F470917

General Info

Members Datasets Scaffolds Average Seq Length
631 304 553 171

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10001285|Ga0157372_1000128524
Length 184
Sequence MSQETAARVALTIEPLTREAFAPFGDVIELEGAKQFPINQGTTIRFHDLANVDVGEGGRALISLFRGQPRTLPFEVKMLERHPRGSQAFIPQNDKPYLVVVAPAGELDPSKLRAFVSRGWQGVNYARGVWHHPLLALGEVSDFLVVDRGGEGHNCDEQDLVESVWLTAEAMQAALETSLHRHQY

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
13 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
14 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
15 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
16 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
17 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
18 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
19 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
20 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
21 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
22 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
23 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
24 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
25 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
26 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
27 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
28 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
29 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
30 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
31 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
32 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
33 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
34 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
35 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
36 2818991450 Burkholderia sp. 604 Isolate Unclassified
37 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
38 2885266251 Ralstonia sp. SET104 Isolate Nodule
39 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
40 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
41 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
42 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
43 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
44 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
45 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
46 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
47 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
48 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
49 2928058823 Ralstonia sp. 1138 Isolate Unclassified
50 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
51 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
52 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
53 2928163908 Burkholderia sp. 567 Isolate Unclassified
54 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
55 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
56 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
57 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
58 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
59 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
60 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
61 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
62 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
63 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
64 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
65 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
66 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
67 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
70 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
71 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
72 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
73 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
74 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
75 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
76 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
77 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
78 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
79 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
85 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
86 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
131 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
140 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
141 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
170 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
189 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
257 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
260 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
293 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
296 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
299 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
300 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
301 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
302 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
303 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
304 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.37
Metatranscriptomes 1.27
Isolates 12.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.67
Nodule 3.01
Rhizoplane 5.71
Rhizosphere 67.04
Stem 0
Stem Tuber 0
Unclassified 14.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000205 3300001915 Bacteria 17562
2 JGI24740J21852_10000417 3300001979 Bacteria 18191
3 JGI24740J21852_10000439 3300001979 Bacteria 17770
4 JGI24740J21852_10000760 3300001979 Bacteria 14118
5 JGI24740J21852_10024443 3300001979 Bacteria 2049
6 JGI24739J22299_10009821 3300001989 Bacteria 3557
7 JGI24739J22299_10041929 3300001989 Bacteria 1520
8 JGI24739J22299_10092672 3300001989 Bacteria 918
9 JGI24737J22298_10017912 3300001990 Bacteria 2278
10 JGI24737J22298_10072481 3300001990 Bacteria 1028
11 JGI24735J21928_10000198 3300002067 Bacteria 21179
12 JGI24735J21928_10000485 3300002067 Bacteria 14043
13 JGI24735J21928_10003047 3300002067 Bacteria 5746
14 JGI24735J21928_10012106 3300002067 Bacteria 2729
15 JGI24735J21928_10018106 3300002067 Bacteria 2174
16 JGI24738J21930_10010548 3300002075 Bacteria 2055
17 JGI25156J39149_1000552 3300002705 Bacteria 21414
18 JGI25156J39149_1001925 3300002705 Bacteria 8056
19 JGI25156J39149_1003155 3300002705 Bacteria 5548
20 JGI25156J39149_1007233 3300002705 Bacteria 2941
21 JGI25156J39149_1027078 3300002705 Bacteria 900
22 JGI25154J39366_1002472 3300002738 Bacteria 4756
23 JGI25165J46597_1001281 3300003214 Bacteria 14624
24 rootH1_10012924 3300003316 Bacteria 5204
25 rootH2_10072807 3300003320 Bacteria 3509
26 rootH1_10129794 3300003323 Bacteria 1487
27 Ga0006562J51391_1049819 3300003578 Bacteria 3000
28 Ga0006562J51391_1049820 3300003578 Bacteria 2670
29 Ga0055539_1000073 3300003752 Bacteria 131094
30 Ga0055539_1019396 3300003752 Bacteria 815
31 Ga0055533_1000099 3300003756 Bacteria 112337
32 Ga0055533_1002937 3300003756 Bacteria 3658
33 Ga0055533_1003392 3300003756 Bacteria 3214
34 Ga0055533_1003532 3300003756 Bacteria 3103
35 Ga0055533_1003879 3300003756 Bacteria 2851
36 Ga0055532_1000010 3300003758 Bacteria 392055
37 Ga0055532_1000090 3300003758 Bacteria 104391
38 Ga0055532_1003241 3300003758 Bacteria 2889
39 Ga0055525_1004901 3300003759 Bacteria 1146
40 Ga0055527_1000008 3300003760 Bacteria 392055
41 Ga0055527_1000433 3300003760 Bacteria 16809
42 Ga0055527_1000900 3300003760 Bacteria 7539
43 Ga0055535_1000007 3300003761 Bacteria 392055
44 Ga0055535_1000085 3300003761 Bacteria 104391
45 Ga0055535_1001075 3300003761 Bacteria 16809
46 Ga0055542_1000011 3300003762 Bacteria 392055
47 Ga0055542_1004528 3300003762 Bacteria 3348
48 Ga0055542_1018459 3300003762 Bacteria 1057
49 Ga0055529_1000009 3300003763 Bacteria 392055
50 Ga0055529_1000134 3300003763 Bacteria 104391
51 Ga0055541_1000346 3300003841 Bacteria 14455
52 Ga0070658_10191013 3300005327 Bacteria 1726
53 Ga0070658_10440466 3300005327 Bacteria 1122
54 Ga0070658_10692268 3300005327 Bacteria 885
55 Ga0070666_10549032 3300005335 Bacteria 840
56 Ga0070682_100613032 3300005337 Bacteria 861
57 Ga0070660_100000110 3300005339 Bacteria 50810
58 Ga0070660_100002002 3300005339 Bacteria 14053
59 Ga0070660_100051434 3300005339 Bacteria 3173
60 Ga0070661_100000683 3300005344 Bacteria 24923
61 Ga0070688_100466779 3300005365 Bacteria 946
62 Ga0070659_100000096 3300005366 Bacteria 66336
63 Ga0070659_100001478 3300005366 Bacteria 16932
64 Ga0070659_100013948 3300005366 Bacteria 5998
65 Ga0070659_100364124 3300005366 Bacteria 1215
66 Ga0070663_100000251 3300005455 Bacteria 27107
67 Ga0070663_100005838 3300005455 Bacteria 7355
68 Ga0070663_100079743 3300005455 Bacteria 2403
69 Ga0070663_100202895 3300005455 Bacteria 1548
70 Ga0070662_100740223 3300005457 Bacteria 833
71 Ga0070684_101473944 3300005535 Bacteria 641
72 Ga0068853_100482895 3300005539 Bacteria 1168
73 Ga0068855_100000976 3300005563 Bacteria 35611
74 Ga0068855_100002760 3300005563 Bacteria 21619
75 Ga0068855_100004438 3300005563 Bacteria 17140
76 Ga0070664_100000623 3300005564 Bacteria 27102
77 Ga0068857_100024577 3300005577 Bacteria 5305
78 Ga0068854_100000308 3300005578 Bacteria 32248
79 Ga0068854_100168030 3300005578 Bacteria 1704
80 Ga0068854_100600050 3300005578 Bacteria 940
81 Ga0068856_100001206 3300005614 Bacteria 27139
82 Ga0068852_100017957 3300005616 Bacteria 5564
83 Ga0068852_100227256 3300005616 Bacteria 1778
84 Ga0068852_100338929 3300005616 Bacteria 1465
85 Ga0068852_100713825 3300005616 Bacteria 1013
86 Ga0105251_10000167 3300009011 Bacteria 67775
87 Ga0105251_10003286 3300009011 Bacteria 11835
88 Ga0105244_10034804 3300009036 Bacteria 2649
89 Ga0105250_10014587 3300009092 Bacteria 3225
90 Ga0105250_10328946 3300009092 Bacteria 665
91 Ga0105240_10007702 3300009093 Bacteria 15583
92 Ga0105240_10133560 3300009093 Bacteria 2974
93 Ga0105240_10375303 3300009093 Bacteria 1607
94 Ga0105240_10501831 3300009093 Bacteria 1349
95 Ga0105240_10621786 3300009093 Bacteria 1187
96 Ga0105240_11496985 3300009093 Bacteria 708
97 Ga0105245_10145089 3300009098 Bacteria 2239
98 Ga0105245_10930624 3300009098 Bacteria 912
99 Ga0105247_10375409 3300009101 Bacteria 1007
100 Ga0105241_10081593 3300009174 Bacteria 2533
101 Ga0105241_10190219 3300009174 Bacteria 1708
102 Ga0105242_10455490 3300009176 Bacteria 1207
103 Ga0105242_10902578 3300009176 Bacteria 884
104 Ga0105248_10081405 3300009177 Bacteria 3639
105 Ga0105237_10060739 3300009545 Bacteria 3780
106 Ga0105237_10061510 3300009545 Bacteria 3754
107 Ga0105237_10062425 3300009545 Bacteria 3725
108 Ga0105237_10200694 3300009545 Bacteria 1994
109 Ga0105237_10593886 3300009545 Bacteria 1114
110 Ga0105238_10047045 3300009551 Bacteria 4351
111 Ga0105238_10081003 3300009551 Bacteria 3235
112 Ga0105239_10001287 3300010375 Bacteria 33848
113 Ga0105239_10172755 3300010375 Bacteria 2417
114 Ga0105239_10253753 3300010375 Bacteria 1976
115 Ga0105239_10903853 3300010375 Bacteria 1013
116 Ga0105246_10115539 3300011119 Bacteria 1979
117 Ga0157373_10005042 3300013100 Bacteria 9919
118 Ga0157373_10010952 3300013100 Bacteria 6676
119 Ga0157373_10016497 3300013100 Bacteria 5386
120 Ga0157373_10224519 3300013100 Bacteria 1325
121 Ga0157371_10001237 3300013102 Bacteria 27113
122 Ga0157371_10031371 3300013102 Bacteria 3829
123 Ga0157370_10000470 3300013104 Bacteria 50271
124 Ga0157370_10000930 3300013104 Bacteria 37091
125 Ga0157370_10002999 3300013104 Bacteria 20037
126 Ga0157370_10018114 3300013104 Bacteria 7090
127 Ga0157370_10019712 3300013104 Bacteria 6753
128 Ga0157370_10342202 3300013104 Bacteria 1378
129 Ga0157369_10000622 3300013105 Bacteria 46108
130 Ga0157369_10000837 3300013105 Bacteria 39324
131 Ga0157369_10002473 3300013105 Bacteria 22139
132 Ga0157369_10002802 3300013105 Bacteria 20808
133 Ga0157369_10034929 3300013105 Bacteria 5514
134 Ga0157369_10145826 3300013105 Bacteria 2503
135 Ga0157369_10407142 3300013105 Bacteria 1411
136 Ga0157369_10479038 3300013105 Bacteria 1288
137 Ga0157369_10977690 3300013105 Bacteria 867
138 Ga0157374_10000033 3300013296 Bacteria 185818
139 Ga0157374_10115416 3300013296 Bacteria 2586
140 Ga0163162_10010173 3300013306 Bacteria 9136
141 Ga0163162_10015796 3300013306 Bacteria 7379
142 Ga0157372_10000399 3300013307 Bacteria 47919
143 Ga0157372_10001285 3300013307 Bacteria 27113
144 Ga0157372_12402744 3300013307 Bacteria 605
145 Ga0157375_10104604 3300013308 Bacteria 2920
146 Ga0182008_10022296 3300014497 Bacteria 3244
147 Ga0182008_10032247 3300014497 Bacteria 2633
148 Ga0157376_10834587 3300014969 Bacteria 936
149 Ga0182006_1005021 3300015261 Bacteria 6370
150 Ga0182006_1081738 3300015261 Bacteria 1177
151 Ga0182006_1108183 3300015261 Bacteria 978
152 Ga0182007_10000507 3300015262 Bacteria 23021
153 Ga0182007_10008292 3300015262 Bacteria 4276
154 Ga0183361_10006 3300016635 Bacteria 368532
155 Ga0206356_10303557 3300020070 Bacteria 1747
156 Ga0206356_11384741 3300020070 Bacteria 2821
157 Ga0206355_1026994 3300020076 Bacteria 993
158 Ga0206353_10827992 3300020082 Bacteria 2532
159 Ga0154015_1153479 3300020610 Bacteria 7739
160 Ga0213874_10059495 3300021377 Bacteria 1193
161 Ga0213874_10082557 3300021377 Unclassified 1043
162 Ga0213876_10003186 3300021384 Bacteria 9440
163 Ga0224712_10002502 3300022467 Bacteria 4548
164 Ga0209435_115408 3300025206 Bacteria 798
165 Ga0209784_100006 3300025224 Bacteria 930704
166 Ga0209784_100428 3300025224 Bacteria 18349
167 Ga0209784_101544 3300025224 Bacteria 2922
168 Ga0209566_100002 3300025225 Bacteria 2614868
169 Ga0209566_100572 3300025225 Bacteria 23824
170 Ga0209674_100010 3300025226 Bacteria 1038638
171 Ga0209674_100022 3300025226 Bacteria 563656
172 Ga0209674_100164 3300025226 Bacteria 86571
173 Ga0209674_100355 3300025226 Bacteria 25986
174 Ga0209674_103435 3300025226 Bacteria 2910
175 Ga0209672_100001 3300025228 Bacteria 2828210
176 Ga0209672_100023 3300025228 Bacteria 371758
177 Ga0209672_100110 3300025228 Bacteria 95441
178 Ga0209672_100806 3300025228 Bacteria 14786
179 Ga0209672_101336 3300025228 Bacteria 9317
180 Ga0209147_100001 3300025229 Bacteria 2384371
181 Ga0209147_100018 3300025229 Bacteria 515719
182 Ga0209147_100094 3300025229 Bacteria 167145
183 Ga0209563_100041 3300025230 Bacteria 407467
184 Ga0209563_100280 3300025230 Bacteria 21540
185 Ga0207427_100993 3300025231 Bacteria 11949
186 Ga0209258_100001 3300025242 Bacteria 2384269
187 Ga0209258_100028 3300025242 Bacteria 515719
188 Ga0209258_100142 3300025242 Bacteria 165865
189 Ga0209646_1000153 3300025246 Bacteria 96707
190 Ga0209026_1004636 3300025250 Bacteria 4000
191 Ga0209677_100007 3300025253 Bacteria 1021332
192 Ga0209677_106575 3300025253 Bacteria 2718
193 Ga0209148_1000003 3300025254 Bacteria 2384288
194 Ga0209148_1000297 3300025254 Bacteria 72735
195 Ga0209148_1001163 3300025254 Bacteria 15301
196 Ga0209148_1005602 3300025254 Bacteria 2855
197 Ga0209759_1000102 3300025256 Bacteria 153422
198 Ga0209759_1000158 3300025256 Bacteria 116493
199 Ga0209759_1002481 3300025256 Bacteria 8050
200 Ga0209759_1003417 3300025256 Bacteria 6348
201 Ga0209759_1012301 3300025256 Bacteria 2378
202 Ga0209233_1000061 3300025261 Bacteria 406211
203 Ga0209455_1000001 3300025272 Bacteria 2384278
204 Ga0209455_1000107 3300025272 Bacteria 195136
205 Ga0209455_1000724 3300025272 Bacteria 19116
206 Ga0207426_1011873 3300025302 Bacteria 3296
207 Ga0207713_1000353 3300025735 Bacteria 50352
208 Ga0207710_10195976 3300025900 Bacteria 996
209 Ga0207647_10002830 3300025904 Bacteria 13093
210 Ga0207647_10021652 3300025904 Bacteria 4288
211 Ga0207647_10036924 3300025904 Bacteria 3101
212 Ga0207647_10048344 3300025904 Bacteria 2642
213 Ga0207647_10115106 3300025904 Bacteria 1588
214 Ga0207705_10000771 3300025909 Bacteria 26342
215 Ga0207705_10001865 3300025909 Bacteria 16543
216 Ga0207705_10063418 3300025909 Bacteria 2670
217 Ga0207654_10139086 3300025911 Bacteria 1546
218 Ga0207695_10000879 3300025913 Bacteria 54696
219 Ga0207695_10008368 3300025913 Bacteria 12959
220 Ga0207695_10279925 3300025913 Bacteria 1562
221 Ga0207695_10456736 3300025913 Bacteria 1160
222 Ga0207695_10912944 3300025913 Bacteria 758
223 Ga0207671_10031885 3300025914 Bacteria 3924
224 Ga0207671_10060762 3300025914 Bacteria 2803
225 Ga0207671_10105563 3300025914 Bacteria 2138
226 Ga0207657_10000004 3300025919 Bacteria 247179
227 Ga0207657_10000269 3300025919 Bacteria 55259
228 Ga0207657_10099893 3300025919 Bacteria 2410
229 Ga0207657_10199476 3300025919 Bacteria 1610
230 Ga0207649_10000668 3300025920 Bacteria 22913
231 Ga0207694_10125036 3300025924 Bacteria 2057
232 Ga0207694_10138865 3300025924 Bacteria 1953
233 Ga0207687_11162433 3300025927 Bacteria 663
234 Ga0207690_10000015 3300025932 Bacteria 257457
235 Ga0207690_10001619 3300025932 Bacteria 14018
236 Ga0207690_10023724 3300025932 Bacteria 3833
237 Ga0207690_10285182 3300025932 Bacteria 1287
238 Ga0207686_10303272 3300025934 Bacteria 1187
239 Ga0207711_10041382 3300025941 Bacteria 3924
240 Ga0207679_10000349 3300025945 Bacteria 33664
241 Ga0207667_10000347 3300025949 Bacteria 63149
242 Ga0207667_10007627 3300025949 Bacteria 12966
243 Ga0207667_10043226 3300025949 Bacteria 4783
244 Ga0207667_10258453 3300025949 Bacteria 1781
245 Ga0207640_10000490 3300025981 Bacteria 24099
246 Ga0207640_10252081 3300025981 Bacteria 1371
247 Ga0207640_10920846 3300025981 Bacteria 765
248 Ga0207639_11481816 3300026041 Bacteria 637
249 Ga0207678_10000911 3300026067 Bacteria 27065
250 Ga0207678_10016268 3300026067 Bacteria 6528
251 Ga0207678_10128195 3300026067 Bacteria 2164
252 Ga0207678_10374905 3300026067 Bacteria 1230
253 Ga0207702_10006736 3300026078 Bacteria 9870
254 Ga0207674_10056006 3300026116 Bacteria 4005
255 Ga0207674_10232019 3300026116 Bacteria 1793
256 Ga0207698_10016539 3300026142 Bacteria 4976
257 Ga0207698_10146977 3300026142 Bacteria 2040
258 Ga0207698_10244432 3300026142 Bacteria 1638
259 Ga0207698_10807530 3300026142 Bacteria 941
260 Ga0209371_1001480 3300027312 Bacteria 15680
261 Ga0268256_1002184 3300030500 Bacteria 10341
262 Ga0268256_1006866 3300030500 Bacteria 4159
263 Ga0307408_100000002 3300031548 Bacteria 827227
264 Ga0307412_10000003 3300031911 Bacteria 659081
265 Ga0307412_10000044 3300031911 Bacteria 165237
266 Ga0395899_0000007 3300037312 Bacteria 629129
267 Ga0395899_0004268 3300037312 Bacteria 11181
268 Ga0395899_0060176 3300037312 Bacteria 2798
269 Ga0395899_0126815 3300037312 Bacteria 1825
270 Ga0395899_0185398 3300037312 Bacteria 1458
271 Ga0395899_0469333 3300037312 Bacteria 821
272 Ga0395900_0000026 3300037418 Bacteria 313470
273 Ga0395900_0000098 3300037418 Bacteria 158030
274 Ga0395900_0009132 3300037418 Bacteria 10155
275 Ga0395900_0023556 3300037418 Bacteria 6300
276 Ga0395900_0036588 3300037418 Bacteria 5060
277 Ga0395900_0090596 3300037418 Bacteria 3143
278 Ga0395900_0128788 3300037418 Bacteria 2595
279 Ga0395900_0227657 3300037418 Bacteria 1877
280 Ga0395900_0523329 3300037418 Bacteria 1133
281 Ga0395900_0536444 3300037418 Bacteria 1116
282 Ga0395898_0000085 3300037466 Bacteria 240992
283 Ga0395898_0000577 3300037466 Bacteria 67972
284 Ga0395898_0002532 3300037466 Bacteria 21438
285 Ga0395898_0006441 3300037466 Bacteria 12543
286 Ga0395898_0115932 3300037466 Bacteria 2566
287 Ga0395898_0134288 3300037466 Bacteria 2369
288 Ga0395898_0173425 3300037466 Bacteria 2061
289 Ga0395905_0000076 3300037471 Bacteria 164190
290 Ga0395905_0267474 3300037471 Bacteria 1595
291 Ga0395901_0000045 3300038443 Bacteria 188874
292 Ga0395901_0000088 3300038443 Bacteria 124938
293 Ga0395901_0000130 3300038443 Bacteria 97728
294 Ga0395901_0008971 3300038443 Bacteria 10124
295 Ga0395901_0132444 3300038443 Bacteria 2619
296 Ga0395901_0178427 3300038443 Bacteria 2227
297 Ga0395901_0253640 3300038443 Bacteria 1832
298 Ga0395901_0365289 3300038443 Bacteria 1487
299 Ga0436365_1679636 3300039437 Bacteria 9548
300 Ga0436360_0297094 3300039438 Bacteria 2050
301 Ga0436361_0909556 3300039447 Bacteria 5391
302 Ga0436361_1059219 3300039447 Bacteria 3977
303 Ga0436361_1204147 3300039447 Bacteria 784
304 Ga0436363_0769086 3300039450 Bacteria 2220
305 Ga0436363_1321106 3300039450 Bacteria 6160
306 Ga0439466_0021077 3300041411 Bacteria 2315
307 Ga0439448_0008800 3300042005 Bacteria 2960
308 Ga0439464_0002118 3300042439 Bacteria 4838
309 Ga0466986_0171352 3300044650 Bacteria 1449
310 Ga0466969_0000516 3300044656 Bacteria 21225
311 Ga0466969_0009291 3300044656 Bacteria 5213
312 Ga0466969_0032783 3300044656 Bacteria 2640
313 Ga0466969_0054915 3300044656 Bacteria 1950
314 Ga0466969_0192892 3300044656 Bacteria 930
315 Ga0466969_0203242 3300044656 Bacteria 903
316 Ga0466972_0005219 3300044658 Bacteria 6502
317 Ga0466972_0036637 3300044658 Bacteria 2399
318 Ga0466973_0021282 3300044659 Bacteria 6206
319 Ga0466982_0049283 3300044672 Bacteria 2573
320 Ga0466965_0000114 3300044683 Bacteria 23122
321 Ga0466965_0036949 3300044683 Bacteria 2397
322 Ga0466965_0042490 3300044683 Bacteria 2242
323 Ga0466966_0000005 3300044684 Bacteria 193939
324 Ga0466966_0000061 3300044684 Bacteria 79168
325 Ga0466966_0000730 3300044684 Bacteria 20906
326 Ga0466966_0003394 3300044684 Bacteria 10505
327 Ga0466966_0013754 3300044684 Bacteria 5354
328 Ga0466966_0046108 3300044684 Bacteria 2785
329 Ga0466966_0048275 3300044684 Bacteria 2711
330 Ga0466961_0000656 3300044693 Bacteria 21722
331 Ga0466961_0000908 3300044693 Bacteria 18384
332 Ga0466961_0001421 3300044693 Bacteria 14857
333 Ga0466961_0015322 3300044693 Bacteria 4924
334 Ga0466961_0060717 3300044693 Bacteria 2403
335 Ga0466961_0163748 3300044693 Bacteria 1385
336 Ga0466961_0422360 3300044693 Bacteria 808
337 Ga0466961_0560433 3300044693 Bacteria 688
338 Ga0466961_0573563 3300044693 Bacteria 679
339 Ga0466963_0006960 3300044694 Bacteria 6730
340 Ga0466963_0007803 3300044694 Bacteria 6401
341 Ga0466963_0008927 3300044694 Bacteria 6017
342 Ga0466963_0105019 3300044694 Bacteria 1936
343 Ga0466964_0010442 3300044706 Bacteria 3503
344 Ga0466964_0017477 3300044706 Bacteria 2745
345 Ga0466964_0057717 3300044706 Bacteria 1607
346 Ga0466971_0000225 3300044719 Bacteria 21713
347 Ga0466971_0001560 3300044719 Bacteria 9673
348 Ga0466968_0024757 3300044735 Bacteria 2454
349 Ga0466968_0030781 3300044735 Bacteria 2224
350 Ga0466968_0215466 3300044735 Bacteria 903
351 Ga0466970_0006869 3300044765 Bacteria 5699
352 Ga0466970_0016750 3300044765 Bacteria 3782
353 Ga0466970_0018570 3300044765 Bacteria 3601
354 Ga0466957_0002300 3300044842 Bacteria 10233
355 Ga0466957_0029864 3300044842 Bacteria 3252
356 Ga0466957_0042293 3300044842 Bacteria 2756
357 Ga0466957_0315322 3300044842 Bacteria 1054
358 Ga0466957_0642740 3300044842 Bacteria 745
359 Ga0466960_0175312 3300044901 Bacteria 1159
360 Ga0466959_0016104 3300045049 Bacteria 5456
361 Ga0466959_0045589 3300045049 Bacteria 3228
362 Ga0466959_0079981 3300045049 Bacteria 2356
363 Ga0466959_0134571 3300045049 Bacteria 1750
364 Ga0466958_0000956 3300045836 Bacteria 13061
365 Ga0466958_0002970 3300045836 Bacteria 8686
366 Ga0466958_0030602 3300045836 Bacteria 3198
367 Ga0466958_0059657 3300045836 Bacteria 2321
368 Ga0466958_0066003 3300045836 Bacteria 2209
369 Ga0466958_0155904 3300045836 Bacteria 1441
370 Ga0466958_0193365 3300045836 Bacteria 1293
371 Ga0466967_0156457 3300045976 Bacteria 2135
372 Ga0466967_0163334 3300045976 Bacteria 2092
373 Ga0466967_0684948 3300045976 Bacteria 1015
374 Ga0495592_0014327 3300046454 Bacteria 6022
375 Ga0495590_0006332 3300046457 Bacteria 4629
376 Ga0495591_118092 3300046458 Bacteria 648
377 Ga0495629_0017113 3300046459 Bacteria 5199
378 Ga0495629_0278928 3300046459 Bacteria 1147
379 Ga0495638_0021487 3300046460 Bacteria 4252
380 Ga0495651_0186555 3300046462 Bacteria 1463
381 Ga0495653_0066182 3300046463 Bacteria 2718
382 Ga0495653_0146689 3300046463 Bacteria 1652
383 Ga0495650_0022089 3300046471 Bacteria 3059
384 Ga0495650_0044762 3300046471 Bacteria 1868
385 Ga0495580_0068770 3300046472 Bacteria 2475
386 Ga0495605_0015977 3300046474 Bacteria 4073
387 Ga0495605_0021562 3300046474 Bacteria 3411
388 Ga0495605_0110268 3300046474 Bacteria 1256
389 Ga0495662_0179379 3300046476 Bacteria 1044
390 Ga0495664_0001809 3300046477 Bacteria 11352
391 Ga0495664_0165326 3300046477 Bacteria 1342
392 Ga0495584_0092340 3300046491 Bacteria 1527
393 Ga0495584_0408339 3300046491 Bacteria 690
394 Ga0495585_0082419 3300046492 Bacteria 1741
395 Ga0495596_0030974 3300046500 Bacteria 2139
396 Ga0495596_0033332 3300046500 Bacteria 2049
397 Ga0495583_0018670 3300046506 Bacteria 3645
398 Ga0495606_0015096 3300046507 Bacteria 5977
399 Ga0495606_0105777 3300046507 Bacteria 1705
400 Ga0495606_0161585 3300046507 Bacteria 1306
401 Ga0495608_0036968 3300046511 Bacteria 3284
402 Ga0495610_0000208 3300046512 Bacteria 64442
403 Ga0495610_0003579 3300046512 Bacteria 12005
404 Ga0495616_0301384 3300046513 Bacteria 677
405 Ga0495618_0001153 3300046514 Bacteria 17904
406 Ga0495620_0045295 3300046515 Bacteria 1906
407 Ga0495628_0305287 3300046516 Bacteria 1177
408 Ga0495630_0017440 3300046517 Bacteria 5259
409 Ga0495630_0019508 3300046517 Bacteria 4984
410 Ga0495630_0089299 3300046517 Bacteria 2328
411 Ga0495643_0130161 3300046522 Bacteria 1264
412 Ga0495644_0042927 3300046523 Bacteria 1702
413 Ga0495648_0016563 3300046524 Bacteria 5309
414 Ga0495648_0024837 3300046524 Bacteria 4069
415 Ga0495666_0008258 3300046526 Bacteria 5217
416 Ga0495642_0042181 3300046528 Bacteria 1858
417 Ga0495642_0090968 3300046528 Bacteria 1292
418 Ga0495652_0188071 3300046529 Bacteria 1578
419 Ga0495665_0014577 3300046531 Bacteria 4237
420 Ga0495640_0009969 3300046533 Bacteria 7364
421 Ga0495586_0015109 3300046535 Bacteria 4108
422 Ga0495586_0266390 3300046535 Bacteria 979
423 Ga0495587_0016946 3300046536 Bacteria 4530
424 Ga0495597_0217797 3300046542 Bacteria 759
425 Ga0495645_0046546 3300046543 Bacteria 3161
426 Ga0495645_0139302 3300046543 Bacteria 1694
427 Ga0495656_0281354 3300046615 Bacteria 848
428 Ga0495634_0027023 3300046642 Bacteria 3997
429 Ga0495634_0062818 3300046642 Bacteria 2465
430 Ga0495611_0084411 3300046648 Bacteria 1464
431 Ga0495635_0008509 3300046663 Bacteria 7165
432 Ga0495635_0175237 3300046663 Bacteria 1458
433 Ga0495657_0030240 3300046675 Bacteria 3795
434 Ga0495623_0017722 3300046679 Bacteria 4599
435 Ga0495623_0025020 3300046679 Bacteria 3846
436 Ga0495646_0014132 3300046680 Bacteria 5077
437 Ga0495646_0038718 3300046680 Bacteria 2943
438 Ga0495669_0026149 3300046684 Bacteria 2549
439 Ga0495613_0055876 3300046689 Bacteria 2899
440 Ga0495624_0055329 3300046690 Bacteria 2499
441 Ga0495649_0020117 3300046694 Bacteria 3745
442 Ga0495649_0022834 3300046694 Bacteria 3498
443 Ga0495649_0172704 3300046694 Bacteria 1130
444 Ga0495589_0065954 3300046794 Bacteria 1774
445 Ga0495589_0083331 3300046794 Bacteria 1554
446 Ga0495600_0677339 3300046809 Bacteria 622
447 Ga0495604_0177437 3300047317 Bacteria 1492
448 Ga0495604_0418895 3300047317 Bacteria 879
449 Ga0495674_0043542 3300047319 Bacteria 3995
450 Ga0495672_0003576 3300047320 Bacteria 13219
451 Ga0495672_0239562 3300047320 Bacteria 886
452 Ga0495680_0004910 3300047322 Bacteria 12669
453 Ga0495680_0042520 3300047322 Bacteria 3604
454 Ga0495680_0282523 3300047322 Bacteria 1169
455 Ga0495683_0008845 3300047323 Bacteria 5371
456 Ga0495683_0009111 3300047323 Bacteria 5288
457 Ga0495683_0012623 3300047323 Bacteria 4436
458 Ga0495683_0022009 3300047323 Bacteria 3280
459 Ga0495683_0156765 3300047323 Bacteria 1055
460 Ga0495683_0240244 3300047323 Bacteria 799
461 Ga0495687_000022 3300047443 Bacteria 327353
462 Ga0495687_012482 3300047443 Bacteria 4488
463 Ga0495687_081893 3300047443 Bacteria 1261
464 Ga0495675_0018648 3300047444 Bacteria 4405
465 Ga0495675_0422644 3300047444 Bacteria 774
466 Ga0495679_012722 3300047446 Bacteria 3188
467 Ga0495679_073433 3300047446 Bacteria 981
468 Ga0495673_0077877 3300047469 Bacteria 1380
469 Ga0495684_0929584 3300047471 Bacteria 558
470 Ga0495686_0000002 3300047472 Bacteria 1050777
471 Ga0495593_0009276 3300047673 Bacteria 5708
472 Ga0495593_0023636 3300047673 Bacteria 3414
473 Ga0495593_0074185 3300047673 Bacteria 1764
474 Ga0495602_0023771 3300048088 Bacteria 5962
475 Ga0495602_0130773 3300048088 Bacteria 2002
476 Ga0495602_0271492 3300048088 Bacteria 1253
477 Ga0495602_0385517 3300048088 Bacteria 1003
478 Ga0495614_0001352 3300048089 Bacteria 10585
479 Ga0495626_0036774 3300048091 Bacteria 2330
480 Ga0496100_0005188 3300048903 Bacteria 6989
481 Ga0496101_0001195 3300048904 Bacteria 15516
482 Ga0496101_0238395 3300048904 Bacteria 1415
483 Ga0496101_0371583 3300048904 Bacteria 1124
484 Ga0496102_0000258 3300048905 Bacteria 68544
485 Ga0496102_0028699 3300048905 Bacteria 4972
486 Ga0496102_0064409 3300048905 Bacteria 3357
487 Ga0496102_0575624 3300048905 Bacteria 1049
488 Ga0496103_0000326 3300048906 Bacteria 43556
489 Ga0496104_0127605 3300048907 Bacteria 2442
490 Ga0496104_0221007 3300048907 Bacteria 1806
491 Ga0496104_0408212 3300048907 Bacteria 1271
492 Ga0496105_0159745 3300048908 Bacteria 1850
493 Ga0496105_1141473 3300048908 Bacteria 576
494 Ga0496106_0000016 3300048909 Bacteria 182368
495 Ga0496106_0000152 3300048909 Bacteria 51253
496 Ga0496106_0011971 3300048909 Bacteria 6402
497 Ga0496107_0033074 3300048910 Bacteria 3699
498 Ga0496107_0569793 3300048910 Bacteria 838
499 Ga0496108_1258992 3300048911 Bacteria 624
500 Ga0496109_0044685 3300048912 Bacteria 4019
501 Ga0496110_0022852 3300048913 Bacteria 5314
502 Ga0496110_0664834 3300048913 Bacteria 942
503 Ga0496111_0017829 3300048914 Bacteria 4910
504 Ga0496112_0008966 3300048915 Bacteria 8979
505 Ga0496112_1232768 3300048915 Bacteria 664
506 Ga0496113_0009988 3300048916 Bacteria 6257
507 Ga0496114_0193347 3300048917 Bacteria 1781
508 Ga0496114_0239397 3300048917 Bacteria 1596
509 Ga0496115_0376141 3300048918 Bacteria 1156
510 Ga0496116_0002942 3300048919 Bacteria 17352
511 Ga0496116_0293801 3300048919 Bacteria 778
512 Ga0496117_0009771 3300048920 Bacteria 8849
513 Ga0496117_0038718 3300048920 Bacteria 3530
514 Ga0496117_0039138 3300048920 Bacteria 3503
515 Ga0496117_0100878 3300048920 Bacteria 1827
516 Ga0496117_0238911 3300048920 Bacteria 999
517 Ga0496118_0001660 3300048921 Bacteria 32686
518 Ga0496118_0002237 3300048921 Bacteria 26627
519 Ga0496118_0022178 3300048921 Bacteria 5562
520 Ga0496118_0023158 3300048921 Bacteria 5405
521 Ga0496118_0059547 3300048921 Bacteria 2842
522 Ga0496118_0065918 3300048921 Bacteria 2646
523 Ga0496118_0144466 3300048921 Bacteria 1501
524 Ga0496118_0197634 3300048921 Bacteria 1195
525 Ga0496119_0137285 3300048922 Bacteria 1325
526 Ga0496121_0002599 3300048924 Bacteria 27274
527 Ga0496121_0009993 3300048924 Bacteria 10790
528 Ga0496121_0022077 3300048924 Bacteria 6196
529 Ga0496121_0063660 3300048924 Bacteria 3011
530 Ga0496121_0663442 3300048924 Bacteria 633
531 Ga0496122_0012863 3300048925 Bacteria 8272
532 Ga0496122_0365283 3300048925 Bacteria 747
533 Ga0496124_0016758 3300048927 Bacteria 6948
534 Ga0496124_0087381 3300048927 Bacteria 2550
535 Ga0496125_0199932 3300048928 Bacteria 1309
536 Ga0496125_0453035 3300048928 Bacteria 734
537 Ga0496126_0000550 3300048929 Bacteria 72171
538 Ga0496126_0000603 3300048929 Bacteria 67970
539 Ga0496126_0001193 3300048929 Bacteria 42367
540 Ga0496126_0007155 3300048929 Bacteria 12286
541 Ga0496126_0154882 3300048929 Bacteria 1962
542 Ga0496126_0187498 3300048929 Bacteria 1753
543 Ga0495678_070839 3300049459 Bacteria 1279
544 Ga0495682_0058182 3300049460 Bacteria 1398
545 Ga0501040_0232925 3300049576 Bacteria 1312
546 Ga0500618_019147 3300053125 Bacteria 1686
547 Ga0500559_0241731 3300053136 Bacteria 851
548 Ga0466962_0000559 3300061719 Bacteria 16346
549 Ga0466962_0003200 3300061719 Bacteria 7776
550 Ga0466962_0005084 3300061719 Bacteria 6326
551 Ga0466962_0009369 3300061719 Bacteria 4693
552 Ga0466962_0024089 3300061719 Bacteria 2924
553 Ga0466962_0091643 3300061719 Bacteria 1456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2894652903 2894655144 158
2 iso_pu_bacteria 2823421272 2823425760 159
3 iso_pu_bacteria 2904434214 2904434757 159
4 3300013100 Ga0157373_10005042 Ga0157373_100050424 160
5 3300027312 Ga0209371_1001480 Ga0209371_100148013 160
6 3300030500 Ga0268256_1002184 Ga0268256_10021843 160
7 3300048909 Ga0496106_0000152 Ga0496106_0000152_15438_15926 160
8 3300048924 Ga0496121_0002599 Ga0496121_0002599_968_1456 160
9 3300048927 Ga0496124_0087381 Ga0496124_0087381_1724_2212 160
10 iso_pu_bacteria 2600254954 2600444139 160
11 iso_pu_bacteria 2600255389 2602008383 160
12 iso_pu_bacteria 8034962539 8034965086 160
13 3300053125 Ga0500618_019147 Ga0500618_019147_775_1266 161
14 3300005365 Ga0070688_100466779 Ga0070688_1004667792 162
15 3300005455 Ga0070663_100202895 Ga0070663_1002028952 162
16 3300005616 Ga0068852_100227256 Ga0068852_1002272561 162
17 3300026142 Ga0207698_10244432 Ga0207698_102444322 162
18 3300048921 Ga0496118_0144466 Ga0496118_0144466_278_781 162
19 3300053136 Ga0500559_0241731 Ga0500559_0241731_72_563 162
20 iso_pu_bacteria 2919501602 2919502518 162
21 iso_pu_bacteria 2926063275 2926064191 162
22 3300044693 Ga0466961_0560433 Ga0466961_0560433_128_628 163
23 3300045836 Ga0466958_0066003 Ga0466958_0066003_1349_1849 163
24 3300048905 Ga0496102_0575624 Ga0496102_0575624_532_1026 163
25 3300048920 Ga0496117_0009771 Ga0496117_0009771_5067_5561 163
26 3300048929 Ga0496126_0000550 Ga0496126_0000550_50646_51140 163
27 iso_pu_bacteria 2513237166 2514046190 163
28 iso_pu_bacteria 2721755763 2723876850 163
29 iso_pu_bacteria 2721755763 2723877514 163
30 iso_pu_bacteria 2791355137 2792835728 163
31 3300021377 Ga0213874_10059495 Ga0213874_100594952 164
32 3300039450 Ga0436363_0769086 Ga0436363_0769086_973_1482 164
33 3300042439 Ga0439464_0002118 Ga0439464_0002118_610_1119 164
34 iso_pu_bacteria 2501025501 2501070897 164
35 iso_pu_bacteria 2501025502 2501084872 164
36 iso_pu_bacteria 2501025504 2501413725 164
37 iso_pu_bacteria 2508501125 2509131668 164
38 iso_pu_bacteria 2510065045 2510251340 164
39 iso_pu_bacteria 2510917013 2511089596 164
40 iso_pu_bacteria 2510917014 2511095005 164
41 iso_pu_bacteria 2510917015 2511104661 164
42 iso_pu_bacteria 2512047030 2512345732 164
43 iso_pu_bacteria 2513237082 2513551474 164
44 iso_pu_bacteria 2513237083 2513560124 164
45 iso_pu_bacteria 2513237151 2513959974 164
46 iso_pu_bacteria 2513237166 2514054142 164
47 iso_pu_bacteria 2515154122 2515680983 164
48 iso_pu_bacteria 2515154123 2515689272 164
49 iso_pu_bacteria 2515154189 2516016881 164
50 iso_pu_bacteria 2526164713 2527078067 164
51 iso_pu_bacteria 2562617112 2563058660 164
52 iso_pu_bacteria 2711768613 2713476691 164
53 iso_pu_bacteria 2718217991 2719640458 164
54 iso_pu_bacteria 2738541296 2738818293 164
55 iso_pu_bacteria 2738541298 2738831550 164
56 iso_pu_bacteria 2738541306 2738873078 164
57 iso_pu_bacteria 2738543002 2739184708 164
58 iso_pu_bacteria 2738543008 2739219677 164
59 iso_pu_bacteria 2751185846 2753567163 164
60 iso_pu_bacteria 2791355137 2792835914 164
61 iso_pu_bacteria 2808606384 2808972323 164
62 iso_pu_bacteria 2808606390 2809007152 164
63 iso_pu_bacteria 2808606391 2809014290 164
64 iso_pu_bacteria 2885270888 2885274625 164
65 iso_pu_bacteria 2902682994 2902683558 164
66 iso_pu_bacteria 2904483920 2904485391 164
67 iso_pu_bacteria 2919527303 2919532425 164
68 iso_pu_bacteria 2921643360 2921651805 164
69 iso_pu_bacteria 2928157003 2928160094 164
70 iso_pu_bacteria 2928163908 2928168534 164
71 iso_pu_bacteria 2945934425 2945936590 164
72 iso_pu_bacteria 2981990288 2981994752 164
73 iso_pu_bacteria 2990703756 2990709479 164
74 iso_pu_bacteria 641736151 642426082 164
75 iso_pu_bacteria 641736154 642419168 164
76 iso_pu_bacteria 642555112 642593074 164
77 iso_pu_bacteria 8003955200 8003957389 164
78 iso_pu_bacteria 8055301274 8055302915 164
79 3300001989 JGI24739J22299_10009821 JGI24739J22299_100098213 165
80 3300002067 JGI24735J21928_10000485 JGI24735J21928_1000048514 165
81 3300005335 Ga0070666_10549032 Ga0070666_105490322 165
82 3300005337 Ga0070682_100613032 Ga0070682_1006130322 165
83 3300005455 Ga0070663_100079743 Ga0070663_1000797432 165
84 3300009011 Ga0105251_10000167 Ga0105251_1000016718 165
85 3300009036 Ga0105244_10034804 Ga0105244_100348043 165
86 3300009093 Ga0105240_10375303 Ga0105240_103753032 165
87 3300009098 Ga0105245_10145089 Ga0105245_101450893 165
88 3300009101 Ga0105247_10375409 Ga0105247_103754092 165
89 3300009176 Ga0105242_10455490 Ga0105242_104554902 165
90 3300009176 Ga0105242_10902578 Ga0105242_109025781 165
91 3300009177 Ga0105248_10081405 Ga0105248_100814052 165
92 3300009545 Ga0105237_10200694 Ga0105237_102006942 165
93 3300009551 Ga0105238_10047045 Ga0105238_100470452 165
94 3300010375 Ga0105239_10253753 Ga0105239_102537532 165
95 3300011119 Ga0105246_10115539 Ga0105246_101155391 165
96 3300013105 Ga0157369_10407142 Ga0157369_104071422 165
97 3300013296 Ga0157374_10115416 Ga0157374_101154162 165
98 3300013306 Ga0163162_10015796 Ga0163162_100157966 165
99 3300013307 Ga0157372_12402744 Ga0157372_124027441 165
100 3300013308 Ga0157375_10104604 Ga0157375_101046041 165
101 3300014969 Ga0157376_10834587 Ga0157376_108345872 165
102 3300025206 Ga0209435_115408 Ga0209435_1154082 165
103 3300025302 Ga0207426_1011873 Ga0207426_10118733 165
104 3300025735 Ga0207713_1000353 Ga0207713_100035310 165
105 3300025900 Ga0207710_10195976 Ga0207710_101959762 165
106 3300025904 Ga0207647_10115106 Ga0207647_101151062 165
107 3300025924 Ga0207694_10138865 Ga0207694_101388652 165
108 3300025934 Ga0207686_10303272 Ga0207686_103032722 165
109 3300026067 Ga0207678_10128195 Ga0207678_101281952 165
110 3300046457 Ga0495590_0006332 Ga0495590_0006332_2097_2600 165
111 3300046458 Ga0495591_118092 Ga0495591_118092_79_579 165
112 3300046460 Ga0495638_0021487 Ga0495638_0021487_412_912 165
113 3300046474 Ga0495605_0015977 Ga0495605_0015977_330_830 165
114 3300046476 Ga0495662_0179379 Ga0495662_0179379_168_671 165
115 3300046477 Ga0495664_0165326 Ga0495664_0165326_334_837 165
116 3300046492 Ga0495585_0082419 Ga0495585_0082419_67_567 165
117 3300046507 Ga0495606_0105777 Ga0495606_0105777_1035_1535 165
118 3300046515 Ga0495620_0045295 Ga0495620_0045295_1076_1579 165
119 3300046523 Ga0495644_0042927 Ga0495644_0042927_927_1427 165
120 3300046528 Ga0495642_0042181 Ga0495642_0042181_430_933 165
121 3300046615 Ga0495656_0281354 Ga0495656_0281354_175_675 165
122 3300046648 Ga0495611_0084411 Ga0495611_0084411_423_923 165
123 3300046684 Ga0495669_0026149 Ga0495669_0026149_1824_2324 165
124 3300046694 Ga0495649_0172704 Ga0495649_0172704_366_866 165
125 3300046794 Ga0495589_0065954 Ga0495589_0065954_347_847 165
126 3300046809 Ga0495600_0677339 Ga0495600_0677339_109_612 165
127 3300047320 Ga0495672_0003576 Ga0495672_0003576_95_595 165
128 3300047322 Ga0495680_0282523 Ga0495680_0282523_33_536 165
129 3300047323 Ga0495683_0009111 Ga0495683_0009111_1870_2373 165
130 3300047443 Ga0495687_000022 Ga0495687_000022_20196_20696 165
131 3300047673 Ga0495593_0074185 Ga0495593_0074185_884_1387 165
132 3300048088 Ga0495602_0385517 Ga0495602_0385517_340_840 165
133 3300048903 Ga0496100_0005188 Ga0496100_0005188_4067_4570 165
134 3300048904 Ga0496101_0238395 Ga0496101_0238395_214_714 165
135 3300048905 Ga0496102_0000258 Ga0496102_0000258_60404_60907 165
136 3300048905 Ga0496102_0028699 Ga0496102_0028699_1073_1573 165
137 3300048906 Ga0496103_0000326 Ga0496103_0000326_39838_40341 165
138 3300048907 Ga0496104_0408212 Ga0496104_0408212_298_798 165
139 3300048909 Ga0496106_0011971 Ga0496106_0011971_4885_5388 165
140 3300048910 Ga0496107_0033074 Ga0496107_0033074_462_965 165
141 3300048912 Ga0496109_0044685 Ga0496109_0044685_802_1305 165
142 3300048913 Ga0496110_0022852 Ga0496110_0022852_3466_3969 165
143 3300048914 Ga0496111_0017829 Ga0496111_0017829_4110_4613 165
144 3300048915 Ga0496112_0008966 Ga0496112_0008966_1837_2340 165
145 3300048916 Ga0496113_0009988 Ga0496113_0009988_301_804 165
146 3300048917 Ga0496114_0193347 Ga0496114_0193347_745_1245 165
147 3300048919 Ga0496116_0002942 Ga0496116_0002942_15330_15833 165
148 3300048920 Ga0496117_0038718 Ga0496117_0038718_2028_2531 165
149 3300048921 Ga0496118_0022178 Ga0496118_0022178_386_889 165
150 3300048921 Ga0496118_0023158 Ga0496118_0023158_2895_3398 165
151 3300048924 Ga0496121_0009993 Ga0496121_0009993_6160_6663 165
152 3300048925 Ga0496122_0012863 Ga0496122_0012863_2058_2561 165
153 3300048927 Ga0496124_0016758 Ga0496124_0016758_2303_2806 165
154 3300048929 Ga0496126_0000603 Ga0496126_0000603_13911_14414 165
155 3300048929 Ga0496126_0154882 Ga0496126_0154882_825_1328 165
156 3300049459 Ga0495678_070839 Ga0495678_070839_680_1180 165
157 iso_pu_bacteria 2818991450 2819622930 165
158 iso_pu_bacteria 2904615490 2904624044 165
159 iso_pu_bacteria 2928108538 2928113441 165
160 iso_pu_bacteria 2928135762 2928140600 165
161 iso_pu_bacteria 2928503688 2928507312 165
162 iso_pu_bacteria 8055266321 8055269983 165
163 3300009174 Ga0105241_10190219 Ga0105241_101902192 166
164 3300025913 Ga0207695_10912944 Ga0207695_109129441 166
165 3300046459 Ga0495629_0278928 Ga0495629_0278928_154_660 166
166 3300046507 Ga0495606_0161585 Ga0495606_0161585_584_1090 166
167 3300046516 Ga0495628_0305287 Ga0495628_0305287_330_836 166
168 3300046517 Ga0495630_0089299 Ga0495630_0089299_1590_2096 166
169 3300046535 Ga0495586_0266390 Ga0495586_0266390_150_656 166
170 3300046663 Ga0495635_0175237 Ga0495635_0175237_312_818 166
171 3300046679 Ga0495623_0025020 Ga0495623_0025020_381_887 166
172 3300047317 Ga0495604_0177437 Ga0495604_0177437_132_638 166
173 3300047444 Ga0495675_0422644 Ga0495675_0422644_202_708 166
174 3300048088 Ga0495602_0271492 Ga0495602_0271492_733_1239 166
175 3300048904 Ga0496101_0001195 Ga0496101_0001195_11_517 166
176 3300048907 Ga0496104_0127605 Ga0496104_0127605_859_1365 166
177 3300048908 Ga0496105_1141473 Ga0496105_1141473_28_534 166
178 3300048917 Ga0496114_0239397 Ga0496114_0239397_202_708 166
179 3300048918 Ga0496115_0376141 Ga0496115_0376141_162_668 166
180 3300048922 Ga0496119_0137285 Ga0496119_0137285_481_987 166
181 3300048928 Ga0496125_0453035 Ga0496125_0453035_135_641 166
182 3300005339 Ga0070660_100051434 Ga0070660_1000514342 167
183 3300005366 Ga0070659_100364124 Ga0070659_1003641241 167
184 3300005563 Ga0068855_100004438 Ga0068855_1000044384 167
185 3300005578 Ga0068854_100600050 Ga0068854_1006000502 167
186 3300009093 Ga0105240_11496985 Ga0105240_114969851 167
187 3300009545 Ga0105237_10061510 Ga0105237_100615104 167
188 3300010375 Ga0105239_10903853 Ga0105239_109038532 167
189 3300013104 Ga0157370_10019712 Ga0157370_100197125 167
190 3300013105 Ga0157369_10000622 Ga0157369_1000062220 167
191 3300013306 Ga0163162_10010173 Ga0163162_100101736 167
192 3300025909 Ga0207705_10000771 Ga0207705_1000077118 167
193 3300025914 Ga0207671_10060762 Ga0207671_100607623 167
194 3300025919 Ga0207657_10099893 Ga0207657_100998933 167
195 3300025932 Ga0207690_10285182 Ga0207690_102851822 167
196 3300025949 Ga0207667_10000347 Ga0207667_1000034746 167
197 3300025981 Ga0207640_10920846 Ga0207640_109208462 167
198 3300037312 Ga0395899_0126815 Ga0395899_0126815_1049_1558 167
199 3300037418 Ga0395900_0000098 Ga0395900_0000098_18341_18850 167
200 3300037418 Ga0395900_0090596 Ga0395900_0090596_1541_2050 167
201 3300037466 Ga0395898_0000577 Ga0395898_0000577_45505_46014 167
202 3300038443 Ga0395901_0132444 Ga0395901_0132444_1735_2244 167
203 3300041411 Ga0439466_0021077 Ga0439466_0021077_1633_2148 167
204 3300044656 Ga0466969_0032783 Ga0466969_0032783_463_972 167
205 3300044658 Ga0466972_0036637 Ga0466972_0036637_385_894 167
206 3300044684 Ga0466966_0000005 Ga0466966_0000005_75509_76018 167
207 3300044684 Ga0466966_0000730 Ga0466966_0000730_2163_2672 167
208 3300044693 Ga0466961_0000908 Ga0466961_0000908_14394_14903 167
209 3300044693 Ga0466961_0163748 Ga0466961_0163748_215_724 167
210 3300044693 Ga0466961_0422360 Ga0466961_0422360_51_560 167
211 3300044694 Ga0466963_0007803 Ga0466963_0007803_4711_5220 167
212 3300044694 Ga0466963_0008927 Ga0466963_0008927_5083_5592 167
213 3300044719 Ga0466971_0000225 Ga0466971_0000225_1486_1995 167
214 3300044842 Ga0466957_0042293 Ga0466957_0042293_148_657 167
215 3300044842 Ga0466957_0642740 Ga0466957_0642740_145_657 167
216 3300045049 Ga0466959_0079981 Ga0466959_0079981_1053_1562 167
217 3300045836 Ga0466958_0000956 Ga0466958_0000956_1181_1690 167
218 3300046471 Ga0495650_0044762 Ga0495650_0044762_1146_1652 167
219 3300047472 Ga0495686_0000002 Ga0495686_0000002_835713_836219 167
220 3300048924 Ga0496121_0663442 Ga0496121_0663442_60_566 167
221 3300061719 Ga0466962_0000559 Ga0466962_0000559_2763_3272 167
222 3300061719 Ga0466962_0024089 Ga0466962_0024089_1561_2070 167
223 3300001979 JGI24740J21852_10024443 JGI24740J21852_100244432 168
224 3300001989 JGI24739J22299_10092672 JGI24739J22299_100926721 168
225 3300001990 JGI24737J22298_10072481 JGI24737J22298_100724812 168
226 3300002067 JGI24735J21928_10000198 JGI24735J21928_100001984 168
227 3300002067 JGI24735J21928_10012106 JGI24735J21928_100121062 168
228 3300002067 JGI24735J21928_10018106 JGI24735J21928_100181062 168
229 3300002705 JGI25156J39149_1000552 JGI25156J39149_10005529 168
230 3300002705 JGI25156J39149_1001925 JGI25156J39149_10019255 168
231 3300003214 JGI25165J46597_1001281 JGI25165J46597_100128111 168
232 3300003316 rootH1_10012924 rootH1_100129246 168
233 3300003756 Ga0055533_1000099 Ga0055533_100009948 168
234 3300003756 Ga0055533_1003392 Ga0055533_10033923 168
235 3300003758 Ga0055532_1000010 Ga0055532_1000010234 168
236 3300003758 Ga0055532_1003241 Ga0055532_10032413 168
237 3300003760 Ga0055527_1000008 Ga0055527_1000008234 168
238 3300003760 Ga0055527_1000433 Ga0055527_10004333 168
239 3300003761 Ga0055535_1000007 Ga0055535_1000007234 168
240 3300003761 Ga0055535_1001075 Ga0055535_10010753 168
241 3300003762 Ga0055542_1000011 Ga0055542_1000011234 168
242 3300003762 Ga0055542_1018459 Ga0055542_10184592 168
243 3300003763 Ga0055529_1000009 Ga0055529_1000009234 168
244 3300005327 Ga0070658_10440466 Ga0070658_104404662 168
245 3300005327 Ga0070658_10692268 Ga0070658_106922682 168
246 3300005339 Ga0070660_100000110 Ga0070660_10000011017 168
247 3300005339 Ga0070660_100002002 Ga0070660_1000020024 168
248 3300005366 Ga0070659_100000096 Ga0070659_10000009616 168
249 3300005455 Ga0070663_100005838 Ga0070663_1000058386 168
250 3300005457 Ga0070662_100740223 Ga0070662_1007402231 168
251 3300005563 Ga0068855_100000976 Ga0068855_10000097630 168
252 3300005578 Ga0068854_100168030 Ga0068854_1001680302 168
253 3300005616 Ga0068852_100017957 Ga0068852_1000179572 168
254 3300005616 Ga0068852_100713825 Ga0068852_1007138252 168
255 3300009092 Ga0105250_10014587 Ga0105250_100145872 168
256 3300009092 Ga0105250_10328946 Ga0105250_103289462 168
257 3300009093 Ga0105240_10007702 Ga0105240_1000770216 168
258 3300009098 Ga0105245_10930624 Ga0105245_109306241 168
259 3300009545 Ga0105237_10062425 Ga0105237_100624254 168
260 3300009545 Ga0105237_10593886 Ga0105237_105938862 168
261 3300009551 Ga0105238_10081003 Ga0105238_100810032 168
262 3300010375 Ga0105239_10001287 Ga0105239_1000128729 168
263 3300010375 Ga0105239_10172755 Ga0105239_101727552 168
264 3300013100 Ga0157373_10010952 Ga0157373_100109528 168
265 3300013104 Ga0157370_10002999 Ga0157370_100029999 168
266 3300013105 Ga0157369_10002802 Ga0157369_100028027 168
267 3300013105 Ga0157369_10145826 Ga0157369_101458264 168
268 3300013105 Ga0157369_10977690 Ga0157369_109776902 168
269 3300013296 Ga0157374_10000033 Ga0157374_1000003326 168
270 3300013307 Ga0157372_10000399 Ga0157372_1000039924 168
271 3300014497 Ga0182008_10022296 Ga0182008_100222962 168
272 3300016635 Ga0183361_10006 Ga0183361_1000698 168
273 3300021384 Ga0213876_10003186 Ga0213876_100031864 168
274 3300025226 Ga0209674_100022 Ga0209674_100022365 168
275 3300025226 Ga0209674_100164 Ga0209674_10016471 168
276 3300025228 Ga0209672_100001 Ga0209672_100001372 168
277 3300025228 Ga0209672_100023 Ga0209672_100023261 168
278 3300025228 Ga0209672_101336 Ga0209672_1013365 168
279 3300025229 Ga0209147_100001 Ga0209147_100001372 168
280 3300025229 Ga0209147_100094 Ga0209147_10009481 168
281 3300025230 Ga0209563_100280 Ga0209563_1002803 168
282 3300025231 Ga0207427_100993 Ga0207427_1009939 168
283 3300025242 Ga0209258_100001 Ga0209258_100001372 168
284 3300025242 Ga0209258_100142 Ga0209258_10014270 168
285 3300025254 Ga0209148_1000003 Ga0209148_1000003372 168
286 3300025254 Ga0209148_1001163 Ga0209148_10011635 168
287 3300025256 Ga0209759_1000102 Ga0209759_100010240 168
288 3300025256 Ga0209759_1000158 Ga0209759_100015879 168
289 3300025256 Ga0209759_1002481 Ga0209759_10024812 168
290 3300025261 Ga0209233_1000061 Ga0209233_1000061121 168
291 3300025272 Ga0209455_1000001 Ga0209455_1000001372 168
292 3300025272 Ga0209455_1000724 Ga0209455_100072418 168
293 3300025904 Ga0207647_10002830 Ga0207647_100028307 168
294 3300025904 Ga0207647_10021652 Ga0207647_100216522 168
295 3300025909 Ga0207705_10063418 Ga0207705_100634182 168
296 3300025913 Ga0207695_10000879 Ga0207695_1000087939 168
297 3300025913 Ga0207695_10279925 Ga0207695_102799252 168
298 3300025914 Ga0207671_10105563 Ga0207671_101055632 168
299 3300025919 Ga0207657_10000004 Ga0207657_10000004112 168
300 3300025919 Ga0207657_10000269 Ga0207657_1000026917 168
301 3300025919 Ga0207657_10199476 Ga0207657_101994762 168
302 3300025924 Ga0207694_10125036 Ga0207694_101250363 168
303 3300025927 Ga0207687_11162433 Ga0207687_111624331 168
304 3300025932 Ga0207690_10000015 Ga0207690_10000015181 168
305 3300025949 Ga0207667_10007627 Ga0207667_100076279 168
306 3300025949 Ga0207667_10043226 Ga0207667_100432264 168
307 3300025981 Ga0207640_10252081 Ga0207640_102520812 168
308 3300026041 Ga0207639_11481816 Ga0207639_114818161 168
309 3300026067 Ga0207678_10016268 Ga0207678_100162686 168
310 3300026067 Ga0207678_10374905 Ga0207678_103749051 168
311 3300026142 Ga0207698_10016539 Ga0207698_100165396 168
312 3300026142 Ga0207698_10807530 Ga0207698_108075302 168
313 3300030500 Ga0268256_1006866 Ga0268256_10068662 168
314 3300031548 Ga0307408_100000002 Ga0307408_100000002449 168
315 3300031911 Ga0307412_10000003 Ga0307412_10000003277 168
316 3300037312 Ga0395899_0004268 Ga0395899_0004268_8901_9419 168
317 3300037312 Ga0395899_0060176 Ga0395899_0060176_589_1107 168
318 3300037418 Ga0395900_0009132 Ga0395900_0009132_3974_4492 168
319 3300037418 Ga0395900_0036588 Ga0395900_0036588_3276_3794 168
320 3300037418 Ga0395900_0128788 Ga0395900_0128788_1870_2382 168
321 3300037418 Ga0395900_0536444 Ga0395900_0536444_124_636 168
322 3300037466 Ga0395898_0006441 Ga0395898_0006441_6979_7497 168
323 3300037466 Ga0395898_0134288 Ga0395898_0134288_1668_2180 168
324 3300037466 Ga0395898_0173425 Ga0395898_0173425_1254_1772 168
325 3300037471 Ga0395905_0000076 Ga0395905_0000076_44720_45232 168
326 3300037471 Ga0395905_0267474 Ga0395905_0267474_643_1161 168
327 3300038443 Ga0395901_0008971 Ga0395901_0008971_3943_4461 168
328 3300038443 Ga0395901_0253640 Ga0395901_0253640_1153_1671 168
329 3300039438 Ga0436360_0297094 Ga0436360_0297094_413_925 168
330 3300039447 Ga0436361_0909556 Ga0436361_0909556_4229_4741 168
331 3300039447 Ga0436361_1059219 Ga0436361_1059219_1826_2338 168
332 3300042005 Ga0439448_0008800 Ga0439448_0008800_405_917 168
333 3300044656 Ga0466969_0000516 Ga0466969_0000516_11224_11736 168
334 3300044656 Ga0466969_0009291 Ga0466969_0009291_1587_2102 168
335 3300044659 Ga0466973_0021282 Ga0466973_0021282_2121_2633 168
336 3300044683 Ga0466965_0000114 Ga0466965_0000114_7572_8084 168
337 3300044684 Ga0466966_0003394 Ga0466966_0003394_9160_9675 168
338 3300044684 Ga0466966_0046108 Ga0466966_0046108_2185_2697 168
339 3300044693 Ga0466961_0015322 Ga0466961_0015322_4185_4700 168
340 3300044694 Ga0466963_0006960 Ga0466963_0006960_1552_2064 168
341 3300044706 Ga0466964_0017477 Ga0466964_0017477_396_908 168
342 3300044735 Ga0466968_0215466 Ga0466968_0215466_332_844 168
343 3300044765 Ga0466970_0016750 Ga0466970_0016750_2972_3487 168
344 3300044842 Ga0466957_0002300 Ga0466957_0002300_1114_1626 168
345 3300045049 Ga0466959_0134571 Ga0466959_0134571_304_819 168
346 3300045836 Ga0466958_0193365 Ga0466958_0193365_697_1209 168
347 3300045976 Ga0466967_0163334 Ga0466967_0163334_1071_1583 168
348 3300046454 Ga0495592_0014327 Ga0495592_0014327_3452_3964 168
349 3300046459 Ga0495629_0017113 Ga0495629_0017113_2101_2613 168
350 3300046462 Ga0495651_0186555 Ga0495651_0186555_520_1032 168
351 3300046463 Ga0495653_0066182 Ga0495653_0066182_583_1095 168
352 3300046463 Ga0495653_0146689 Ga0495653_0146689_945_1457 168
353 3300046471 Ga0495650_0022089 Ga0495650_0022089_1533_2045 168
354 3300046472 Ga0495580_0068770 Ga0495580_0068770_1232_1744 168
355 3300046474 Ga0495605_0021562 Ga0495605_0021562_24_536 168
356 3300046477 Ga0495664_0001809 Ga0495664_0001809_1837_2349 168
357 3300046491 Ga0495584_0092340 Ga0495584_0092340_324_836 168
358 3300046500 Ga0495596_0033332 Ga0495596_0033332_222_734 168
359 3300046506 Ga0495583_0018670 Ga0495583_0018670_3009_3521 168
360 3300046507 Ga0495606_0015096 Ga0495606_0015096_1177_1689 168
361 3300046511 Ga0495608_0036968 Ga0495608_0036968_1469_1981 168
362 3300046512 Ga0495610_0000208 Ga0495610_0000208_52433_52945 168
363 3300046513 Ga0495616_0301384 Ga0495616_0301384_70_582 168
364 3300046514 Ga0495618_0001153 Ga0495618_0001153_14341_14853 168
365 3300046517 Ga0495630_0017440 Ga0495630_0017440_1605_2117 168
366 3300046517 Ga0495630_0019508 Ga0495630_0019508_2584_3096 168
367 3300046524 Ga0495648_0016563 Ga0495648_0016563_3068_3580 168
368 3300046524 Ga0495648_0024837 Ga0495648_0024837_2617_3129 168
369 3300046526 Ga0495666_0008258 Ga0495666_0008258_2893_3405 168
370 3300046528 Ga0495642_0090968 Ga0495642_0090968_716_1228 168
371 3300046529 Ga0495652_0188071 Ga0495652_0188071_1034_1546 168
372 3300046531 Ga0495665_0014577 Ga0495665_0014577_961_1473 168
373 3300046533 Ga0495640_0009969 Ga0495640_0009969_1676_2188 168
374 3300046535 Ga0495586_0015109 Ga0495586_0015109_1875_2387 168
375 3300046536 Ga0495587_0016946 Ga0495587_0016946_3871_4383 168
376 3300046542 Ga0495597_0217797 Ga0495597_0217797_73_585 168
377 3300046543 Ga0495645_0046546 Ga0495645_0046546_396_908 168
378 3300046543 Ga0495645_0139302 Ga0495645_0139302_1139_1651 168
379 3300046642 Ga0495634_0027023 Ga0495634_0027023_3031_3543 168
380 3300046642 Ga0495634_0062818 Ga0495634_0062818_796_1308 168
381 3300046663 Ga0495635_0008509 Ga0495635_0008509_4546_5058 168
382 3300046675 Ga0495657_0030240 Ga0495657_0030240_2339_2851 168
383 3300046679 Ga0495623_0017722 Ga0495623_0017722_3462_3974 168
384 3300046680 Ga0495646_0014132 Ga0495646_0014132_4242_4754 168
385 3300046680 Ga0495646_0038718 Ga0495646_0038718_1849_2361 168
386 3300046689 Ga0495613_0055876 Ga0495613_0055876_355_867 168
387 3300046690 Ga0495624_0055329 Ga0495624_0055329_1799_2311 168
388 3300046694 Ga0495649_0020117 Ga0495649_0020117_701_1213 168
389 3300047317 Ga0495604_0418895 Ga0495604_0418895_335_847 168
390 3300047319 Ga0495674_0043542 Ga0495674_0043542_12_524 168
391 3300047320 Ga0495672_0239562 Ga0495672_0239562_73_585 168
392 3300047322 Ga0495680_0004910 Ga0495680_0004910_8887_9399 168
393 3300047322 Ga0495680_0042520 Ga0495680_0042520_2904_3416 168
394 3300047323 Ga0495683_0008845 Ga0495683_0008845_3213_3725 168
395 3300047323 Ga0495683_0012623 Ga0495683_0012623_1706_2218 168
396 3300047323 Ga0495683_0022009 Ga0495683_0022009_1426_1938 168
397 3300047323 Ga0495683_0240244 Ga0495683_0240244_42_554 168
398 3300047443 Ga0495687_012482 Ga0495687_012482_975_1487 168
399 3300047443 Ga0495687_081893 Ga0495687_081893_661_1173 168
400 3300047444 Ga0495675_0018648 Ga0495675_0018648_1682_2194 168
401 3300047446 Ga0495679_012722 Ga0495679_012722_2057_2569 168
402 3300047446 Ga0495679_073433 Ga0495679_073433_18_530 168
403 3300047469 Ga0495673_0077877 Ga0495673_0077877_167_679 168
404 3300047471 Ga0495684_0929584 Ga0495684_0929584_17_529 168
405 3300047673 Ga0495593_0009276 Ga0495593_0009276_56_568 168
406 3300047673 Ga0495593_0023636 Ga0495593_0023636_1763_2275 168
407 3300048088 Ga0495602_0023771 Ga0495602_0023771_1319_1831 168
408 3300048088 Ga0495602_0130773 Ga0495602_0130773_1012_1524 168
409 3300048089 Ga0495614_0001352 Ga0495614_0001352_7991_8503 168
410 3300048904 Ga0496101_0371583 Ga0496101_0371583_121_633 168
411 3300048907 Ga0496104_0221007 Ga0496104_0221007_1090_1602 168
412 3300048908 Ga0496105_0159745 Ga0496105_0159745_18_530 168
413 3300048910 Ga0496107_0569793 Ga0496107_0569793_159_671 168
414 3300048911 Ga0496108_1258992 Ga0496108_1258992_77_589 168
415 3300048913 Ga0496110_0664834 Ga0496110_0664834_19_531 168
416 3300048915 Ga0496112_1232768 Ga0496112_1232768_94_606 168
417 3300048920 Ga0496117_0039138 Ga0496117_0039138_1492_2004 168
418 3300048920 Ga0496117_0238911 Ga0496117_0238911_179_691 168
419 3300048921 Ga0496118_0002237 Ga0496118_0002237_23382_23894 168
420 3300048921 Ga0496118_0059547 Ga0496118_0059547_469_981 168
421 3300048924 Ga0496121_0063660 Ga0496121_0063660_116_628 168
422 3300049460 Ga0495682_0058182 Ga0495682_0058182_209_721 168
423 3300061719 Ga0466962_0005084 Ga0466962_0005084_584_1096 168
424 iso_pu_bacteria 2501025502 2501080849 168
425 iso_pu_bacteria 2510917013 2511086718 168
426 3300009011 Ga0105251_10003286 Ga0105251_1000328611 169
427 3300015261 Ga0182006_1108183 Ga0182006_11081832 169
428 3300015262 Ga0182007_10000507 Ga0182007_1000050713 169
429 3300025904 Ga0207647_10036924 Ga0207647_100369243 169
430 3300026116 Ga0207674_10232019 Ga0207674_102320192 169
431 3300048905 Ga0496102_0064409 Ga0496102_0064409_970_1485 169
432 3300048921 Ga0496118_0001660 Ga0496118_0001660_6103_6618 169
433 3300048929 Ga0496126_0001193 Ga0496126_0001193_6798_7313 169
434 3300013104 Ga0157370_10342202 Ga0157370_103422021 170
435 3300044656 Ga0466969_0054915 Ga0466969_0054915_320_853 170
436 3300044693 Ga0466961_0573563 Ga0466961_0573563_12_545 170
437 3300044842 Ga0466957_0315322 Ga0466957_0315322_176_697 170
438 iso_pu_bacteria 2738541296 2738821681 170
439 iso_pu_bacteria 2738541298 2738834163 170
440 iso_pu_bacteria 2738541306 2738875367 170
441 iso_pu_bacteria 2738543002 2739187320 170
442 iso_pu_bacteria 2738543008 2739221965 170
443 iso_pu_bacteria 2945934425 2945938130 170
444 iso_pu_bacteria 2990703756 2990705153 170
445 iso_pu_bacteria 641736151 642426206 170
446 3300049576 Ga0501040_0232925 Ga0501040_0232925_336_881 171
447 iso_pu_bacteria 2596583598 2597032381 171
448 iso_pu_bacteria 2599185178 2599448471 171
449 iso_pu_bacteria 2885266251 2885268786 171
450 iso_pu_bacteria 2928058823 2928060543 171
451 3300044656 Ga0466969_0203242 Ga0466969_0203242_288_815 172
452 3300044683 Ga0466965_0042490 Ga0466965_0042490_901_1428 172
453 3300044684 Ga0466966_0048275 Ga0466966_0048275_705_1232 172
454 3300044693 Ga0466961_0060717 Ga0466961_0060717_1214_1741 172
455 3300044706 Ga0466964_0010442 Ga0466964_0010442_2751_3278 172
456 3300044735 Ga0466968_0030781 Ga0466968_0030781_582_1109 172
457 3300044765 Ga0466970_0006869 Ga0466970_0006869_2608_3135 172
458 3300044842 Ga0466957_0029864 Ga0466957_0029864_745_1272 172
459 3300045049 Ga0466959_0045589 Ga0466959_0045589_1974_2501 172
460 3300045836 Ga0466958_0059657 Ga0466958_0059657_573_1100 172
461 3300001979 JGI24740J21852_10000760 JGI24740J21852_1000076010 173
462 3300001989 JGI24739J22299_10041929 JGI24739J22299_100419292 173
463 3300001990 JGI24737J22298_10017912 JGI24737J22298_100179122 173
464 3300002067 JGI24735J21928_10003047 JGI24735J21928_100030475 173
465 3300002075 JGI24738J21930_10010548 JGI24738J21930_100105483 173
466 3300005327 Ga0070658_10191013 Ga0070658_101910133 173
467 3300005366 Ga0070659_100013948 Ga0070659_1000139486 173
468 3300005539 Ga0068853_100482895 Ga0068853_1004828951 173
469 3300005563 Ga0068855_100002760 Ga0068855_1000027603 173
470 3300009093 Ga0105240_10621786 Ga0105240_106217862 173
471 3300009545 Ga0105237_10060739 Ga0105237_100607395 173
472 3300013102 Ga0157371_10031371 Ga0157371_100313711 173
473 3300013104 Ga0157370_10000470 Ga0157370_1000047045 173
474 3300013104 Ga0157370_10018114 Ga0157370_100181148 173
475 3300013105 Ga0157369_10000837 Ga0157369_1000083716 173
476 3300013105 Ga0157369_10002473 Ga0157369_1000247310 173
477 3300013105 Ga0157369_10479038 Ga0157369_104790382 173
478 3300020070 Ga0206356_11384741 Ga0206356_113847414 173
479 3300020082 Ga0206353_10827992 Ga0206353_108279921 173
480 3300021377 Ga0213874_10082557 Ga0213874_100825571 173
481 3300022467 Ga0224712_10002502 Ga0224712_100025026 173
482 3300025256 Ga0209759_1012301 Ga0209759_10123012 173
483 3300025904 Ga0207647_10048344 Ga0207647_100483442 173
484 3300025909 Ga0207705_10001865 Ga0207705_1000186516 173
485 3300025913 Ga0207695_10456736 Ga0207695_104567362 173
486 3300025914 Ga0207671_10031885 Ga0207671_100318855 173
487 3300025932 Ga0207690_10023724 Ga0207690_100237245 173
488 3300025949 Ga0207667_10258453 Ga0207667_102584532 173
489 3300031911 Ga0307412_10000044 Ga0307412_1000004487 173
490 3300037312 Ga0395899_0000007 Ga0395899_0000007_453728_454255 173
491 3300037312 Ga0395899_0469333 Ga0395899_0469333_213_740 173
492 3300037418 Ga0395900_0000026 Ga0395900_0000026_138069_138596 173
493 3300037418 Ga0395900_0227657 Ga0395900_0227657_864_1391 173
494 3300037418 Ga0395900_0523329 Ga0395900_0523329_473_1000 173
495 3300037466 Ga0395898_0000085 Ga0395898_0000085_65604_66131 173
496 3300037466 Ga0395898_0002532 Ga0395898_0002532_10503_11030 173
497 3300037466 Ga0395898_0115932 Ga0395898_0115932_1402_1929 173
498 3300038443 Ga0395901_0000045 Ga0395901_0000045_73991_74518 173
499 3300038443 Ga0395901_0000088 Ga0395901_0000088_21296_21823 173
500 3300038443 Ga0395901_0000130 Ga0395901_0000130_69918_70445 173
501 3300038443 Ga0395901_0178427 Ga0395901_0178427_1617_2144 173
502 3300038443 Ga0395901_0365289 Ga0395901_0365289_877_1404 173
503 3300039437 Ga0436365_1679636 Ga0436365_1679636_1491_2018 173
504 3300039450 Ga0436363_1321106 Ga0436363_1321106_5463_6002 173
505 3300044684 Ga0466966_0000061 Ga0466966_0000061_8781_9308 173
506 3300044684 Ga0466966_0013754 Ga0466966_0013754_2904_3431 173
507 3300044693 Ga0466961_0001421 Ga0466961_0001421_7137_7664 173
508 3300044694 Ga0466963_0105019 Ga0466963_0105019_179_706 173
509 3300044719 Ga0466971_0001560 Ga0466971_0001560_5187_5714 173
510 3300045836 Ga0466958_0002970 Ga0466958_0002970_2350_2877 173
511 3300045836 Ga0466958_0030602 Ga0466958_0030602_1320_1847 173
512 3300045836 Ga0466958_0155904 Ga0466958_0155904_124_651 173
513 3300046474 Ga0495605_0110268 Ga0495605_0110268_126_662 173
514 3300046491 Ga0495584_0408339 Ga0495584_0408339_88_624 173
515 3300046500 Ga0495596_0030974 Ga0495596_0030974_1416_1952 173
516 3300046512 Ga0495610_0003579 Ga0495610_0003579_4504_5040 173
517 3300046522 Ga0495643_0130161 Ga0495643_0130161_276_812 173
518 3300046694 Ga0495649_0022834 Ga0495649_0022834_2420_2956 173
519 3300046794 Ga0495589_0083331 Ga0495589_0083331_643_1179 173
520 3300047323 Ga0495683_0156765 Ga0495683_0156765_73_609 173
521 3300048091 Ga0495626_0036774 Ga0495626_0036774_1224_1760 173
522 3300048920 Ga0496117_0100878 Ga0496117_0100878_619_1155 173
523 3300048921 Ga0496118_0065918 Ga0496118_0065918_1523_2059 173
524 3300048925 Ga0496122_0365283 Ga0496122_0365283_157_693 173
525 3300048929 Ga0496126_0187498 Ga0496126_0187498_128_673 173
526 3300061719 Ga0466962_0003200 Ga0466962_0003200_5006_5533 173
527 3300061719 Ga0466962_0091643 Ga0466962_0091643_21_548 173
528 3300048929 Ga0496126_0007155 Ga0496126_0007155_4679_5236 174
529 3300001915 JGI24741J21665_1000205 JGI24741J21665_100020513 175
530 3300001979 JGI24740J21852_10000417 JGI24740J21852_1000041710 175
531 3300001979 JGI24740J21852_10000439 JGI24740J21852_1000043913 175
532 3300002705 JGI25156J39149_1003155 JGI25156J39149_10031554 175
533 3300002705 JGI25156J39149_1007233 JGI25156J39149_10072334 175
534 3300002705 JGI25156J39149_1027078 JGI25156J39149_10270782 175
535 3300002738 JGI25154J39366_1002472 JGI25154J39366_10024723 175
536 3300003320 rootH2_10072807 rootH2_100728073 175
537 3300003323 rootH1_10129794 rootH1_101297943 175
538 3300003578 Ga0006562J51391_1049819 Ga0006562J51391_10498192 175
539 3300003578 Ga0006562J51391_1049820 Ga0006562J51391_10498202 175
540 3300003752 Ga0055539_1000073 Ga0055539_1000073127 175
541 3300003752 Ga0055539_1019396 Ga0055539_10193962 175
542 3300003756 Ga0055533_1002937 Ga0055533_10029375 175
543 3300003756 Ga0055533_1003532 Ga0055533_10035322 175
544 3300003756 Ga0055533_1003879 Ga0055533_10038793 175
545 3300003758 Ga0055532_1000090 Ga0055532_100009086 175
546 3300003759 Ga0055525_1004901 Ga0055525_10049011 175
547 3300003760 Ga0055527_1000900 Ga0055527_10009005 175
548 3300003761 Ga0055535_1000085 Ga0055535_100008586 175
549 3300003762 Ga0055542_1004528 Ga0055542_10045282 175
550 3300003763 Ga0055529_1000134 Ga0055529_100013420 175
551 3300003841 Ga0055541_1000346 Ga0055541_100034610 175
552 3300005344 Ga0070661_100000683 Ga0070661_1000006839 175
553 3300005366 Ga0070659_100001478 Ga0070659_10000147813 175
554 3300005455 Ga0070663_100000251 Ga0070663_10000025124 175
555 3300005535 Ga0070684_101473944 Ga0070684_1014739441 175
556 3300005564 Ga0070664_100000623 Ga0070664_10000062324 175
557 3300005577 Ga0068857_100024577 Ga0068857_1000245773 175
558 3300005578 Ga0068854_100000308 Ga0068854_10000030811 175
559 3300005614 Ga0068856_100001206 Ga0068856_10000120624 175
560 3300005616 Ga0068852_100338929 Ga0068852_1003389291 175
561 3300009093 Ga0105240_10133560 Ga0105240_101335602 175
562 3300009093 Ga0105240_10501831 Ga0105240_105018312 175
563 3300009174 Ga0105241_10081593 Ga0105241_100815932 175
564 3300013100 Ga0157373_10016497 Ga0157373_100164974 175
565 3300013100 Ga0157373_10224519 Ga0157373_102245192 175
566 3300013102 Ga0157371_10001237 Ga0157371_1000123724 175
567 3300013104 Ga0157370_10000930 Ga0157370_1000093034 175
568 3300013105 Ga0157369_10034929 Ga0157369_100349293 175
569 3300013307 Ga0157372_10001285 Ga0157372_1000128524 175
570 3300014497 Ga0182008_10032247 Ga0182008_100322472 175
571 3300015261 Ga0182006_1005021 Ga0182006_10050212 175
572 3300015261 Ga0182006_1081738 Ga0182006_10817381 175
573 3300015262 Ga0182007_10008292 Ga0182007_100082922 175
574 3300020070 Ga0206356_10303557 Ga0206356_103035571 175
575 3300020076 Ga0206355_1026994 Ga0206355_10269942 175
576 3300020610 Ga0154015_1153479 Ga0154015_11534797 175
577 3300025224 Ga0209784_100006 Ga0209784_100006186 175
578 3300025224 Ga0209784_100428 Ga0209784_1004288 175
579 3300025224 Ga0209784_101544 Ga0209784_1015442 175
580 3300025225 Ga0209566_100002 Ga0209566_100002186 175
581 3300025225 Ga0209566_100572 Ga0209566_1005728 175
582 3300025226 Ga0209674_100010 Ga0209674_100010951 175
583 3300025226 Ga0209674_100355 Ga0209674_1003558 175
584 3300025226 Ga0209674_103435 Ga0209674_1034352 175
585 3300025228 Ga0209672_100110 Ga0209672_10011026 175
586 3300025228 Ga0209672_100806 Ga0209672_1008067 175
587 3300025229 Ga0209147_100018 Ga0209147_100018319 175
588 3300025230 Ga0209563_100041 Ga0209563_100041286 175
589 3300025242 Ga0209258_100028 Ga0209258_100028319 175
590 3300025246 Ga0209646_1000153 Ga0209646_10001539 175
591 3300025250 Ga0209026_1004636 Ga0209026_10046365 175
592 3300025253 Ga0209677_100007 Ga0209677_100007186 175
593 3300025253 Ga0209677_106575 Ga0209677_1065752 175
594 3300025254 Ga0209148_1000297 Ga0209148_100029764 175
595 3300025254 Ga0209148_1005602 Ga0209148_10056024 175
596 3300025256 Ga0209759_1003417 Ga0209759_10034177 175
597 3300025272 Ga0209455_1000107 Ga0209455_100010719 175
598 3300025911 Ga0207654_10139086 Ga0207654_101390862 175
599 3300025913 Ga0207695_10008368 Ga0207695_100083685 175
600 3300025920 Ga0207649_10000668 Ga0207649_1000066824 175
601 3300025932 Ga0207690_10001619 Ga0207690_100016199 175
602 3300025941 Ga0207711_10041382 Ga0207711_100413824 175
603 3300025945 Ga0207679_10000349 Ga0207679_1000034924 175
604 3300025981 Ga0207640_10000490 Ga0207640_1000049014 175
605 3300026067 Ga0207678_10000911 Ga0207678_1000091110 175
606 3300026078 Ga0207702_10006736 Ga0207702_1000673610 175
607 3300026116 Ga0207674_10056006 Ga0207674_100560064 175
608 3300026142 Ga0207698_10146977 Ga0207698_101469772 175
609 3300037312 Ga0395899_0185398 Ga0395899_0185398_444_986 175
610 3300037418 Ga0395900_0023556 Ga0395900_0023556_5409_5936 175
611 3300039447 Ga0436361_1204147 Ga0436361_1204147_148_675 175
612 3300044650 Ga0466986_0171352 Ga0466986_0171352_793_1320 175
613 3300044656 Ga0466969_0192892 Ga0466969_0192892_137_664 175
614 3300044658 Ga0466972_0005219 Ga0466972_0005219_1279_1806 175
615 3300044672 Ga0466982_0049283 Ga0466982_0049283_583_1110 175
616 3300044683 Ga0466965_0036949 Ga0466965_0036949_141_668 175
617 3300044693 Ga0466961_0000656 Ga0466961_0000656_4977_5504 175
618 3300044706 Ga0466964_0057717 Ga0466964_0057717_695_1222 175
619 3300044735 Ga0466968_0024757 Ga0466968_0024757_385_912 175
620 3300044765 Ga0466970_0018570 Ga0466970_0018570_183_710 175
621 3300044901 Ga0466960_0175312 Ga0466960_0175312_552_1079 175
622 3300045049 Ga0466959_0016104 Ga0466959_0016104_786_1313 175
623 3300045976 Ga0466967_0156457 Ga0466967_0156457_175_702 175
624 3300045976 Ga0466967_0684948 Ga0466967_0684948_363_890 175
625 3300048909 Ga0496106_0000016 Ga0496106_0000016_4621_5184 175
626 3300048919 Ga0496116_0293801 Ga0496116_0293801_101_646 175
627 3300048921 Ga0496118_0197634 Ga0496118_0197634_287_826 175
628 3300048924 Ga0496121_0022077 Ga0496121_0022077_3457_4020 175
629 3300048928 Ga0496125_0199932 Ga0496125_0199932_681_1208 175
630 3300061719 Ga0466962_0009369 Ga0466962_0009369_159_686 175
631 iso_pu_bacteria 2513237151 2513963045 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04115

Ureidogly_lyase

Ureidoglycolate lyase

8

167

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bdr-assembly1.cif.gz_B crystal structure of the putative ureidoglycolate hydrolase pp4288 from pseudomonas putida, northeast structural genomics target ppr49 0.9341 9 168
1xsr-assembly1.cif.gz_B x-ray structure of northeast structural genomics consortium target sfr7 0.8991 9 166
2bdr-assembly1.cif.gz_B crystal structure of the putative ureidoglycolate hydrolase pp4288 from pseudomonas putida, northeast structural genomics target ppr49 0.8969 9 168
1yqc-assembly1.cif.gz_B crystal structure of ureidoglycolate hydrolase (alla) from escherichia coli o157:h7 0.8962 9 166
1xsq-assembly1.cif.gz_A crystal structure of ureidoglycolate hydrolase from e.coli. northeast structural genomics consortium target et81. 0.8951 9 166
ID Description Score Start End Superfamily
2bdrB00 Mainly Beta;Sandwich;Jelly Rolls;Ureidoglycolate hydrolase 0.913 11 168 2.60.120.480
2bdrB00 Mainly Beta;Sandwich;Jelly Rolls;Ureidoglycolate hydrolase 0.8968 11 168 2.60.120.480
af_O13843_3_189_2.60.120.480 Mainly Beta;Sandwich;Jelly Rolls;Ureidoglycolate hydrolase 0.895 9 166 2.60.120.480
1xsqA00 Mainly Beta;Sandwich;Jelly Rolls;Ureidoglycolate hydrolase 0.8909 11 166 2.60.120.480
1xsqA00 Mainly Beta;Sandwich;Jelly Rolls;Ureidoglycolate hydrolase 0.8634 11 166 2.60.120.480
ID Description Score Start End GO Terms
AF-A0A5E5PCB7-F1-model_v4 Ureidoglycolate hydrolase 0.9899 79 174 GO:0000256
GO:0004848
GO:0006144
GO:0050385
AF-A0A4V2WWU7-F1-model_v4 deleted 0.9773 58 147
AF-A0A4V2WTT5-F1-model_v4 deleted 0.9736 65 166
AF-N6YRA5-F1-model_v4 Ureidoglycolate hydrolase 0.9668 80 162 GO:0000256
GO:0004848
GO:0006144
GO:0050385
AF-A0A522JUX1-F1-model_v4 Ureidoglycolate lyase (EC 4.3.2.3) 0.9654 9 174 GO:0000256
GO:0004848
GO:0006144
GO:0050385

Feature Viewer

pLDDT pTM Quality
93.65 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map