F470878

General Info

Members Datasets Scaffolds Average Seq Length
630 420 474 309

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2510065059|2510314008
Length 341
Sequence VAEGQFCLYYKDRTISVIKTDMAEFTLHDLQCFDAVVRTGGFQPAAAVLHRSHPAVFAAVAKLERQLGLSLLDRSGYRVRPTEAGLSFHRRALSLLRELDGLRVHAAQLAMGEESEIHVVIGDLCPRPQVLGMLGRFFAQCPGTRLHLHFEAVGGPCERLFDDEADLILHWVDKGDARVEWVDLCKVSFIPVVAPGFLPDRIEQPIALDQMQALTQCVMRDSARHSPQQNYSLLEGAPQCLVADQGMKKEIILQGLGWGHLPRFLIEDELQDGRLRSIAGRHLPGRTDELVVARRRDRPHGPIANRLWDHIQQEAPALRRALEPRRIPTNQSRKAQVEIGR

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
3 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
4 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
5 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
6 2512875024 Mesorhizobium loti R88b Isolate Nodule
7 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
8 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
9 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
10 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
11 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
12 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
13 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
14 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
15 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
16 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
17 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
18 2643221559 Lysobacter sp. Root559 Isolate Unclassified
19 2643221569 Achromobacter sp. Root565 Isolate Unclassified
20 2643221573 Lysobacter sp. Root604 Isolate Unclassified
21 2643221586 Lysobacter sp. Root667 Isolate Unclassified
22 2643221593 Lysobacter sp. Root690 Isolate Unclassified
23 2643221612 Lysobacter sp. Root76 Isolate Unclassified
24 2643221621 Achromobacter sp. Root83 Isolate Unclassified
25 2643221720 Lysobacter sp. Root916 Isolate Unclassified
26 2643221727 Lysobacter sp. Root96 Isolate Unclassified
27 2643221728 Lysobacter sp. Root983 Isolate Unclassified
28 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
29 2818991436 Collimonas arenae 515 Isolate Unclassified
30 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
31 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
32 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
33 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
34 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
35 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
36 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
37 2858950400 Achromobacter sp. K91 Isolate Unclassified
38 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
39 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
40 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
41 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
42 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
43 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
44 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
45 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
46 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
47 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
48 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
49 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
50 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
51 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
52 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
53 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
54 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
55 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
56 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
57 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
58 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
59 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
60 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
61 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
62 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
63 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
64 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
65 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
66 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
67 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
68 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
69 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
70 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
71 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
72 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
73 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
74 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
75 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
76 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
77 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
78 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
79 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
80 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
81 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
82 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
83 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
84 2928058823 Ralstonia sp. 1138 Isolate Unclassified
85 2928070936 Variovorax gossypii 1167 Isolate Unclassified
86 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
87 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
88 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
89 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
90 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
91 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
92 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
93 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
94 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
95 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
96 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
97 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
98 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
99 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
100 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
101 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
102 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
103 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
104 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
105 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
106 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
107 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
108 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
109 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
110 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
111 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
112 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
113 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
114 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
115 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
116 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
117 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
118 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
119 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
120 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
121 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
122 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
123 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
124 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
125 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
126 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
127 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
128 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
129 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
130 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
131 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
132 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
133 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
134 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
135 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
136 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
137 3004167301 Mesorhizobium loti 582 Isolate Unclassified
138 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
139 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
140 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
141 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
142 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
143 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
144 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
145 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
146 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
147 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
148 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
149 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
150 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
151 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
152 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
153 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
154 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
155 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
156 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
157 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
158 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
159 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
160 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
161 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
162 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
163 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
164 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
165 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
166 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
167 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
168 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
169 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
170 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
171 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
172 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
173 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
174 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
175 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
176 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
177 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
178 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
179 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
180 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
181 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
182 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
183 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
184 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
185 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
186 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
187 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
188 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
189 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
190 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
191 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
192 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
193 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
194 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
195 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
196 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
197 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
198 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
199 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
200 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
201 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
202 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
203 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
204 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
205 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
206 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
207 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
208 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
209 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
210 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
211 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
212 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
213 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
214 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
215 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
216 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
217 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
218 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
219 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
220 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
221 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
222 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
223 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
224 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
225 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
226 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
227 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
228 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
229 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
230 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
231 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
232 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
234 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
241 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
242 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
244 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
245 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
246 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
249 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
250 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
251 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
252 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
255 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
256 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
258 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
260 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
262 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
286 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
289 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
290 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
291 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
292 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
293 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
294 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
295 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
296 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
297 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
298 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
299 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
300 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
301 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
302 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
303 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
304 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
305 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
306 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
307 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
308 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
309 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
310 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
311 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
312 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
313 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
316 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
317 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
318 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
319 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
320 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
321 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
322 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
323 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
324 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
325 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
326 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
327 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
328 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
329 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
330 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
331 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
332 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
333 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
334 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
335 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
336 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
337 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
338 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
339 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
340 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
341 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
342 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
343 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
344 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
345 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
346 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
347 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
348 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
349 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
350 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
351 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
352 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
353 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
354 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
355 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
356 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
357 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
361 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
362 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
363 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
364 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
365 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
366 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
367 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
368 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
369 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
370 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
371 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
372 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
373 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
374 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
375 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
376 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
377 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
381 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
382 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
385 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
386 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
387 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
388 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
389 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
390 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
391 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
392 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
393 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
394 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
395 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
396 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
397 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
398 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
399 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
400 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
404 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
405 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
406 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
407 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
408 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
409 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
410 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
411 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
412 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
413 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
414 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
415 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
416 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
417 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
418 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
419 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
420 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.76
Metatranscriptomes 0.48
Isolates 24.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.68
Nodule 17.78
Rhizoplane 1.9
Rhizosphere 47.78
Stem 0
Stem Tuber 0
Unclassified 12.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000103 3300001979 Bacteria 30266
2 JGI24740J21852_10002230 3300001979 Bacteria 8848
3 JGI24735J21928_10013646 3300002067 Bacteria 2551
4 JGI25156J39149_1000084 3300002705 Bacteria 70001
5 JGI25156J39149_1006519 3300002705 Bacteria 3178
6 JGI25162J39368_1000021 3300002737 Bacteria 248155
7 JGI25157J39369_1000039 3300002741 Bacteria 128766
8 JGI25152J39213_1000906 3300002773 Bacteria 14520
9 JGI25150J39212_1000577 3300002774 Bacteria 14573
10 JGI25159J45721_1000817 3300002987 Bacteria 13566
11 JGI25151J46595_10000325 3300003187 Bacteria 51727
12 JGI25151J46595_10001674 3300003187 Bacteria 14520
13 JGI25165J46597_1000049 3300003214 Bacteria 248154
14 JGI25153J46596_10001381 3300003215 Bacteria 14520
15 rootH1_10030891 3300003316 Bacteria 2527
16 rootH2_10030598 3300003320 Bacteria 18898
17 rootH2_10054119 3300003320 Bacteria 1754
18 rootH2_10239084 3300003320 Bacteria 1872
19 rootL2_10042288 3300003322 Bacteria 2819
20 rootH1_10028363 3300003323 Bacteria 4216
21 rootH1_10032240 3300003323 Bacteria 9642
22 rootH1_10212107 3300003323 Bacteria 1700
23 JGI25160J50197_1003834 3300003354 Bacteria 6604
24 JGI25161J50226_1001843 3300003374 Bacteria 5932
25 Ga0055538_1000023 3300003751 Bacteria 248154
26 Ga0055539_1000030 3300003752 Bacteria 248154
27 Ga0055539_1000086 3300003752 Bacteria 117621
28 Ga0055539_1000157 3300003752 Bacteria 65224
29 Ga0055539_1000198 3300003752 Bacteria 48821
30 Ga0055539_1000503 3300003752 Bacteria 12131
31 Ga0055533_1000008 3300003756 Bacteria 575861
32 Ga0055533_1000024 3300003756 Bacteria 338067
33 Ga0055533_1000039 3300003756 Bacteria 248154
34 Ga0055533_1001665 3300003756 Bacteria 5706
35 Ga0055533_1003765 3300003756 Bacteria 2932
36 Ga0055532_1000041 3300003758 Bacteria 195749
37 Ga0055525_1000048 3300003759 Bacteria 248154
38 Ga0055525_1000292 3300003759 Bacteria 45067
39 Ga0055525_1000667 3300003759 Bacteria 13198
40 Ga0055527_1003790 3300003760 Bacteria 2177
41 Ga0055527_1004922 3300003760 Bacteria 1788
42 Ga0055535_1000030 3300003761 Bacteria 195749
43 Ga0055542_1000675 3300003762 Bacteria 27508
44 Ga0055529_1000058 3300003763 Bacteria 195735
45 Ga0055529_1002284 3300003763 Bacteria 3859
46 Ga0055526_1000003 3300003771 Bacteria 413092
47 Ga0055526_1001904 3300003771 Bacteria 14454
48 Ga0055526_1003210 3300003771 Bacteria 10563
49 Ga0055537_1000002 3300003773 Bacteria 250042
50 Ga0055537_1001929 3300003773 Bacteria 7426
51 Ga0055524_1000002 3300003775 Bacteria 459550
52 Ga0055524_1001315 3300003775 Bacteria 14520
53 Ga0055536_1018549 3300003781 Bacteria 2225
54 Ga0055534_1000005 3300003784 Bacteria 238704
55 Ga0055534_1002066 3300003784 Bacteria 7244
56 Ga0055528_1000155 3300003790 Bacteria 56992
57 Ga0055528_1003814 3300003790 Bacteria 7426
58 Ga0055540_1010228 3300003792 Bacteria 3139
59 Ga0055531_10029104 3300003794 Bacteria 1889
60 Ga0055541_1000021 3300003841 Bacteria 248154
61 Ga0055541_1002711 3300003841 Bacteria 3462
62 Ga0055543_1000864 3300004625 Bacteria 14558
63 Ga0065165_1002639 3300005262 Bacteria 14558
64 Ga0070658_10046038 3300005327 Bacteria 3530
65 Ga0070658_10072204 3300005327 Bacteria 2828
66 Ga0070658_10151230 3300005327 Bacteria 1943
67 Ga0070658_10395999 3300005327 Bacteria 1186
68 Ga0070683_100018697 3300005329 Bacteria 6141
69 Ga0070660_100024983 3300005339 Bacteria 4437
70 Ga0070660_100083194 3300005339 Bacteria 2514
71 Ga0070660_100276729 3300005339 Bacteria 1373
72 Ga0070689_100003694 3300005340 Bacteria 10225
73 Ga0070661_100000240 3300005344 Bacteria 45120
74 Ga0070661_100045895 3300005344 Bacteria 3195
75 Ga0070661_100116323 3300005344 Bacteria 2000
76 Ga0070688_100204254 3300005365 Bacteria 1384
77 Ga0070659_100001341 3300005366 Bacteria 17720
78 Ga0070714_100022585 3300005435 Bacteria 5159
79 Ga0070713_100023602 3300005436 Bacteria 4775
80 Ga0070663_100000015 3300005455 Bacteria 131905
81 Ga0070662_100133250 3300005457 Bacteria 1918
82 Ga0070665_100561696 3300005548 Bacteria 1154
83 Ga0068855_100005737 3300005563 Bacteria 15157
84 Ga0068855_100007133 3300005563 Bacteria 13556
85 Ga0068855_100119372 3300005563 Bacteria 3019
86 Ga0070664_100000068 3300005564 Bacteria 64073
87 Ga0070664_100075031 3300005564 Bacteria 2903
88 Ga0068857_100001477 3300005577 Bacteria 18702
89 Ga0068857_100026702 3300005577 Bacteria 5089
90 Ga0068854_100000864 3300005578 Bacteria 18156
91 Ga0068854_100008593 3300005578 Bacteria 6573
92 Ga0068856_100000488 3300005614 Bacteria 43810
93 Ga0068856_100002946 3300005614 Bacteria 17445
94 Ga0068856_100062966 3300005614 Bacteria 3664
95 Ga0068852_100000153 3300005616 Bacteria 46292
96 Ga0068852_100283356 3300005616 Bacteria 1598
97 Ga0068860_100033574 3300005843 Bacteria 4923
98 Ga0068862_100119895 3300005844 Bacteria 2318
99 Ga0075365_10072107 3300006038 Bacteria 2326
100 Ga0075363_100038285 3300006048 Bacteria 2521
101 Ga0075364_10001095 3300006051 Bacteria 14473
102 Ga0075367_10065380 3300006178 Bacteria 2178
103 Ga0075366_10133780 3300006195 Bacteria 1497
104 Ga0075428_100001742 3300006844 Bacteria 23226
105 Ga0075431_100000070 3300006847 Bacteria 59538
106 Ga0075429_100001242 3300006880 Bacteria 20672
107 Ga0105240_10002925 3300009093 Bacteria 26951
108 Ga0105240_10019438 3300009093 Bacteria 9075
109 Ga0105240_10069007 3300009093 Bacteria 4377
110 Ga0105240_10121568 3300009093 Bacteria 3143
111 Ga0111539_10000519 3300009094 Bacteria 48758
112 Ga0114129_10129026 3300009147 Bacteria 3475
113 Ga0105241_10026029 3300009174 Bacteria 4352
114 Ga0105237_10006506 3300009545 Bacteria 12942
115 Ga0105237_10049411 3300009545 Bacteria 4228
116 Ga0105237_10107108 3300009545 Bacteria 2787
117 Ga0105238_10001405 3300009551 Bacteria 24159
118 Ga0105238_10740891 3300009551 Bacteria 996
119 Ga0105239_10008447 3300010375 Bacteria 11712
120 Ga0105239_10040094 3300010375 Bacteria 5130
121 Ga0105239_10126176 3300010375 Bacteria 2844
122 Ga0105239_10252304 3300010375 Bacteria 1982
123 Ga0157373_10004363 3300013100 Bacteria 10654
124 Ga0157373_10042119 3300013100 Bacteria 3264
125 Ga0157371_10000100 3300013102 Bacteria 131924
126 Ga0157371_10010220 3300013102 Bacteria 7330
127 Ga0157370_10000004 3300013104 Bacteria 366426
128 Ga0157370_10012455 3300013104 Bacteria 8817
129 Ga0157370_10051986 3300013104 Bacteria 3912
130 Ga0157369_10000145 3300013105 Bacteria 100895
131 Ga0157369_10000293 3300013105 Bacteria 66670
132 Ga0157369_10001605 3300013105 Bacteria 27686
133 Ga0157369_10027874 3300013105 Bacteria 6257
134 Ga0157369_10088329 3300013105 Bacteria 3308
135 Ga0157374_10009198 3300013296 Bacteria 8470
136 Ga0163162_10117995 3300013306 Bacteria 2755
137 Ga0157372_10000396 3300013307 Bacteria 48144
138 Ga0157372_10061334 3300013307 Bacteria 4210
139 Ga0182008_10007403 3300014497 Bacteria 6064
140 Ga0182008_10009969 3300014497 Bacteria 5103
141 Ga0182008_10043621 3300014497 Bacteria 2232
142 Ga0182008_10089399 3300014497 Bacteria 1518
143 Ga0182006_1000924 3300015261 Bacteria 19620
144 Ga0182006_1014032 3300015261 Bacteria 3460
145 Ga0182007_10002522 3300015262 Bacteria 9030
146 Ga0182007_10052509 3300015262 Bacteria 1343
147 Ga0182007_10086970 3300015262 Unclassified 1028
148 Ga0182005_1000238 3300015265 Bacteria 35328
149 Ga0183360_10003 3300015689 Bacteria 713221
150 Ga0206354_10130670 3300020081 Bacteria 1567
151 Ga0206353_10590062 3300020082 Bacteria 4150
152 Ga0154015_1060319 3300020610 Bacteria 23716
153 Ga0209436_102530 3300025208 Bacteria 5431
154 Ga0209784_100004 3300025224 Bacteria 1378156
155 Ga0209784_100029 3300025224 Bacteria 347315
156 Ga0209784_101418 3300025224 Bacteria 3238
157 Ga0209566_100004 3300025225 Bacteria 1531866
158 Ga0209566_100030 3300025225 Bacteria 347329
159 Ga0209566_100834 3300025225 Bacteria 15499
160 Ga0209674_100006 3300025226 Bacteria 1531866
161 Ga0209674_100007 3300025226 Bacteria 1077082
162 Ga0209674_100015 3300025226 Bacteria 697299
163 Ga0209674_100123 3300025226 Bacteria 131438
164 Ga0209674_103321 3300025226 Bacteria 2999
165 Ga0209672_100165 3300025228 Bacteria 57196
166 Ga0209672_100264 3300025228 Bacteria 38604
167 Ga0209672_100503 3300025228 Bacteria 21673
168 Ga0209147_100008 3300025229 Bacteria 777096
169 Ga0209563_100009 3300025230 Bacteria 1378156
170 Ga0209563_100017 3300025230 Bacteria 796449
171 Ga0209563_100052 3300025230 Bacteria 334307
172 Ga0209563_100091 3300025230 Bacteria 168320
173 Ga0209563_100092 3300025230 Bacteria 167669
174 Ga0207427_100353 3300025231 Bacteria 29338
175 Ga0209437_100004 3300025233 Bacteria 1378156
176 Ga0209258_100013 3300025242 Bacteria 777096
177 Ga0209258_100554 3300025242 Bacteria 33123
178 Ga0207425_1000887 3300025245 Bacteria 14537
179 Ga0207425_1002492 3300025245 Bacteria 6465
180 Ga0209646_1000047 3300025246 Bacteria 323416
181 Ga0209646_1000053 3300025246 Bacteria 284737
182 Ga0209026_1000020 3300025250 Bacteria 376211
183 Ga0209026_1000093 3300025250 Bacteria 170393
184 Ga0209677_100005 3300025253 Bacteria 1378156
185 Ga0209677_100015 3300025253 Bacteria 532137
186 Ga0209677_100030 3300025253 Bacteria 347314
187 Ga0209677_100037 3300025253 Bacteria 286702
188 Ga0209677_100114 3300025253 Bacteria 84101
189 Ga0209148_1000124 3300025254 Bacteria 185123
190 Ga0209759_1000017 3300025256 Bacteria 376232
191 Ga0209759_1003078 3300025256 Bacteria 6860
192 Ga0209759_1006255 3300025256 Bacteria 4031
193 Ga0209759_1007265 3300025256 Bacteria 3590
194 Ga0209759_1007983 3300025256 Bacteria 3343
195 Ga0209129_1000055 3300025258 Bacteria 261708
196 Ga0209233_1000005 3300025261 Bacteria 1531866
197 Ga0209565_1000002 3300025263 Bacteria 1423083
198 Ga0209565_1000315 3300025263 Bacteria 44809
199 Ga0209565_1004458 3300025263 Bacteria 4248
200 Ga0209565_1014423 3300025263 Bacteria 1816
201 Ga0209455_1000062 3300025272 Bacteria 335169
202 Ga0209455_1000106 3300025272 Bacteria 195801
203 Ga0209673_1000002 3300025273 Bacteria 1423083
204 Ga0209673_1000862 3300025273 Bacteria 39375
205 Ga0209130_1000613 3300025284 Bacteria 34101
206 Ga0209675_1000002 3300025291 Bacteria 1423083
207 Ga0209675_1000187 3300025291 Bacteria 68276
208 Ga0209676_1001701 3300025292 Bacteria 19041
209 Ga0209025_1000005 3300025294 Bacteria 1272149
210 Ga0209025_1000183 3300025294 Bacteria 155799
211 Ga0209025_1001233 3300025294 Bacteria 35565
212 Ga0209564_1000004 3300025295 Bacteria 1424639
213 Ga0209564_1000442 3300025295 Bacteria 71380
214 Ga0209758_1000042 3300025297 Bacteria 407145
215 Ga0209758_1003219 3300025297 Bacteria 15208
216 Ga0209256_1000004 3300025299 Bacteria 1424643
217 Ga0209256_1000005 3300025299 Bacteria 1315082
218 Ga0209256_1000148 3300025299 Bacteria 147639
219 Ga0207426_1000055 3300025302 Bacteria 374450
220 Ga0209051_1002668 3300025303 Bacteria 12488
221 Ga0209257_1003188 3300025304 Bacteria 14572
222 Ga0207647_10154768 3300025904 Bacteria 1339
223 Ga0207705_10043120 3300025909 Bacteria 3240
224 Ga0207705_10075179 3300025909 Bacteria 2453
225 Ga0207654_10025451 3300025911 Bacteria 3192
226 Ga0207695_10000409 3300025913 Bacteria 95547
227 Ga0207695_10022583 3300025913 Bacteria 7136
228 Ga0207695_10053264 3300025913 Bacteria 4233
229 Ga0207695_10091758 3300025913 Bacteria 3050
230 Ga0207695_10343515 3300025913 Bacteria 1380
231 Ga0207671_10042960 3300025914 Bacteria 3344
232 Ga0207671_10109701 3300025914 Bacteria 2098
233 Ga0207671_10134355 3300025914 Bacteria 1901
234 Ga0207657_10013341 3300025919 Bacteria 8061
235 Ga0207649_10000240 3300025920 Bacteria 44666
236 Ga0207694_10004848 3300025924 Bacteria 10446
237 Ga0207694_10327244 3300025924 Bacteria 1266
238 Ga0207700_10016769 3300025928 Bacteria 4877
239 Ga0207664_10017681 3300025929 Bacteria 5233
240 Ga0207690_10001049 3300025932 Bacteria 17673
241 Ga0207690_10053356 3300025932 Bacteria 2712
242 Ga0207706_10000266 3300025933 Bacteria 56883
243 Ga0207670_10002104 3300025936 Bacteria 10403
244 Ga0207679_10000038 3300025945 Bacteria 131935
245 Ga0207667_10089941 3300025949 Bacteria 3172
246 Ga0207667_10109918 3300025949 Bacteria 2843
247 Ga0207667_10142016 3300025949 Bacteria 2472
248 Ga0207640_10000437 3300025981 Bacteria 25440
249 Ga0207639_10056801 3300026041 Bacteria 3001
250 Ga0207639_10105736 3300026041 Bacteria 2284
251 Ga0207678_10000021 3300026067 Bacteria 131877
252 Ga0207678_10059893 3300026067 Bacteria 3276
253 Ga0207702_10002441 3300026078 Bacteria 17607
254 Ga0207702_10006990 3300026078 Bacteria 9659
255 Ga0207702_10096385 3300026078 Bacteria 2601
256 Ga0207702_10110408 3300026078 Bacteria 2444
257 Ga0207674_10000455 3300026116 Bacteria 53534
258 Ga0207674_10101152 3300026116 Bacteria 2863
259 Ga0207674_10107740 3300026116 Bacteria 2763
260 Ga0207674_10253645 3300026116 Bacteria 1706
261 Ga0207698_10099664 3300026142 Bacteria 2404
262 Ga0209813_10009733 3300027866 Bacteria 2468
263 Ga0268266_10069984 3300028379 Bacteria 3041
264 Ga0268264_10034678 3300028381 Bacteria 4152
265 Ga0307515_10003157 3300028794 Bacteria 34863
266 Ga0307516_10001053 3300031730 Bacteria 38382
267 Ga0307406_10000332 3300031901 Bacteria 27455
268 Ga0307412_10000169 3300031911 Bacteria 46494
269 Ga0307414_10012648 3300032004 Bacteria 5001
270 Ga0373923_0140796 3300035111 Bacteria 1090
271 Ga0395899_0004996 3300037312 Bacteria 10321
272 Ga0395899_0044015 3300037312 Bacteria 3326
273 Ga0395899_0333710 3300037312 Bacteria 1018
274 Ga0395900_0000053 3300037418 Bacteria 221135
275 Ga0395900_0005273 3300037418 Bacteria 13551
276 Ga0395900_0007445 3300037418 Bacteria 11310
277 Ga0395900_0016734 3300037418 Bacteria 7480
278 Ga0395900_0076063 3300037418 Bacteria 3451
279 Ga0395900_0101733 3300037418 Bacteria 2951
280 Ga0395900_0392309 3300037418 Bacteria 1354
281 Ga0395900_0718573 3300037418 Bacteria 931
282 Ga0395898_0000421 3300037466 Bacteria 90307
283 Ga0395898_0005843 3300037466 Bacteria 13233
284 Ga0395898_0008181 3300037466 Bacteria 11069
285 Ga0395898_0016349 3300037466 Bacteria 7594
286 Ga0395898_0060042 3300037466 Bacteria 3697
287 Ga0395898_0260707 3300037466 Bacteria 1653
288 Ga0395905_0072696 3300037471 Bacteria 3224
289 Ga0395905_0286790 3300037471 Bacteria 1533
290 Ga0395901_0000004 3300038443 Bacteria 657361
291 Ga0395901_0000042 3300038443 Bacteria 201819
292 Ga0395901_0002128 3300038443 Bacteria 20288
293 Ga0395901_0112476 3300038443 Bacteria 2859
294 Ga0395901_0156033 3300038443 Bacteria 2397
295 Ga0395901_0165060 3300038443 Bacteria 2325
296 Ga0439448_0001372 3300042005 Bacteria 6263
297 Ga0439458_0005441 3300042157 Bacteria 2864
298 Ga0466969_0029828 3300044656 Bacteria 2782
299 Ga0466969_0039413 3300044656 Bacteria 2373
300 Ga0466969_0094455 3300044656 Bacteria 1414
301 Ga0466972_0001119 3300044658 Bacteria 12854
302 Ga0466972_0003042 3300044658 Bacteria 8320
303 Ga0466972_0006643 3300044658 Bacteria 5806
304 Ga0466972_0006924 3300044658 Bacteria 5685
305 Ga0466972_0016184 3300044658 Bacteria 3728
306 Ga0466978_0133709 3300044671 Bacteria 1524
307 Ga0466982_0047420 3300044672 Bacteria 2620
308 Ga0466982_0148185 3300044672 Bacteria 1437
309 Ga0466965_0005268 3300044683 Bacteria 5816
310 Ga0466965_0015677 3300044683 Bacteria 3600
311 Ga0466965_0028986 3300044683 Bacteria 2692
312 Ga0466965_0085540 3300044683 Bacteria 1598
313 Ga0466966_0023614 3300044684 Bacteria 4025
314 Ga0466966_0029122 3300044684 Bacteria 3595
315 Ga0466966_0107725 3300044684 Bacteria 1719
316 Ga0466961_0000165 3300044693 Bacteria 44711
317 Ga0466961_0017881 3300044693 Bacteria 4557
318 Ga0466961_0033111 3300044693 Bacteria 3322
319 Ga0466963_0026672 3300044694 Bacteria 3696
320 Ga0466964_0005364 3300044706 Bacteria 4762
321 Ga0466964_0021630 3300044706 Bacteria 2488
322 Ga0466971_0001355 3300044719 Bacteria 10274
323 Ga0466971_0026708 3300044719 Bacteria 2582
324 Ga0466968_0010105 3300044735 Bacteria 3648
325 Ga0466968_0010159 3300044735 Bacteria 3641
326 Ga0466970_0000123 3300044765 Bacteria 34885
327 Ga0466970_0005485 3300044765 Bacteria 6299
328 Ga0466970_0048343 3300044765 Bacteria 2268
329 Ga0466970_0090966 3300044765 Bacteria 1656
330 Ga0466957_0029042 3300044842 Bacteria 3295
331 Ga0466957_0040461 3300044842 Bacteria 2815
332 Ga0466957_0065204 3300044842 Bacteria 2242
333 Ga0466957_0201598 3300044842 Bacteria 1307
334 Ga0466959_0000186 3300045049 Bacteria 40737
335 Ga0466958_0001037 3300045836 Bacteria 12696
336 Ga0466958_0050140 3300045836 Bacteria 2527
337 Ga0466967_0013982 3300045976 Bacteria 6231
338 Ga0466967_0091380 3300045976 Bacteria 2766
339 Ga0495590_0000023 3300046457 Bacteria 196939
340 Ga0495591_000917 3300046458 Bacteria 20363
341 Ga0495629_0018875 3300046459 Bacteria 4929
342 Ga0495638_0003661 3300046460 Bacteria 11979
343 Ga0495651_0042612 3300046462 Bacteria 3523
344 Ga0495653_0026058 3300046463 Bacteria 4692
345 Ga0495650_0000112 3300046471 Bacteria 197339
346 Ga0495650_0001177 3300046471 Bacteria 27813
347 Ga0495580_0014036 3300046472 Bacteria 6092
348 Ga0495582_0020352 3300046473 Bacteria 3631
349 Ga0495605_0000051 3300046474 Bacteria 163067
350 Ga0495639_0008979 3300046475 Bacteria 4286
351 Ga0495662_0010781 3300046476 Bacteria 4469
352 Ga0495664_0010535 3300046477 Bacteria 5190
353 Ga0495584_0002626 3300046491 Bacteria 10135
354 Ga0495585_0120255 3300046492 Bacteria 1390
355 Ga0495607_0002583 3300046501 Bacteria 14589
356 Ga0495583_0000324 3300046506 Bacteria 75413
357 Ga0495583_0000392 3300046506 Bacteria 66871
358 Ga0495606_0000487 3300046507 Bacteria 64941
359 Ga0495606_0003419 3300046507 Bacteria 16863
360 Ga0495608_0004371 3300046511 Bacteria 10129
361 Ga0495608_0026255 3300046511 Bacteria 3971
362 Ga0495618_0018820 3300046514 Bacteria 4243
363 Ga0495618_0041326 3300046514 Bacteria 2903
364 Ga0495628_0011279 3300046516 Bacteria 7560
365 Ga0495628_0078445 3300046516 Bacteria 2568
366 Ga0495630_0013041 3300046517 Bacteria 6039
367 Ga0495643_0000049 3300046522 Bacteria 212242
368 Ga0495643_0004961 3300046522 Bacteria 9137
369 Ga0495643_0026385 3300046522 Bacteria 3278
370 Ga0495648_0000008 3300046524 Bacteria 336584
371 Ga0495648_0022159 3300046524 Bacteria 4381
372 Ga0495666_0000580 3300046526 Bacteria 16370
373 Ga0495642_0000531 3300046528 Bacteria 19380
374 Ga0495642_0000763 3300046528 Bacteria 15832
375 Ga0495665_0000462 3300046531 Bacteria 20440
376 Ga0495640_0002036 3300046533 Bacteria 16127
377 Ga0495587_0030200 3300046536 Bacteria 3287
378 Ga0495609_0038983 3300046538 Bacteria 2140
379 Ga0495645_0133893 3300046543 Bacteria 1734
380 Ga0495622_0000392 3300046557 Bacteria 29644
381 Ga0495622_0018881 3300046557 Bacteria 3213
382 Ga0495633_0000339 3300046558 Bacteria 52477
383 Ga0495668_0000347 3300046616 Bacteria 61748
384 Ga0495668_0003749 3300046616 Bacteria 11157
385 Ga0495625_0000378 3300046660 Bacteria 67950
386 Ga0495625_0008790 3300046660 Bacteria 8553
387 Ga0495625_0034659 3300046660 Bacteria 3724
388 Ga0495635_0059351 3300046663 Bacteria 2630
389 Ga0495635_0114164 3300046663 Bacteria 1844
390 Ga0495661_0010374 3300046665 Bacteria 6358
391 Ga0495661_0021239 3300046665 Bacteria 4234
392 Ga0495599_0001463 3300046678 Bacteria 13565
393 Ga0495599_0064172 3300046678 Bacteria 2294
394 Ga0495623_0013868 3300046679 Bacteria 5225
395 Ga0495623_0255111 3300046679 Bacteria 985
396 Ga0495646_0005970 3300046680 Bacteria 7717
397 Ga0495669_0007115 3300046684 Bacteria 4687
398 Ga0495613_0006773 3300046689 Bacteria 8554
399 Ga0495624_0064794 3300046690 Bacteria 2283
400 Ga0495649_0000207 3300046694 Bacteria 51510
401 Ga0495649_0012344 3300046694 Bacteria 4976
402 Ga0495589_0016036 3300046794 Bacteria 3850
403 Ga0495589_0027204 3300046794 Bacteria 2893
404 Ga0495600_0004081 3300046809 Bacteria 8686
405 Ga0495660_0000100 3300046810 Bacteria 92354
406 Ga0495604_0058913 3300047317 Bacteria 2947
407 Ga0495672_0007664 3300047320 Bacteria 8093
408 Ga0495676_0018306 3300047321 Bacteria 6176
409 Ga0495680_0037551 3300047322 Bacteria 3878
410 Ga0495683_0006670 3300047323 Bacteria 6289
411 Ga0495683_0013982 3300047323 Bacteria 4183
412 Ga0495683_0043337 3300047323 Bacteria 2266
413 Ga0495687_000016 3300047443 Bacteria 359237
414 Ga0495687_001387 3300047443 Bacteria 22378
415 Ga0495687_009393 3300047443 Bacteria 5468
416 Ga0495675_0003886 3300047444 Bacteria 9058
417 Ga0495677_0001394 3300047445 Bacteria 9678
418 Ga0495679_010441 3300047446 Bacteria 3646
419 Ga0495673_0010113 3300047469 Bacteria 5159
420 Ga0495593_0002320 3300047673 Bacteria 11427
421 Ga0495602_0093150 3300048088 Bacteria 2493
422 Ga0495602_0191744 3300048088 Bacteria 1566
423 Ga0495614_0009407 3300048089 Bacteria 4321
424 Ga0495626_0000904 3300048091 Bacteria 26200
425 Ga0496102_0123136 3300048905 Bacteria 2423
426 Ga0496104_0415251 3300048907 Bacteria 1258
427 Ga0496107_0130345 3300048910 Bacteria 1856
428 Ga0496112_0307192 3300048915 Bacteria 1531
429 Ga0496113_0004513 3300048916 Bacteria 8574
430 Ga0496114_0054716 3300048917 Bacteria 3328
431 Ga0496115_0031719 3300048918 Bacteria 4164
432 Ga0496116_0001705 3300048919 Bacteria 24088
433 Ga0496116_0041591 3300048919 Bacteria 3152
434 Ga0496117_0010670 3300048920 Bacteria 8324
435 Ga0496117_0107808 3300048920 Bacteria 1744
436 Ga0496118_0004821 3300048921 Bacteria 15730
437 Ga0496120_0011401 3300048923 Bacteria 6113
438 Ga0496121_0000724 3300048924 Bacteria 61072
439 Ga0496121_0002018 3300048924 Bacteria 32204
440 Ga0496121_0196525 3300048924 Bacteria 1441
441 Ga0496122_0000410 3300048925 Bacteria 91128
442 Ga0496122_0004246 3300048925 Bacteria 17974
443 Ga0496122_0097014 3300048925 Bacteria 1985
444 Ga0496123_0000818 3300048926 Bacteria 50079
445 Ga0496123_0001090 3300048926 Bacteria 40789
446 Ga0496123_0021777 3300048926 Bacteria 4968
447 Ga0496123_0035900 3300048926 Bacteria 3525
448 Ga0496124_0027048 3300048927 Bacteria 5159
449 Ga0496124_0187659 3300048927 Bacteria 1585
450 Ga0496125_0000166 3300048928 Bacteria 147432
451 Ga0496125_0004308 3300048928 Bacteria 16520
452 Ga0496125_0011560 3300048928 Bacteria 8817
453 Ga0496125_0021923 3300048928 Bacteria 5942
454 Ga0496126_0028614 3300048929 Bacteria 5307
455 Ga0496126_0034296 3300048929 Bacteria 4767
456 Ga0496126_0156650 3300048929 Bacteria 1949
457 Ga0495678_003455 3300049459 Bacteria 9788
458 Ga0495678_012336 3300049459 Bacteria 4055
459 Ga0495682_0006297 3300049460 Bacteria 4815
460 nmdc:mga00v17_15580_c1 3300050491 Bacteria 4268
461 nmdc:mga0yw44_63741_c1 3300050492 Bacteria 2267
462 nmdc:mga0k408_129637_c1 3300050493 Bacteria 1497
463 nmdc:mga04h51_30882_c1 3300050495 Bacteria 1689
464 nmdc:mga05p37_7547_c1 3300050507 Bacteria 6359
465 nmdc:mga09592_1155_c2 3300050508 Bacteria 17466
466 nmdc:mga06r32_127_c1 3300050510 Bacteria 55298
467 nmdc:mga08y16_245_c1 3300050511 Bacteria 48774
468 Ga0495601_0002629 3300053077 Bacteria 10190
469 Ga0500635_0000041 3300053080 Bacteria 90865
470 Ga0500578_0074417 3300053086 Bacteria 2164
471 Ga0500619_001184 3300053154 Bacteria 4541
472 Ga0500661_017832 3300055283 Bacteria 1267
473 Ga0466962_0011075 3300061719 Bacteria 4342
474 Ga0466962_0065688 3300061719 Bacteria 1732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2970627176 2970632258 265
2 3300005563 Ga0068855_100005737 Ga0068855_1000057375 273
3 3300025949 Ga0207667_10109918 Ga0207667_101099182 273
4 3300026116 Ga0207674_10253645 Ga0207674_102536452 273
5 3300028794 Ga0307515_10003157 Ga0307515_1000315725 273
6 3300037418 Ga0395900_0718573 Ga0395900_0718573_15_854 275
7 iso_pu_bacteria 2878730984 2878735731 276
8 3300046457 Ga0495590_0000023 Ga0495590_0000023_154577_155470 277
9 3300049459 Ga0495678_012336 Ga0495678_012336_2533_3426 277
10 3300046538 Ga0495609_0038983 Ga0495609_0038983_1185_2075 278
11 3300046471 Ga0495650_0001177 Ga0495650_0001177_21614_22507 279
12 3300046475 Ga0495639_0008979 Ga0495639_0008979_189_1082 279
13 3300046506 Ga0495583_0000392 Ga0495583_0000392_45554_46447 279
14 3300046524 Ga0495648_0000008 Ga0495648_0000008_45510_46403 279
15 3300046528 Ga0495642_0000531 Ga0495642_0000531_11241_12134 279
16 3300046557 Ga0495622_0000392 Ga0495622_0000392_21544_22437 279
17 3300046558 Ga0495633_0000339 Ga0495633_0000339_6560_7453 279
18 3300046660 Ga0495625_0000378 Ga0495625_0000378_45482_46375 279
19 3300047443 Ga0495687_009393 Ga0495687_009393_4257_5150 279
20 3300049459 Ga0495678_003455 Ga0495678_003455_2007_2900 279
21 3300046616 Ga0495668_0000347 Ga0495668_0000347_26327_27220 280
22 iso_pu_bacteria 2869242130 2869247842 280
23 3300031730 Ga0307516_10001053 Ga0307516_1000105349 284
24 3300046679 Ga0495623_0255111 Ga0495623_0255111_92_958 285
25 iso_pu_bacteria 8011350971 8011354490 287
26 3300003316 rootH1_10030891 rootH1_100308913 292
27 3300003320 rootH2_10030598 rootH2_1003059818 292
28 3300003323 rootH1_10032240 rootH1_100322401 292
29 3300003752 Ga0055539_1000198 Ga0055539_10001988 292
30 3300003756 Ga0055533_1000008 Ga0055533_100000870 292
31 3300005327 Ga0070658_10072204 Ga0070658_100722043 292
32 3300025226 Ga0209674_100015 Ga0209674_100015594 292
33 3300025230 Ga0209563_100017 Ga0209563_100017691 292
34 3300025253 Ga0209677_100037 Ga0209677_100037191 292
35 3300025909 Ga0207705_10075179 Ga0207705_100751792 292
36 3300035111 Ga0373923_0140796 Ga0373923_0140796_47_925 292
37 3300037466 Ga0395898_0016349 Ga0395898_0016349_4297_5175 292
38 3300038443 Ga0395901_0002128 Ga0395901_0002128_5106_5984 292
39 3300044842 Ga0466957_0201598 Ga0466957_0201598_333_1211 292
40 3300046492 Ga0495585_0120255 Ga0495585_0120255_22_900 292
41 3300046506 Ga0495583_0000324 Ga0495583_0000324_63763_64641 292
42 3300046507 Ga0495606_0000487 Ga0495606_0000487_46699_47577 292
43 3300046660 Ga0495625_0008790 Ga0495625_0008790_4035_4913 292
44 3300046684 Ga0495669_0007115 Ga0495669_0007115_212_1090 292
45 3300046694 Ga0495649_0000207 Ga0495649_0000207_37681_38559 292
46 3300046794 Ga0495589_0027204 Ga0495589_0027204_314_1192 292
47 3300047323 Ga0495683_0043337 Ga0495683_0043337_1110_1988 292
48 3300053080 Ga0500635_0000041 Ga0500635_0000041_45657_46535 292
49 3300053086 Ga0500578_0074417 Ga0500578_0074417_1243_2121 292
50 3300055283 Ga0500661_017832 Ga0500661_017832_74_952 292
51 iso_pu_bacteria 2844009547 2844013018 292
52 3300003322 rootL2_10042288 rootL2_100422883 293
53 3300003323 rootH1_10028363 rootH1_100283632 293
54 3300005564 Ga0070664_100075031 Ga0070664_1000750312 295
55 3300025246 Ga0209646_1000047 Ga0209646_1000047294 295
56 3300026078 Ga0207702_10096385 Ga0207702_100963852 295
57 3300037418 Ga0395900_0016734 Ga0395900_0016734_925_1857 295
58 3300037466 Ga0395898_0060042 Ga0395898_0060042_1778_2710 295
59 3300038443 Ga0395901_0000042 Ga0395901_0000042_56034_56966 295
60 3300046660 Ga0495625_0034659 Ga0495625_0034659_344_1237 295
61 3300046694 Ga0495649_0012344 Ga0495649_0012344_1245_2138 295
62 3300005327 Ga0070658_10151230 Ga0070658_101512301 296
63 3300005339 Ga0070660_100083194 Ga0070660_1000831943 296
64 3300025919 Ga0207657_10013341 Ga0207657_100133414 296
65 3300025932 Ga0207690_10053356 Ga0207690_100533563 296
66 3300037418 Ga0395900_0101733 Ga0395900_0101733_2033_2923 296
67 3300037466 Ga0395898_0260707 Ga0395898_0260707_645_1535 296
68 3300038443 Ga0395901_0165060 Ga0395901_0165060_813_1703 296
69 3300044656 Ga0466969_0039413 Ga0466969_0039413_854_1744 296
70 3300044656 Ga0466969_0094455 Ga0466969_0094455_349_1239 296
71 3300044658 Ga0466972_0003042 Ga0466972_0003042_368_1258 296
72 3300044683 Ga0466965_0005268 Ga0466965_0005268_4359_5249 296
73 3300044684 Ga0466966_0023614 Ga0466966_0023614_2963_3853 296
74 3300044684 Ga0466966_0029122 Ga0466966_0029122_548_1438 296
75 3300044706 Ga0466964_0005364 Ga0466964_0005364_1238_2128 296
76 3300044735 Ga0466968_0010105 Ga0466968_0010105_1861_2751 296
77 3300044765 Ga0466970_0090966 Ga0466970_0090966_210_1100 296
78 3300044842 Ga0466957_0065204 Ga0466957_0065204_1148_2038 296
79 3300046474 Ga0495605_0000051 Ga0495605_0000051_143955_144845 296
80 3300046501 Ga0495607_0002583 Ga0495607_0002583_11490_12380 296
81 3300046522 Ga0495643_0004961 Ga0495643_0004961_323_1213 296
82 3300046522 Ga0495643_0026385 Ga0495643_0026385_325_1215 296
83 3300046528 Ga0495642_0000763 Ga0495642_0000763_8512_9402 296
84 3300046665 Ga0495661_0010374 Ga0495661_0010374_462_1352 296
85 3300046810 Ga0495660_0000100 Ga0495660_0000100_18223_19113 296
86 3300047320 Ga0495672_0007664 Ga0495672_0007664_6442_7332 296
87 3300047323 Ga0495683_0006670 Ga0495683_0006670_4202_5092 296
88 3300047443 Ga0495687_000016 Ga0495687_000016_299223_300113 296
89 3300047445 Ga0495677_0001394 Ga0495677_0001394_2869_3759 296
90 3300048091 Ga0495626_0000904 Ga0495626_0000904_16686_17576 296
91 3300048905 Ga0496102_0123136 Ga0496102_0123136_52_942 296
92 3300048910 Ga0496107_0130345 Ga0496107_0130345_896_1786 296
93 3300048916 Ga0496113_0004513 Ga0496113_0004513_5579_6475 296
94 3300048925 Ga0496122_0004246 Ga0496122_0004246_4551_5447 296
95 3300048926 Ga0496123_0021777 Ga0496123_0021777_3382_4278 296
96 3300048928 Ga0496125_0021923 Ga0496125_0021923_4612_5508 296
97 iso_pu_bacteria 2643221569 2643861371 296
98 iso_pu_bacteria 2643221621 2644123774 296
99 iso_pu_bacteria 2941479691 2941482845 296
100 3300006051 Ga0075364_10001095 Ga0075364_100010952 297
101 3300006195 Ga0075366_10133780 Ga0075366_101337802 297
102 3300026116 Ga0207674_10107740 Ga0207674_101077403 297
103 3300050491 nmdc:mga00v17_15580_c1 nmdc:mga00v17_15580_c1_3001_3894 297
104 3300050493 nmdc:mga0k408_129637_c1 nmdc:mga0k408_129637_c1_250_1143 297
105 iso_pu_bacteria 2924733363 2924740216 297
106 iso_pu_bacteria 3004268573 3004272765 297
107 3300025263 Ga0209565_1014423 Ga0209565_10144232 298
108 3300025299 Ga0209256_1000005 Ga0209256_10000051049 298
109 3300037312 Ga0395899_0333710 Ga0395899_0333710_66_968 298
110 3300037312 Ga0395899_0004996 Ga0395899_0004996_3978_4877 299
111 3300037418 Ga0395900_0005273 Ga0395900_0005273_7222_8121 299
112 3300037466 Ga0395898_0005843 Ga0395898_0005843_6836_7735 299
113 3300037471 Ga0395905_0072696 Ga0395905_0072696_1112_2011 299
114 3300038443 Ga0395901_0112476 Ga0395901_0112476_730_1629 299
115 3300042157 Ga0439458_0005441 Ga0439458_0005441_668_1567 299
116 3300044672 Ga0466982_0047420 Ga0466982_0047420_993_1904 300
117 3300044765 Ga0466970_0005485 Ga0466970_0005485_597_1508 300
118 3300046458 Ga0495591_000917 Ga0495591_000917_1569_2474 300
119 3300046459 Ga0495629_0018875 Ga0495629_0018875_1214_2119 300
120 3300046462 Ga0495651_0042612 Ga0495651_0042612_1053_1958 300
121 3300046472 Ga0495580_0014036 Ga0495580_0014036_958_1863 300
122 3300046473 Ga0495582_0020352 Ga0495582_0020352_1642_2547 300
123 3300046476 Ga0495662_0010781 Ga0495662_0010781_1178_2083 300
124 3300046477 Ga0495664_0010535 Ga0495664_0010535_1581_2486 300
125 3300046511 Ga0495608_0004371 Ga0495608_0004371_3223_4128 300
126 3300046514 Ga0495618_0041326 Ga0495618_0041326_1821_2726 300
127 3300046516 Ga0495628_0078445 Ga0495628_0078445_885_1790 300
128 3300046517 Ga0495630_0013041 Ga0495630_0013041_3456_4361 300
129 3300046524 Ga0495648_0022159 Ga0495648_0022159_1924_2829 300
130 3300046526 Ga0495666_0000580 Ga0495666_0000580_4695_5600 300
131 3300046531 Ga0495665_0000462 Ga0495665_0000462_16083_16988 300
132 3300046533 Ga0495640_0002036 Ga0495640_0002036_12247_13152 300
133 3300046536 Ga0495587_0030200 Ga0495587_0030200_335_1240 300
134 3300046543 Ga0495645_0133893 Ga0495645_0133893_359_1264 300
135 3300046663 Ga0495635_0059351 Ga0495635_0059351_1213_2118 300
136 3300046665 Ga0495661_0021239 Ga0495661_0021239_336_1241 300
137 3300046678 Ga0495599_0064172 Ga0495599_0064172_177_1082 300
138 3300046679 Ga0495623_0013868 Ga0495623_0013868_785_1690 300
139 3300046680 Ga0495646_0005970 Ga0495646_0005970_6034_6939 300
140 3300046689 Ga0495613_0006773 Ga0495613_0006773_1549_2454 300
141 3300046690 Ga0495624_0064794 Ga0495624_0064794_779_1684 300
142 3300046794 Ga0495589_0016036 Ga0495589_0016036_1120_2025 300
143 3300046809 Ga0495600_0004081 Ga0495600_0004081_3191_4096 300
144 3300047321 Ga0495676_0018306 Ga0495676_0018306_2861_3766 300
145 3300047322 Ga0495680_0037551 Ga0495680_0037551_1686_2591 300
146 3300047323 Ga0495683_0013982 Ga0495683_0013982_2493_3398 300
147 3300047444 Ga0495675_0003886 Ga0495675_0003886_6742_7647 300
148 3300047446 Ga0495679_010441 Ga0495679_010441_600_1505 300
149 3300047469 Ga0495673_0010113 Ga0495673_0010113_1014_1919 300
150 3300047673 Ga0495593_0002320 Ga0495593_0002320_1257_2162 300
151 3300048088 Ga0495602_0093150 Ga0495602_0093150_600_1505 300
152 3300048089 Ga0495614_0009407 Ga0495614_0009407_2037_2942 300
153 3300048920 Ga0496117_0107808 Ga0496117_0107808_183_1085 300
154 3300048923 Ga0496120_0011401 Ga0496120_0011401_95_997 300
155 3300048924 Ga0496121_0002018 Ga0496121_0002018_15929_16831 300
156 3300048925 Ga0496122_0097014 Ga0496122_0097014_970_1872 300
157 3300048926 Ga0496123_0035900 Ga0496123_0035900_1578_2480 300
158 3300048927 Ga0496124_0027048 Ga0496124_0027048_2436_3338 300
159 3300048928 Ga0496125_0000166 Ga0496125_0000166_106468_107370 300
160 3300048929 Ga0496126_0034296 Ga0496126_0034296_3813_4715 300
161 3300049460 Ga0495682_0006297 Ga0495682_0006297_3071_3976 300
162 iso_pu_bacteria 2509276022 2509395252 300
163 iso_pu_bacteria 8056207758 8056215137 300
164 3300002067 JGI24735J21928_10013646 JGI24735J21928_100136462 301
165 3300003320 rootH2_10239084 rootH2_102390842 301
166 3300005327 Ga0070658_10046038 Ga0070658_100460383 301
167 3300005339 Ga0070660_100024983 Ga0070660_1000249834 301
168 3300005344 Ga0070661_100045895 Ga0070661_1000458952 301
169 3300005563 Ga0068855_100119372 Ga0068855_1001193723 301
170 3300009093 Ga0105240_10121568 Ga0105240_101215681 301
171 3300009545 Ga0105237_10049411 Ga0105237_100494112 301
172 3300013100 Ga0157373_10042119 Ga0157373_100421191 301
173 3300013104 Ga0157370_10051986 Ga0157370_100519861 301
174 3300013105 Ga0157369_10088329 Ga0157369_100883293 301
175 3300013296 Ga0157374_10009198 Ga0157374_100091984 301
176 3300013307 Ga0157372_10061334 Ga0157372_100613343 301
177 3300025256 Ga0209759_1003078 Ga0209759_10030785 301
178 3300025909 Ga0207705_10043120 Ga0207705_100431203 301
179 3300025913 Ga0207695_10053264 Ga0207695_100532643 301
180 3300025914 Ga0207671_10134355 Ga0207671_101343552 301
181 3300025949 Ga0207667_10089941 Ga0207667_100899413 301
182 3300037312 Ga0395899_0044015 Ga0395899_0044015_298_1215 301
183 3300037418 Ga0395900_0076063 Ga0395900_0076063_928_1905 301
184 3300042005 Ga0439448_0001372 Ga0439448_0001372_3025_3987 301
185 3300044658 Ga0466972_0006924 Ga0466972_0006924_513_1424 301
186 3300048919 Ga0496116_0001705 Ga0496116_0001705_18120_19034 301
187 3300048919 Ga0496116_0041591 Ga0496116_0041591_2043_2957 301
188 3300048924 Ga0496121_0196525 Ga0496121_0196525_443_1357 301
189 3300048925 Ga0496122_0000410 Ga0496122_0000410_68605_69519 301
190 3300048926 Ga0496123_0000818 Ga0496123_0000818_30539_31453 301
191 iso_pu_bacteria 2834641062 2834645855 301
192 iso_pu_bacteria 8003400568 8003405127 301
193 3300005340 Ga0070689_100003694 Ga0070689_10000369412 302
194 3300005344 Ga0070661_100116323 Ga0070661_1001163232 302
195 3300005843 Ga0068860_100033574 Ga0068860_1000335742 302
196 3300005844 Ga0068862_100119895 Ga0068862_1001198953 302
197 3300013306 Ga0163162_10117995 Ga0163162_101179953 302
198 3300025936 Ga0207670_10002104 Ga0207670_1000210412 302
199 3300028381 Ga0268264_10034678 Ga0268264_100346786 302
200 3300045836 Ga0466958_0001037 Ga0466958_0001037_3706_4650 302
201 3300046460 Ga0495638_0003661 Ga0495638_0003661_1291_2199 302
202 3300046471 Ga0495650_0000112 Ga0495650_0000112_85158_86066 302
203 3300048907 Ga0496104_0415251 Ga0496104_0415251_327_1235 302
204 3300048917 Ga0496114_0054716 Ga0496114_0054716_644_1627 302
205 3300048918 Ga0496115_0031719 Ga0496115_0031719_1277_2185 302
206 3300048929 Ga0496126_0028614 Ga0496126_0028614_364_1347 302
207 iso_pu_bacteria 2554235132 2554812851 302
208 iso_pu_bacteria 2588253730 2588518218 302
209 iso_pu_bacteria 2606217733 2608383315 302
210 iso_pu_bacteria 2903448605 2903450582 302
211 iso_pu_bacteria 2968083720 2968088159 302
212 iso_pu_bacteria 637000159 637075264 302
213 3300005365 Ga0070688_100204254 Ga0070688_1002042541 303
214 3300038443 Ga0395901_0000004 Ga0395901_0000004_30032_30970 303
215 3300044658 Ga0466972_0016184 Ga0466972_0016184_2736_3668 303
216 iso_pu_bacteria 2508501123 2509117951 303
217 iso_pu_bacteria 2512875016 2512932168 303
218 iso_pu_bacteria 2858950400 2858953919 303
219 iso_pu_bacteria 2869278585 2869283720 303
220 iso_pu_bacteria 2874139085 2874140177 303
221 iso_pu_bacteria 2876363079 2876367803 303
222 iso_pu_bacteria 2878738818 2878738850 303
223 iso_pu_bacteria 2903521522 2903521679 303
224 iso_pu_bacteria 2903528002 2903528057 303
225 iso_pu_bacteria 2924776078 2924776212 303
226 iso_pu_bacteria 2937848649 2937849948 303
227 iso_pu_bacteria 2937877337 2937884329 303
228 iso_pu_bacteria 2958034702 2958040232 303
229 iso_pu_bacteria 2958041894 2958054576 303
230 iso_pu_bacteria 2958084443 2958091640 303
231 iso_pu_bacteria 2958092219 2958094173 303
232 iso_pu_bacteria 2958144490 2958148212 303
233 iso_pu_bacteria 2963644680 2963647039 303
234 iso_pu_bacteria 2968016561 2968019074 303
235 iso_pu_bacteria 2970469710 2970470753 303
236 iso_pu_bacteria 2970593180 2970597855 303
237 iso_pu_bacteria 2977922695 2977928566 303
238 iso_pu_bacteria 2977986579 2977992786 303
239 iso_pu_bacteria 2995948881 2995953439 303
240 iso_pu_bacteria 2996348954 2996356710 303
241 iso_pu_bacteria 3004211236 3004215431 303
242 iso_pu_bacteria 3004218560 3004225726 303
243 iso_pu_bacteria 3004275668 3004283013 303
244 3300002705 JGI25156J39149_1000084 JGI25156J39149_100008453 304
245 3300002741 JGI25157J39369_1000039 JGI25157J39369_100003949 304
246 3300003752 Ga0055539_1000157 Ga0055539_100015758 304
247 3300003752 Ga0055539_1000503 Ga0055539_10005035 304
248 3300003756 Ga0055533_1000024 Ga0055533_1000024315 304
249 3300003759 Ga0055525_1000667 Ga0055525_10006679 304
250 3300005329 Ga0070683_100018697 Ga0070683_1000186977 304
251 3300005563 Ga0068855_100007133 Ga0068855_1000071336 304
252 3300005577 Ga0068857_100001477 Ga0068857_1000014777 304
253 3300005578 Ga0068854_100008593 Ga0068854_1000085932 304
254 3300005614 Ga0068856_100002946 Ga0068856_1000029464 304
255 3300005614 Ga0068856_100062966 Ga0068856_1000629663 304
256 3300005616 Ga0068852_100000153 Ga0068852_10000015323 304
257 3300009174 Ga0105241_10026029 Ga0105241_100260292 304
258 3300009545 Ga0105237_10006506 Ga0105237_1000650611 304
259 3300009551 Ga0105238_10001405 Ga0105238_100014053 304
260 3300010375 Ga0105239_10008447 Ga0105239_100084472 304
261 3300013105 Ga0157369_10027874 Ga0157369_100278743 304
262 3300025226 Ga0209674_100007 Ga0209674_100007355 304
263 3300025230 Ga0209563_100052 Ga0209563_100052256 304
264 3300025242 Ga0209258_100554 Ga0209258_10055427 304
265 3300025246 Ga0209646_1000053 Ga0209646_100005366 304
266 3300025250 Ga0209026_1000020 Ga0209026_1000020253 304
267 3300025253 Ga0209677_100015 Ga0209677_100015435 304
268 3300025253 Ga0209677_100114 Ga0209677_10011414 304
269 3300025256 Ga0209759_1000017 Ga0209759_100001766 304
270 3300025911 Ga0207654_10025451 Ga0207654_100254512 304
271 3300025914 Ga0207671_10042960 Ga0207671_100429602 304
272 3300025924 Ga0207694_10004848 Ga0207694_100048483 304
273 3300025949 Ga0207667_10142016 Ga0207667_101420162 304
274 3300026041 Ga0207639_10105736 Ga0207639_101057362 304
275 3300026078 Ga0207702_10006990 Ga0207702_100069905 304
276 3300026078 Ga0207702_10110408 Ga0207702_101104082 304
277 3300026116 Ga0207674_10000455 Ga0207674_1000045543 304
278 3300026142 Ga0207698_10099664 Ga0207698_100996642 304
279 3300037471 Ga0395905_0286790 Ga0395905_0286790_385_1302 304
280 3300044683 Ga0466965_0028986 Ga0466965_0028986_1110_2027 304
281 3300044765 Ga0466970_0048343 Ga0466970_0048343_679_1596 304
282 iso_pu_bacteria 2856320880 2856326727 304
283 iso_pu_bacteria 2870782633 2870786460 304
284 iso_pu_bacteria 2924718760 2924722403 304
285 iso_pu_bacteria 2937972304 2937979568 304
286 3300048920 Ga0496117_0010670 Ga0496117_0010670_6106_7035 305
287 3300048921 Ga0496118_0004821 Ga0496118_0004821_9137_10066 305
288 3300048928 Ga0496125_0011560 Ga0496125_0011560_4028_4957 305
289 3300003762 Ga0055542_1000675 Ga0055542_100067513 306
290 3300003763 Ga0055529_1002284 Ga0055529_10022844 306
291 3300005327 Ga0070658_10395999 Ga0070658_103959991 306
292 3300005339 Ga0070660_100276729 Ga0070660_1002767291 306
293 3300005457 Ga0070662_100133250 Ga0070662_1001332502 306
294 3300005548 Ga0070665_100561696 Ga0070665_1005616961 306
295 3300006038 Ga0075365_10072107 Ga0075365_100721073 306
296 3300006048 Ga0075363_100038285 Ga0075363_1000382852 306
297 3300006178 Ga0075367_10065380 Ga0075367_100653801 306
298 3300006844 Ga0075428_100001742 Ga0075428_10000174219 306
299 3300006847 Ga0075431_100000070 Ga0075431_10000007045 306
300 3300006880 Ga0075429_100001242 Ga0075429_1000012429 306
301 3300009094 Ga0111539_10000519 Ga0111539_100005199 306
302 3300009147 Ga0114129_10129026 Ga0114129_101290263 306
303 3300010375 Ga0105239_10126176 Ga0105239_101261763 306
304 3300025254 Ga0209148_1000124 Ga0209148_100012414 306
305 3300025272 Ga0209455_1000062 Ga0209455_1000062237 306
306 3300025904 Ga0207647_10154768 Ga0207647_101547682 306
307 3300025913 Ga0207695_10091758 Ga0207695_100917582 306
308 3300025933 Ga0207706_10000266 Ga0207706_1000026635 306
309 3300026041 Ga0207639_10056801 Ga0207639_100568014 306
310 3300027866 Ga0209813_10009733 Ga0209813_100097332 306
311 3300032004 Ga0307414_10012648 Ga0307414_100126485 306
312 3300048929 Ga0496126_0156650 Ga0496126_0156650_925_1848 306
313 3300050492 nmdc:mga0yw44_63741_c1 nmdc:mga0yw44_63741_c1_268_1191 306
314 3300050495 nmdc:mga04h51_30882_c1 nmdc:mga04h51_30882_c1_35_958 306
315 3300050507 nmdc:mga05p37_7547_c1 nmdc:mga05p37_7547_c1_1661_2581 306
316 3300050508 nmdc:mga09592_1155_c2 nmdc:mga09592_1155_c2_10010_10930 306
317 3300050510 nmdc:mga06r32_127_c1 nmdc:mga06r32_127_c1_5069_5989 306
318 3300050511 nmdc:mga08y16_245_c1 nmdc:mga08y16_245_c1_4173_5093 306
319 iso_pu_bacteria 2510065059 2510314008 306
320 iso_pu_bacteria 2512875024 2512960171 306
321 iso_pu_bacteria 2513237164 2514034745 306
322 iso_pu_bacteria 2857537821 2857541737 306
323 iso_pu_bacteria 2869169390 2869174548 306
324 iso_pu_bacteria 2869234852 2869236854 306
325 iso_pu_bacteria 2869256925 2869261645 306
326 iso_pu_bacteria 2871435913 2871440873 306
327 iso_pu_bacteria 2871451962 2871459541 306
328 iso_pu_bacteria 2871481445 2871484564 306
329 iso_pu_bacteria 2874109183 2874111662 306
330 iso_pu_bacteria 2874116593 2874120252 306
331 iso_pu_bacteria 2876386047 2876388662 306
332 iso_pu_bacteria 2876420981 2876424077 306
333 iso_pu_bacteria 2903513507 2903520436 306
334 iso_pu_bacteria 2906401398 2906403540 306
335 iso_pu_bacteria 2924741084 2924741154 306
336 iso_pu_bacteria 2937861824 2937864484 306
337 iso_pu_bacteria 2937980651 2937981455 306
338 iso_pu_bacteria 2958108152 2958113053 306
339 iso_pu_bacteria 2961183825 2961186632 306
340 iso_pu_bacteria 2968138860 2968142508 306
341 iso_pu_bacteria 2970489779 2970493429 306
342 iso_pu_bacteria 2970510686 2970511177 306
343 iso_pu_bacteria 2970532167 2970539928 306
344 iso_pu_bacteria 2970619444 2970622051 306
345 iso_pu_bacteria 2977851361 2977853921 306
346 iso_pu_bacteria 2977907340 2977912049 306
347 iso_pu_bacteria 2979764755 2979769909 306
348 iso_pu_bacteria 2979772303 2979777852 306
349 iso_pu_bacteria 2996386984 2996388519 306
350 iso_pu_bacteria 3004232784 3004238543 306
351 iso_pu_bacteria 8004312739 8004320874 306
352 iso_pu_bacteria 8004727605 8004728695 306
353 3300009093 Ga0105240_10069007 Ga0105240_100690072 307
354 3300009545 Ga0105237_10107108 Ga0105237_101071084 307
355 3300009551 Ga0105238_10740891 Ga0105238_107408911 307
356 3300010375 Ga0105239_10040094 Ga0105239_100400945 307
357 3300010375 Ga0105239_10252304 Ga0105239_102523042 307
358 3300013104 Ga0157370_10012455 Ga0157370_100124556 307
359 3300013105 Ga0157369_10000145 Ga0157369_1000014582 307
360 3300020081 Ga0206354_10130670 Ga0206354_101306702 307
361 3300020082 Ga0206353_10590062 Ga0206353_105900622 307
362 3300025913 Ga0207695_10343515 Ga0207695_103435152 307
363 3300025914 Ga0207671_10109701 Ga0207671_101097013 307
364 3300025924 Ga0207694_10327244 Ga0207694_103272442 307
365 3300026067 Ga0207678_10059893 Ga0207678_100598934 307
366 3300048915 Ga0496112_0307192 Ga0496112_0307192_56_982 307
367 iso_pu_bacteria 2818991436 2819541723 307
368 3300005435 Ga0070714_100022585 Ga0070714_1000225852 309
369 3300005436 Ga0070713_100023602 Ga0070713_1000236024 309
370 3300005616 Ga0068852_100283356 Ga0068852_1002833562 309
371 3300013102 Ga0157371_10010220 Ga0157371_100102201 309
372 3300013105 Ga0157369_10000293 Ga0157369_1000029351 309
373 3300014497 Ga0182008_10009969 Ga0182008_100099694 309
374 3300025250 Ga0209026_1000093 Ga0209026_100009396 309
375 3300025256 Ga0209759_1007983 Ga0209759_10079833 309
376 3300025294 Ga0209025_1000183 Ga0209025_100018379 309
377 3300025928 Ga0207700_10016769 Ga0207700_100167693 309
378 3300025929 Ga0207664_10017681 Ga0207664_100176815 309
379 3300037418 Ga0395900_0000053 Ga0395900_0000053_105416_106357 309
380 3300037466 Ga0395898_0000421 Ga0395898_0000421_77276_78217 309
381 3300038443 Ga0395901_0156033 Ga0395901_0156033_492_1433 309
382 3300044693 Ga0466961_0017881 Ga0466961_0017881_2164_3105 309
383 3300044719 Ga0466971_0001355 Ga0466971_0001355_5803_6744 309
384 3300044842 Ga0466957_0029042 Ga0466957_0029042_2146_3087 309
385 3300045836 Ga0466958_0050140 Ga0466958_0050140_60_1001 309
386 3300061719 Ga0466962_0011075 Ga0466962_0011075_3208_4149 309
387 iso_pu_bacteria 2509276018 2509371553 309
388 iso_pu_bacteria 2643221573 2643881311 309
389 iso_pu_bacteria 2643221720 2644662084 309
390 iso_pu_bacteria 2643221728 2644700222 309
391 iso_pu_bacteria 2687453392 2688597627 309
392 iso_pu_bacteria 2856328259 2856333524 309
393 iso_pu_bacteria 2856334872 2856337930 309
394 iso_pu_bacteria 2857367948 2857368943 309
395 iso_pu_bacteria 2869249662 2869253556 309
396 iso_pu_bacteria 2869264136 2869265723 309
397 iso_pu_bacteria 2869271264 2869277951 309
398 iso_pu_bacteria 2871459585 2871461725 309
399 iso_pu_bacteria 2874131515 2874133042 309
400 iso_pu_bacteria 2874162495 2874165350 309
401 iso_pu_bacteria 2876399893 2876402886 309
402 iso_pu_bacteria 2876406927 2876413747 309
403 iso_pu_bacteria 2878774303 2878776210 309
404 iso_pu_bacteria 2878781027 2878786692 309
405 iso_pu_bacteria 2906363423 2906367682 309
406 iso_pu_bacteria 2906370794 2906371488 309
407 iso_pu_bacteria 2906386501 2906388597 309
408 iso_pu_bacteria 2906393657 2906400564 309
409 iso_pu_bacteria 2906408224 2906412507 309
410 iso_pu_bacteria 2922151315 2922156308 309
411 iso_pu_bacteria 2922172374 2922175867 309
412 iso_pu_bacteria 2922178524 2922180194 309
413 iso_pu_bacteria 2924748358 2924752675 309
414 iso_pu_bacteria 2937868953 2937876102 309
415 iso_pu_bacteria 2941489479 2941494500 309
416 iso_pu_bacteria 2958137437 2958138667 309
417 iso_pu_bacteria 2958158011 2958163659 309
418 iso_pu_bacteria 2965025482 2965025817 309
419 iso_pu_bacteria 2965032056 2965038985 309
420 iso_pu_bacteria 2965040258 2965042692 309
421 iso_pu_bacteria 2965089291 2965096484 309
422 iso_pu_bacteria 2965110997 2965116240 309
423 iso_pu_bacteria 2970547951 2970551510 309
424 iso_pu_bacteria 2977872689 2977874273 309
425 iso_pu_bacteria 2977915119 2977919860 309
426 iso_pu_bacteria 2977935797 2977939056 309
427 iso_pu_bacteria 2977950692 2977953496 309
428 iso_pu_bacteria 2977957713 2977959340 309
429 iso_pu_bacteria 2979793036 2979793327 309
430 iso_pu_bacteria 2987645492 2987646410 309
431 iso_pu_bacteria 2987673487 2987674335 309
432 iso_pu_bacteria 3004167301 3004168062 309
433 iso_pu_bacteria 3004195979 3004198433 309
434 iso_pu_bacteria 3004239961 3004243013 309
435 iso_pu_bacteria 3004289098 3004296248 309
436 iso_pu_bacteria 649633066 649872171 309
437 iso_pu_bacteria 8004300914 8004306557 309
438 iso_pu_bacteria 8004361976 8004366382 309
439 iso_pu_bacteria 8004695233 8004695256 309
440 3300003760 Ga0055527_1003790 Ga0055527_10037902 310
441 3300025228 Ga0209672_100503 Ga0209672_10050313 310
442 3300037466 Ga0395898_0008181 Ga0395898_0008181_3299_4267 310
443 3300044658 Ga0466972_0006643 Ga0466972_0006643_2765_3697 310
444 3300002737 JGI25162J39368_1000021 JGI25162J39368_1000021121 311
445 3300003214 JGI25165J46597_1000049 JGI25165J46597_1000049103 311
446 3300003751 Ga0055538_1000023 Ga0055538_1000023121 311
447 3300003752 Ga0055539_1000030 Ga0055539_1000030121 311
448 3300003756 Ga0055533_1000039 Ga0055533_1000039121 311
449 3300003759 Ga0055525_1000048 Ga0055525_1000048103 311
450 3300003841 Ga0055541_1000021 Ga0055541_1000021103 311
451 3300014497 Ga0182008_10089399 Ga0182008_100893991 311
452 3300015262 Ga0182007_10002522 Ga0182007_100025224 311
453 3300015265 Ga0182005_1000238 Ga0182005_100023815 311
454 3300025224 Ga0209784_100004 Ga0209784_1000041162 311
455 3300025225 Ga0209566_100004 Ga0209566_1000041319 311
456 3300025226 Ga0209674_100006 Ga0209674_1000061319 311
457 3300025230 Ga0209563_100009 Ga0209563_1000091162 311
458 3300025231 Ga0207427_100353 Ga0207427_10035312 311
459 3300025233 Ga0209437_100004 Ga0209437_1000041162 311
460 3300025253 Ga0209677_100005 Ga0209677_1000051162 311
461 3300025261 Ga0209233_1000005 Ga0209233_10000051319 311
462 3300031911 Ga0307412_10000169 Ga0307412_1000016926 311
463 3300046463 Ga0495653_0026058 Ga0495653_0026058_3112_4083 311
464 3300046511 Ga0495608_0026255 Ga0495608_0026255_1679_2650 311
465 3300046514 Ga0495618_0018820 Ga0495618_0018820_1240_2211 311
466 3300046516 Ga0495628_0011279 Ga0495628_0011279_476_1447 311
467 3300046522 Ga0495643_0000049 Ga0495643_0000049_41312_42250 311
468 3300046557 Ga0495622_0018881 Ga0495622_0018881_1330_2301 311
469 3300046663 Ga0495635_0114164 Ga0495635_0114164_761_1732 311
470 3300046678 Ga0495599_0001463 Ga0495599_0001463_11517_12488 311
471 3300047317 Ga0495604_0058913 Ga0495604_0058913_1127_2071 311
472 3300048088 Ga0495602_0191744 Ga0495602_0191744_111_1082 311
473 3300053077 Ga0495601_0002629 Ga0495601_0002629_6967_7938 311
474 3300053154 Ga0500619_001184 Ga0500619_001184_29_1000 311
475 iso_pu_bacteria 2547132111 2547405778 311
476 iso_pu_bacteria 2643221559 2643817025 311
477 iso_pu_bacteria 2643221586 2643939447 311
478 iso_pu_bacteria 2643221593 2643976962 311
479 iso_pu_bacteria 2643221612 2644078126 311
480 iso_pu_bacteria 2643221727 2644696429 311
481 iso_pu_bacteria 2873151551 2873151807 311
482 3300046491 Ga0495584_0002626 Ga0495584_0002626_7222_8166 312
483 3300046507 Ga0495606_0003419 Ga0495606_0003419_9480_10424 312
484 3300047443 Ga0495687_001387 Ga0495687_001387_9239_10183 312
485 3300048926 Ga0496123_0001090 Ga0496123_0001090_28939_29883 312
486 iso_pu_bacteria 2596583598 2597031514 312
487 iso_pu_bacteria 2599185178 2599445146 312
488 iso_pu_bacteria 2928058823 2928060317 312
489 iso_pu_bacteria 2929160207 2929162637 312
490 3300003323 rootH1_10212107 rootH1_102121071 313
491 3300003771 Ga0055526_1000003 Ga0055526_10000037 313
492 3300003771 Ga0055526_1003210 Ga0055526_10032106 313
493 3300003773 Ga0055537_1000002 Ga0055537_1000002212 313
494 3300003775 Ga0055524_1000002 Ga0055524_1000002365 313
495 3300003784 Ga0055534_1000005 Ga0055534_10000056 313
496 3300003790 Ga0055528_1000155 Ga0055528_100015510 313
497 3300005366 Ga0070659_100001341 Ga0070659_1000013417 313
498 3300014497 Ga0182008_10007403 Ga0182008_100074034 313
499 3300015261 Ga0182006_1014032 Ga0182006_10140322 313
500 3300015689 Ga0183360_10003 Ga0183360_10003229 313
501 3300025263 Ga0209565_1000002 Ga0209565_1000002224 313
502 3300025263 Ga0209565_1004458 Ga0209565_10044584 313
503 3300025273 Ga0209673_1000002 Ga0209673_1000002224 313
504 3300025291 Ga0209675_1000002 Ga0209675_1000002224 313
505 3300025295 Ga0209564_1000004 Ga0209564_1000004225 313
506 3300025299 Ga0209256_1000004 Ga0209256_1000004225 313
507 3300025932 Ga0207690_10001049 Ga0207690_1000104911 313
508 3300028379 Ga0268266_10069984 Ga0268266_100699843 313
509 3300048924 Ga0496121_0000724 Ga0496121_0000724_8099_9043 313
510 3300048927 Ga0496124_0187659 Ga0496124_0187659_580_1539 313
511 iso_pu_bacteria 2599185214 2599622304 313
512 iso_pu_bacteria 2599185226 2599674604 313
513 iso_pu_bacteria 2599185227 2599680289 313
514 iso_pu_bacteria 2599185229 2599692305 313
515 iso_pu_bacteria 2928070936 2928074203 313
516 3300014497 Ga0182008_10043621 Ga0182008_100436212 314
517 3300015262 Ga0182007_10052509 Ga0182007_100525091 314
518 3300015262 Ga0182007_10086970 Ga0182007_100869701 314
519 3300044656 Ga0466969_0029828 Ga0466969_0029828_1478_2422 314
520 3300044658 Ga0466972_0001119 Ga0466972_0001119_7369_8313 314
521 3300044671 Ga0466978_0133709 Ga0466978_0133709_60_1004 314
522 3300044672 Ga0466982_0148185 Ga0466982_0148185_247_1191 314
523 3300044683 Ga0466965_0015677 Ga0466965_0015677_1768_2712 314
524 3300044683 Ga0466965_0085540 Ga0466965_0085540_382_1332 314
525 3300044684 Ga0466966_0107725 Ga0466966_0107725_64_1014 314
526 3300044693 Ga0466961_0000165 Ga0466961_0000165_9983_10927 314
527 3300044693 Ga0466961_0033111 Ga0466961_0033111_581_1531 314
528 3300044694 Ga0466963_0026672 Ga0466963_0026672_1150_2094 314
529 3300044706 Ga0466964_0021630 Ga0466964_0021630_500_1444 314
530 3300044719 Ga0466971_0026708 Ga0466971_0026708_1323_2267 314
531 3300044735 Ga0466968_0010159 Ga0466968_0010159_617_1561 314
532 3300044765 Ga0466970_0000123 Ga0466970_0000123_33792_34736 314
533 3300044842 Ga0466957_0040461 Ga0466957_0040461_1524_2468 314
534 3300045049 Ga0466959_0000186 Ga0466959_0000186_34758_35702 314
535 3300045976 Ga0466967_0091380 Ga0466967_0091380_1062_2006 314
536 3300046616 Ga0495668_0003749 Ga0495668_0003749_2684_3640 314
537 3300061719 Ga0466962_0065688 Ga0466962_0065688_647_1591 314
538 3300003187 JGI25151J46595_10000325 JGI25151J46595_1000032527 315
539 3300025245 Ga0207425_1002492 Ga0207425_10024925 315
540 3300025294 Ga0209025_1000005 Ga0209025_1000005908 315
541 3300025297 Ga0209758_1003219 Ga0209758_10032195 315
542 3300031901 Ga0307406_10000332 Ga0307406_100003324 315
543 3300001979 JGI24740J21852_10000103 JGI24740J21852_1000010319 316
544 3300001979 JGI24740J21852_10002230 JGI24740J21852_100022309 316
545 3300002705 JGI25156J39149_1006519 JGI25156J39149_10065193 316
546 3300002773 JGI25152J39213_1000906 JGI25152J39213_100090611 316
547 3300002774 JGI25150J39212_1000577 JGI25150J39212_100057712 316
548 3300002987 JGI25159J45721_1000817 JGI25159J45721_10008172 316
549 3300003187 JGI25151J46595_10001674 JGI25151J46595_1000167411 316
550 3300003215 JGI25153J46596_10001381 JGI25153J46596_1000138111 316
551 3300003320 rootH2_10054119 rootH2_100541191 316
552 3300003354 JGI25160J50197_1003834 JGI25160J50197_10038347 316
553 3300003374 JGI25161J50226_1001843 JGI25161J50226_10018433 316
554 3300003752 Ga0055539_1000086 Ga0055539_100008655 316
555 3300003756 Ga0055533_1001665 Ga0055533_10016656 316
556 3300003756 Ga0055533_1003765 Ga0055533_10037652 316
557 3300003758 Ga0055532_1000041 Ga0055532_1000041125 316
558 3300003759 Ga0055525_1000292 Ga0055525_100029232 316
559 3300003760 Ga0055527_1004922 Ga0055527_10049222 316
560 3300003761 Ga0055535_1000030 Ga0055535_100003052 316
561 3300003763 Ga0055529_1000058 Ga0055529_1000058125 316
562 3300003771 Ga0055526_1001904 Ga0055526_100190411 316
563 3300003773 Ga0055537_1001929 Ga0055537_10019298 316
564 3300003775 Ga0055524_1001315 Ga0055524_100131511 316
565 3300003781 Ga0055536_1018549 Ga0055536_10185492 316
566 3300003784 Ga0055534_1002066 Ga0055534_10020668 316
567 3300003790 Ga0055528_1003814 Ga0055528_10038148 316
568 3300003792 Ga0055540_1010228 Ga0055540_10102283 316
569 3300003794 Ga0055531_10029104 Ga0055531_100291041 316
570 3300003841 Ga0055541_1002711 Ga0055541_10027115 316
571 3300004625 Ga0055543_1000864 Ga0055543_10008643 316
572 3300005262 Ga0065165_1002639 Ga0065165_10026393 316
573 3300005344 Ga0070661_100000240 Ga0070661_10000024031 316
574 3300005455 Ga0070663_100000015 Ga0070663_10000001519 316
575 3300005564 Ga0070664_100000068 Ga0070664_10000006840 316
576 3300005577 Ga0068857_100026702 Ga0068857_1000267022 316
577 3300005578 Ga0068854_100000864 Ga0068854_1000008649 316
578 3300005614 Ga0068856_100000488 Ga0068856_10000048820 316
579 3300009093 Ga0105240_10002925 Ga0105240_100029258 316
580 3300009093 Ga0105240_10019438 Ga0105240_100194386 316
581 3300013100 Ga0157373_10004363 Ga0157373_100043638 316
582 3300013102 Ga0157371_10000100 Ga0157371_10000100102 316
583 3300013104 Ga0157370_10000004 Ga0157370_10000004102 316
584 3300013105 Ga0157369_10001605 Ga0157369_1000160527 316
585 3300013307 Ga0157372_10000396 Ga0157372_1000039618 316
586 3300015261 Ga0182006_1000924 Ga0182006_100092416 316
587 3300020610 Ga0154015_1060319 Ga0154015_10603194 316
588 3300025208 Ga0209436_102530 Ga0209436_1025306 316
589 3300025224 Ga0209784_100029 Ga0209784_100029236 316
590 3300025224 Ga0209784_101418 Ga0209784_1014183 316
591 3300025225 Ga0209566_100030 Ga0209566_100030102 316
592 3300025225 Ga0209566_100834 Ga0209566_10083413 316
593 3300025226 Ga0209674_100123 Ga0209674_10012317 316
594 3300025226 Ga0209674_103321 Ga0209674_1033212 316
595 3300025228 Ga0209672_100165 Ga0209672_10016530 316
596 3300025228 Ga0209672_100264 Ga0209672_10026417 316
597 3300025229 Ga0209147_100008 Ga0209147_100008597 316
598 3300025230 Ga0209563_100091 Ga0209563_10009168 316
599 3300025230 Ga0209563_100092 Ga0209563_10009283 316
600 3300025242 Ga0209258_100013 Ga0209258_100013597 316
601 3300025245 Ga0207425_1000887 Ga0207425_100088711 316
602 3300025253 Ga0209677_100030 Ga0209677_100030102 316
603 3300025256 Ga0209759_1006255 Ga0209759_10062553 316
604 3300025256 Ga0209759_1007265 Ga0209759_10072653 316
605 3300025258 Ga0209129_1000055 Ga0209129_100005588 316
606 3300025263 Ga0209565_1000315 Ga0209565_10003156 316
607 3300025272 Ga0209455_1000106 Ga0209455_1000106126 316
608 3300025273 Ga0209673_1000862 Ga0209673_10008623 316
609 3300025284 Ga0209130_1000613 Ga0209130_100061324 316
610 3300025291 Ga0209675_1000187 Ga0209675_100018729 316
611 3300025292 Ga0209676_1001701 Ga0209676_100170113 316
612 3300025294 Ga0209025_1001233 Ga0209025_10012335 316
613 3300025295 Ga0209564_1000442 Ga0209564_10004423 316
614 3300025297 Ga0209758_1000042 Ga0209758_1000042272 316
615 3300025299 Ga0209256_1000148 Ga0209256_100014870 316
616 3300025302 Ga0207426_1000055 Ga0207426_100005559 316
617 3300025303 Ga0209051_1002668 Ga0209051_10026682 316
618 3300025304 Ga0209257_1003188 Ga0209257_10031883 316
619 3300025913 Ga0207695_10000409 Ga0207695_1000040921 316
620 3300025913 Ga0207695_10022583 Ga0207695_100225832 316
621 3300025920 Ga0207649_10000240 Ga0207649_1000024019 316
622 3300025945 Ga0207679_10000038 Ga0207679_1000003819 316
623 3300025981 Ga0207640_10000437 Ga0207640_1000043720 316
624 3300026067 Ga0207678_10000021 Ga0207678_1000002118 316
625 3300026078 Ga0207702_10002441 Ga0207702_100024414 316
626 3300026116 Ga0207674_10101152 Ga0207674_101011522 316
627 3300037418 Ga0395900_0007445 Ga0395900_0007445_4199_5149 316
628 3300037418 Ga0395900_0392309 Ga0395900_0392309_289_1239 316
629 3300045976 Ga0466967_0013982 Ga0466967_0013982_1037_1987 316
630 3300048928 Ga0496125_0004308 Ga0496125_0004308_11095_12045 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

27

86

0.98

PF03466

LysR_substrate

LysR substrate binding domain

111

316

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9393 5 92
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9342 5 88
5z4z-assembly2.cif.gz_C-2 crystal structure of pacysb ntd domain with space group c2 0.9324 3 88
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9316 5 91
5z4z-assembly1.cif.gz_A crystal structure of pacysb ntd domain with space group c2 0.9301 3 86
ID Description Score Start End Superfamily
af_P37682_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9791 5 89 1.10.10.10
3fzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9757 4 76 1.10.10.10
af_P0ACR4_1_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9753 4 82 1.10.10.10
af_P45463_8_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9685 7 88 1.10.10.10
af_P0A8R9_1_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9672 6 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A376JAM3-F1-model_v4 deleted 0.8343 134 306
AF-A0A376JAM3-F1-model_v4 deleted 0.8125 134 306
AF-A0A377DL31-F1-model_v4 Tdc operon transcriptional activator 0.8007 3 133 GO:0003700
GO:0005829
AF-H1SDB9-F1-model_v4 LysR family transcriptional regulator 0.7817 3 128 GO:0003700
GO:0006351
GO:0043565
AF-A0A1G1G3G6-F1-model_v4 LysR substrate-binding domain-containing protein 0.7579 92 299 GO:0000976
GO:0006355

Feature Viewer

pLDDT pTM Quality
91.59 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map