
849 Ga0207646_10384721
850 Ga0207646_10676874
851 Ga0207646_11292028
852 Ga0207694_10426371
853 Ga0207694_10865037
854 Ga0207687_10055763
855 Ga0207687_10554334
856 Ga0207664_10037798
857 Ga0207664_10110506
858 Ga0207664_10345922
859 Ga0207644_10526483
860 Ga0207644_10625233
861 Ga0207706_10142570
862 Ga0207686_10119821
863 Ga0207686_11566826
864 Ga0207709_10010548
865 Ga0207709_10161088
866 Ga0207709_10317336
867 Ga0207670_10350117
868 Ga0207669_10283982
869 Ga0207669_11246475
870 Ga0207704_10881664
871 Ga0207704_11005072
872 Ga0207665_10228475
873 Ga0207665_11008240
874 Ga0207711_10009223
875 Ga0207661_10011570
876 Ga0207661_10199002
877 Ga0207679_10328132
878 Ga0207679_10675732
879 Ga0207667_10132577
880 Ga0207667_10408232
881 Ga0207651_10345238
882 Ga0207712_10783825
883 Ga0207640_10051691
884 Ga0207640_10053201
885 Ga0207640_10344961
886 Ga0207677_10168990
887 Ga0207677_10223622
888 Ga0207677_10407783
889 Ga0207677_11621192
890 Ga0207703_10726179
891 Ga0207703_10811220
892 Ga0207639_10822450
893 Ga0207639_11811982
894 Ga0207678_11108805
895 Ga0207708_10104712
896 Ga0207702_10024617
897 Ga0207702_10163196
898 Ga0207702_10696649
899 Ga0207648_10022889
900 Ga0207648_11704906
901 Ga0207676_10284917
902 Ga0207674_10032416
903 Ga0207675_100206264
904 Ga0207675_101541248
905 Ga0207683_10001018
906 Ga0207683_10024729
907 Ga0207683_11256825
908 Ga0207698_10167354
909 Ga0207698_10607230
910 Ga0207428_10250180
911 Ga0207428_11083316
912 Ga0268266_11102337
913 Ga0268265_11701427
914 Ga0268264_10901705
915 Ga0265319_1018240
916 Ga0265339_10186504
917 Ga0265327_10113675
918 Ga0265327_10182125
919 Ga0265327_10297070
920 Ga0307408_100304850
921 Ga0307413_10389860
922 Ga0307407_11343693
923 Ga0307412_10644694
924 Ga0307416_100706351
925 Ga0373944_0096341
926 Ga0373956_0423083
927 Ga0373946_0111394
928 Ga0373955_0477251
929 Ga0316574_0024404
930 Ga0373935_0534905
931 Ga0373935_0770798
932 Ga0373947_1235917
933 Ga0373937_0298981
934 Ga0373937_0476382
935 Ga0373925_0207978
936 Ga0373925_1702723
937 Ga0395900_0298910
938 Ga0395898_0570807
939 Ga0395898_0953614
940 Ga0395898_1271103
941 Ga0395898_1497752
942 Ga0395905_0689865
943 Ga0436364_0117682
944 Ga0436364_1256770
945 Ga0395901_0734120
946 Ga0395901_0762232
947 Ga0395901_1118383
948 Ga0395901_1328778
949 Ga0436363_0707026
950 Ga0439438_024862
951 Ga0439438_090063
952 Ga0439447_112720
953 Ga0439461_0058942
954 Ga0439466_0061828
955 Ga0439466_0206254
956 Ga0439465_0085901
957 Ga0451791_0585133
958 Ga0451853_3277767
959 Ga0439431_0006136
960 Ga0439431_0117579
961 Ga0439445_0122398
962 Ga0439445_0146044
963 Ga0439455_0118718
964 Ga0450907_045084
965 Ga0439446_0127744
966 Ga0439446_0155135
967 Ga0439458_0113846
968 Ga0450918_028506
969 Ga0466965_0088820
970 Ga0466963_0008195
971 Ga0466963_0019581
972 Ga0466963_0044331
973 Ga0466963_0058630
974 Ga0466964_0000074
975 Ga0466964_0060419
976 Ga0466964_0764393
977 Ga0466971_0084796
978 Ga0466971_0264443
979 Ga0466968_0134441
980 Ga0466968_0289544
981 Ga0466968_0336294
982 Ga0466968_0439109
983 Ga0466968_0545460
984 Ga0466957_0006182
985 Ga0466957_0139750
986 Ga0466957_1212676
987 Ga0466960_0020917
988 Ga0466960_0120225
989 Ga0466960_0364623
990 Ga0466960_0479444
991 Ga0466960_0488440
992 Ga0466960_0945234
993 Ga0466958_0038363
994 Ga0466958_0131457
995 Ga0466958_0453071
996 Ga0466958_0622502
997 Ga0466967_0000085
998 Ga0466967_0011298
999 Ga0466967_0020251
1000 Ga0466967_0096466
1001 Ga0466967_0190495
1002 Ga0466967_0197231
1003 Ga0466967_0323051
1004 Ga0466967_0679461
1005 Ga0466967_1399067
1006 Ga0495592_0274122
1007 Ga0495592_0751947
1008 Ga0495603_0064684
1009 Ga0495651_0460834
1010 Ga0495653_0282852
1011 Ga0495653_0913060
1012 Ga0495582_0100252
1013 Ga0495584_0210291
1014 Ga0495594_0651625
1015 Ga0495607_0273148
1016 Ga0495608_0042798
1017 Ga0495616_0074977
1018 Ga0495618_0156803
1019 Ga0495620_0214505
1020 Ga0495628_0230556
1021 Ga0495631_0195647
1022 Ga0495642_0439786
1023 Ga0495652_0597984
1024 Ga0495652_1115613
1025 Ga0495587_0185079
1026 Ga0495587_0350800
1027 Ga0495587_0667181
1028 Ga0495609_0305128
1029 Ga0495609_0312056
1030 Ga0495645_0090953
1031 Ga0495667_0058393
1032 Ga0495667_0288955
1033 Ga0495667_0289237
1034 Ga0495667_0693375
1035 Ga0495656_0055380
1036 Ga0495656_0204299
1037 Ga0495611_0112324
1038 Ga0495611_0447751
1039 Ga0495635_0149151
1040 Ga0495635_0464492
1041 Ga0495635_0717470
1042 Ga0495661_0098631
1043 Ga0495588_0314623
1044 Ga0495657_0288026
1045 Ga0495657_0387931
1046 Ga0495657_0878148
1047 Ga0495599_0063778
1048 Ga0495623_0108370
1049 Ga0495647_0251352
1050 Ga0495658_0098316
1051 Ga0495613_0860318
1052 Ga0495670_0481399
1053 Ga0495600_0521628
1054 Ga0495581_0344103
1055 Ga0495581_0738431
1056 Ga0495604_0133818
1057 Ga0495674_0084511
1058 Ga0495674_0273332
1059 Ga0495674_0736897
1060 Ga0495674_1064855
1061 Ga0495676_0110527
1062 Ga0495680_0088030
1063 Ga0495680_0231598
1064 Ga0495680_0538932
1065 Ga0495684_0079703
1066 Ga0495684_0387076
1067 Ga0495593_0348454
1068 Ga0495602_0287807
1069 Ga0495602_0735767
1070 Ga0495602_0791690
1071 Ga0496100_0010783
1072 Ga0496100_0013930
1073 Ga0496100_1199516
1074 Ga0496101_0015201
1075 Ga0496101_0019335
1076 Ga0496101_0584309
1077 Ga0496101_1374275
1078 Ga0496102_0151621
1079 Ga0496102_0580302
1080 Ga0496102_0848732
1081 Ga0496102_1410453
1082 Ga0496104_0010883
1083 Ga0496104_0112440
1084 Ga0496104_0618463
1085 Ga0496104_1712220
1086 Ga0496105_0088723
1087 Ga0496105_0122417
1088 Ga0496105_0203759
1089 Ga0496105_0843203
1090 Ga0496105_1245874
1091 Ga0496105_1368934
1092 Ga0496106_0002385
1093 Ga0496106_0243722
1094 Ga0496106_0823736
1095 Ga0496106_1088012
1096 Ga0496107_0004303
1097 Ga0496107_0032595
1098 Ga0496108_0105986
1099 Ga0496108_0117442
1100 Ga0496108_0612590
1101 Ga0496108_1801576
1102 Ga0496109_0018827
1103 Ga0496109_0027027
1104 Ga0496109_0059523
1105 Ga0496109_0648305
1106 Ga0496109_1116642
1107 Ga0496109_1804567
1108 Ga0496110_0012994
1109 Ga0496110_1297524
1110 Ga0496111_0314600
1111 Ga0496112_0030532
1112 Ga0496112_0422261
1113 Ga0496112_1547590
1114 Ga0496113_0122586
1115 Ga0496113_0136445
1116 Ga0496113_0389711
1117 Ga0496113_1583686
1118 Ga0496114_0002539
1119 Ga0496114_0003443
1120 Ga0496114_0422075
1121 Ga0496114_1688214
1122 Ga0496115_0263923
1123 Ga0496115_0998381
1124 Ga0496119_0544323
1125 Ga0501031_0014017
1126 Ga0501031_0045604
1127 Ga0501031_0075164
1128 Ga0501031_0918093
1129 Ga0501032_0043422
1130 Ga0501033_0206573
1131 Ga0501033_0247851
1132 Ga0501034_0790579
1133 Ga0501034_1542401
1134 Ga0501036_0007855
1135 Ga0501036_0051786
1136 Ga0501036_0246521
1137 Ga0501038_0018767
1138 Ga0501038_0115124
1139 Ga0501038_1103656
1140 Ga0501039_0001712
1141 Ga0501039_0437870
1142 Ga0501039_0471698
1143 Ga0501039_0540282
1144 Ga0501040_0000277
1145 Ga0501040_0296282
1146 Ga0501040_0324999
1147 Ga0501040_0858621
1148 Ga0501041_0008506
1149 Ga0501041_0011520
1150 Ga0501041_0248793
1151 Ga0501041_0737965
1152 Ga0501042_0012096
1153 Ga0501042_0018925
1154 Ga0501042_0206569
1155 Ga0501042_0331458
1156 Ga0501043_0048139
1157 Ga0501043_0162329
1158 Ga0501043_0364872
1159 Ga0501046_0071522
1160 Ga0501046_0446527
1161 Ga0501046_0474142
1162 Ga0501047_0009779
1163 Ga0501047_0146144
1164 Ga0501047_0222024
1165 Ga0501048_0000708
1166 Ga0501048_0004389
1167 Ga0501048_0171186
1168 Ga0501067_0003599
1169 Ga0501067_0011607
1170 Ga0501067_0060330
1171 Ga0501067_0232370
1172 Ga0501068_0000257
1173 Ga0501068_0033018
1174 Ga0501068_0057026
1175 Ga0501068_0099103
1176 Ga0501068_0385055
1177 Ga0501069_0000272
1178 Ga0501069_0048331
1179 Ga0501069_0088038
1180 Ga0501069_0092337
1181 Ga0501069_0253045
1182 Ga0501070_0104502
1183 Ga0501070_0289239
1184 Ga0501070_1206482
1185 Ga0501071_0002683
1186 Ga0501071_0027266
1187 Ga0501071_0360914
1188 Ga0501072_0027255
1189 Ga0501072_0059069
1190 Ga0501072_0129832
1191 Ga0501074_0008236
1192 Ga0501074_0027140
1193 Ga0501074_0264233
1194 Ga0501075_0013959
1195 Ga0501075_0056510
1196 Ga0501075_0196741
1197 Ga0501076_0002850
1198 Ga0501076_0420603
1199 Ga0501077_0048537
1200 Ga0501077_0147070
1201 Ga0501077_0502494
1202 Ga0501248_033947
1203 Ga0501079_0009452
1204 Ga0501079_0086486
1205 Ga0501079_0133805
1206 Ga0501080_0046331
1207 Ga0501080_0089150
1208 Ga0501080_0166164
1209 Ga0501080_0718356
1210 Ga0501080_0881800
1211 Ga0501081_0006855
1212 Ga0501081_0284709
1213 Ga0501083_0107789
1214 Ga0501083_0204044
1215 Ga0501083_0404405
1216 Ga0501083_0630014
1217 Ga0501035_0158690
1218 Ga0501035_0583702
1219 Ga0501044_0197992
1220 Ga0501044_0499480
1221 Ga0501045_0040353
1222 Ga0501045_0114141
1223 Ga0501045_1273416
1224 nmdc:mga03n38_141692_c1
1225 nmdc:mga03n38_52403_c1
1226 nmdc:mga0yw44_190871_c1
1227 nmdc:mga05p37_37671_c1
1228 nmdc:mga06r32_1235444_c1
1229 nmdc:mga08y16_260485_c1
1230 nmdc:mga08y16_288196_c1
1231 nmdc:mga0n895_125476_c1
1232 nmdc:mga0n895_24130_c1
1233 nmdc:mga0n895_24973_c1
1234 nmdc:mga0n895_362939_c1
1235 nmdc:mga0rr50_57090_c1
1236 nmdc:mga0rr50_65171_c1
1237 nmdc:mga0rr50_72928_c1
1238 nmdc:mga08x19_342840_c1
1239 nmdc:mga08x19_71783_c1
1240 nmdc:mga08x19_87484_c1
1241 nmdc:mga08x19_927575_c1
1242 nmdc:mga0a205_144391_c1
1243 nmdc:mga0a205_467458_c1
1244 nmdc:mga0a205_89817_c1
1245 Ga0495612_0232440
1246 Ga0495612_0264138
1247 Ga0495595_0064817
1248 Ga0495595_0728355
1249 Ga0495619_0090926
1250 Ga0495619_0300034
1251 Ga0501084_0004754
1252 Ga0501084_0049774
1253 Ga0501084_0057952
1254 Ga0501084_0497594
1255 Ga0590077_049871
1256 Ga0590077_055034
1257 Ga0590077_064131
1258 Ga0501082_0018931
1259 Ga0501082_0135570
1260 Ga0466962_0167499
1261 Ga0530510_0018090
1262 Ga0530510_0029857
1263 Ga0530510_0030029
1264 Ga0530510_0143076

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02617

ClpS

ATP-dependent Clp protease adaptor protein ClpS

30

104

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d34-assembly1.cif.gz_B atclps1-peptide complex 0.9331 22 101
7d34-assembly1.cif.gz_B atclps1-peptide complex 0.9221 22 101
4o2x-assembly2.cif.gz_B structure of a malarial protein 0.9158 25 97
4o2x-assembly1.cif.gz_A structure of a malarial protein 0.9125 24 97
3dnj-assembly2.cif.gz_A the structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide 0.8967 26 95
ID Description Score Start End Superfamily
af_Q8IEB2_84_184_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.934 23 101 3.30.1390.10
af_A0A0R0IJ84_76_154_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8942 14 99 3.30.1390.10
af_P0A8Q6_1_106_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8858 22 100 3.30.1390.10
af_A0A0R0IJ84_76_154_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8834 14 99 3.30.1390.10
3o1fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8645 25 95 3.30.1390.10
ID Description Score Start End GO Terms
AF-A0A538CPT5-F1-model_v4 Clp protease ClpS 0.9714 28 98 GO:0006508
GO:0008233
GO:0030163
AF-A0A2W4VXJ9-F1-model_v4 Clp protease ClpS 0.9624 28 100 GO:0006508
GO:0008233
GO:0030163
AF-A0A4P5VM14-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 0.9572 22 99 GO:0006508
GO:0008233
GO:0030163
AF-A0A7S1BRN6-F1-model_v4 Adaptor protein ClpS core domain-containing protein 0.9529 26 101 GO:0006508
GO:0030163
AF-W7KBU9-F1-model_v4 Adaptor protein ClpS core domain-containing protein 0.9521 26 100 GO:0006508
GO:0030163

Map