F470765
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 629 | 248 | 1258 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0001933|Ga0466963_0001933_5896_6234 |
| Length | 112 |
| Sequence | VSDGVPELWTPVAEMPHEAFVERLHRAIASFAEAAGVAKPLVEVELADTSRFVLERIDPEPGFGMVTLYVTDARDDAPDALIVPIGSLRRIELSKAPEERVQRFGFSVPPAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 101 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 102 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 103 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 106 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 114 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 118 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 123 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 124 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 125 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 126 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 127 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 128 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 129 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 130 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 131 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 132 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 133 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 138 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 139 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 143 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 144 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 145 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 146 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 147 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 148 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 149 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 150 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 151 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 152 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 153 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 154 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 155 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 230 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 231 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.79 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 12.56 |
| Rhizosphere | 87.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466963_0001933 | 3300044694 | Bacteria | 11347 |
| 2 | Ga0070658_10160868 | 3300005327 | Bacteria | 1883 |
| 3 | Ga0070683_100240301 | 3300005329 | Bacteria | 1722 |
| 4 | Ga0070683_101242637 | 3300005329 | Bacteria | 716 |
| 5 | Ga0070680_100469154 | 3300005336 | Bacteria | 1076 |
| 6 | Ga0070682_100050938 | 3300005337 | Bacteria | 2587 |
| 7 | Ga0070682_100415726 | 3300005337 | Unclassified | 1021 |
| 8 | Ga0068868_102111326 | 3300005338 | Bacteria | 536 |
| 9 | Ga0070660_100067598 | 3300005339 | Bacteria | 2784 |
| 10 | Ga0070660_100121845 | 3300005339 | Bacteria | 2081 |
| 11 | Ga0070660_101644130 | 3300005339 | Bacteria | 547 |
| 12 | Ga0070661_101146179 | 3300005344 | Unclassified | 649 |
| 13 | Ga0070671_100029890 | 3300005355 | Bacteria | 4495 |
| 14 | Ga0070671_100105915 | 3300005355 | Unclassified | 2360 |
| 15 | Ga0070673_101699706 | 3300005364 | Bacteria | 597 |
| 16 | Ga0070659_100732517 | 3300005366 | Bacteria | 857 |
| 17 | Ga0070709_10003918 | 3300005434 | Bacteria | 8026 |
| 18 | Ga0070709_10955568 | 3300005434 | Bacteria | 680 |
| 19 | Ga0070714_100034648 | 3300005435 | Bacteria | 4228 |
| 20 | Ga0070714_100072777 | 3300005435 | Bacteria | 2976 |
| 21 | Ga0070714_100285161 | 3300005435 | Bacteria | 1535 |
| 22 | Ga0070714_100679293 | 3300005435 | Bacteria | 993 |
| 23 | Ga0070714_101551825 | 3300005435 | Unclassified | 647 |
| 24 | Ga0070714_101775040 | 3300005435 | Bacteria | 602 |
| 25 | Ga0070714_102119860 | 3300005435 | Bacteria | 548 |
| 26 | Ga0070713_100034841 | 3300005436 | Bacteria | 4049 |
| 27 | Ga0070713_100178910 | 3300005436 | Bacteria | 1905 |
| 28 | Ga0070713_100811008 | 3300005436 | Bacteria | 897 |
| 29 | Ga0070710_10002373 | 3300005437 | Bacteria | 8916 |
| 30 | Ga0070710_10041104 | 3300005437 | Bacteria | 2550 |
| 31 | Ga0070711_100025521 | 3300005439 | Bacteria | 3867 |
| 32 | Ga0070711_100076539 | 3300005439 | Bacteria | 2372 |
| 33 | Ga0070711_100250950 | 3300005439 | Bacteria | 1388 |
| 34 | Ga0070705_101026520 | 3300005440 | Unclassified | 671 |
| 35 | Ga0070694_100160343 | 3300005444 | Unclassified | 1650 |
| 36 | Ga0070694_100554032 | 3300005444 | Bacteria | 921 |
| 37 | Ga0070708_100226279 | 3300005445 | Bacteria | 1755 |
| 38 | Ga0070678_100497376 | 3300005456 | Bacteria | 1075 |
| 39 | Ga0070678_101571680 | 3300005456 | Bacteria | 617 |
| 40 | Ga0070662_101280012 | 3300005457 | Bacteria | 631 |
| 41 | Ga0070706_100751915 | 3300005467 | Bacteria | 903 |
| 42 | Ga0070707_100000419 | 3300005468 | Bacteria | 41972 |
| 43 | Ga0070707_100212793 | 3300005468 | Bacteria | 1884 |
| 44 | Ga0070707_102318418 | 3300005468 | Unclassified | 504 |
| 45 | Ga0070679_100079637 | 3300005530 | Bacteria | 3265 |
| 46 | Ga0070679_100735202 | 3300005530 | Bacteria | 930 |
| 47 | Ga0070684_100049801 | 3300005535 | Bacteria | 3637 |
| 48 | Ga0070684_100141021 | 3300005535 | Bacteria | 2180 |
| 49 | Ga0070686_100146523 | 3300005544 | Bacteria | 1649 |
| 50 | Ga0070695_100015857 | 3300005545 | Bacteria | 4553 |
| 51 | Ga0070695_100321633 | 3300005545 | Bacteria | 1150 |
| 52 | Ga0070693_100681537 | 3300005547 | Bacteria | 751 |
| 53 | Ga0070693_100695597 | 3300005547 | Bacteria | 744 |
| 54 | Ga0070704_100133834 | 3300005549 | Bacteria | 1926 |
| 55 | Ga0068855_100477196 | 3300005563 | Bacteria | 1358 |
| 56 | Ga0068855_100482832 | 3300005563 | Bacteria | 1349 |
| 57 | Ga0068855_100761798 | 3300005563 | Bacteria | 1031 |
| 58 | Ga0068855_102428674 | 3300005563 | Bacteria | 523 |
| 59 | Ga0070664_100575470 | 3300005564 | Bacteria | 1043 |
| 60 | Ga0068857_100121899 | 3300005577 | Unclassified | 2348 |
| 61 | Ga0068856_100219354 | 3300005614 | Bacteria | 1917 |
| 62 | Ga0068856_100535237 | 3300005614 | Bacteria | 1193 |
| 63 | Ga0068856_100845957 | 3300005614 | Bacteria | 934 |
| 64 | Ga0068852_100249827 | 3300005616 | Bacteria | 1699 |
| 65 | Ga0068863_100717687 | 3300005841 | Bacteria | 994 |
| 66 | Ga0070717_10010680 | 3300006028 | Bacteria | 6943 |
| 67 | Ga0070717_10024344 | 3300006028 | Bacteria | 4806 |
| 68 | Ga0070717_10026448 | 3300006028 | Bacteria | 4628 |
| 69 | Ga0070717_10150946 | 3300006028 | Bacteria | 2010 |
| 70 | Ga0070717_10906574 | 3300006028 | Unclassified | 802 |
| 71 | Ga0070715_10016586 | 3300006163 | Bacteria | 2770 |
| 72 | Ga0070716_100015994 | 3300006173 | Bacteria | 3866 |
| 73 | Ga0070712_100062466 | 3300006175 | Unclassified | 2634 |
| 74 | Ga0070712_100223954 | 3300006175 | Bacteria | 1490 |
| 75 | Ga0070712_100302762 | 3300006175 | Bacteria | 1294 |
| 76 | Ga0070712_101569541 | 3300006175 | Unclassified | 576 |
| 77 | Ga0097621_100096707 | 3300006237 | Unclassified | 2478 |
| 78 | Ga0075431_100857839 | 3300006847 | Bacteria | 879 |
| 79 | Ga0075433_11911313 | 3300006852 | Bacteria | 509 |
| 80 | Ga0075434_100013149 | 3300006871 | Bacteria | 7862 |
| 81 | Ga0068865_100726458 | 3300006881 | Bacteria | 851 |
| 82 | Ga0075435_100180144 | 3300007076 | Bacteria | 1786 |
| 83 | Ga0075435_100199825 | 3300007076 | Bacteria | 1694 |
| 84 | Ga0075435_101100975 | 3300007076 | Bacteria | 694 |
| 85 | Ga0105240_11124695 | 3300009093 | Bacteria | 835 |
| 86 | Ga0105245_10083785 | 3300009098 | Bacteria | 2919 |
| 87 | Ga0105243_10880831 | 3300009148 | Bacteria | 889 |
| 88 | Ga0105241_10836707 | 3300009174 | Unclassified | 850 |
| 89 | Ga0105237_10696417 | 3300009545 | Bacteria | 1023 |
| 90 | Ga0105238_11724750 | 3300009551 | Bacteria | 658 |
| 91 | Ga0105238_12484137 | 3300009551 | Bacteria | 554 |
| 92 | Ga0105239_10371441 | 3300010375 | Bacteria | 1616 |
| 93 | Ga0105239_12309279 | 3300010375 | Unclassified | 626 |
| 94 | Ga0157373_10219222 | 3300013100 | Bacteria | 1342 |
| 95 | Ga0157370_10041650 | 3300013104 | Bacteria | 4428 |
| 96 | Ga0157369_10077018 | 3300013105 | Bacteria | 3574 |
| 97 | Ga0157369_10404359 | 3300013105 | Bacteria | 1416 |
| 98 | Ga0157374_10456614 | 3300013296 | Bacteria | 1279 |
| 99 | Ga0157374_10817392 | 3300013296 | Bacteria | 948 |
| 100 | Ga0157374_10954345 | 3300013296 | Unclassified | 876 |
| 101 | Ga0163162_10015311 | 3300013306 | Bacteria | 7491 |
| 102 | Ga0157372_10993016 | 3300013307 | Bacteria | 972 |
| 103 | Ga0157375_10731748 | 3300013308 | Bacteria | 1141 |
| 104 | Ga0182008_10112202 | 3300014497 | Bacteria | 1351 |
| 105 | Ga0157377_10314726 | 3300014745 | Bacteria | 1038 |
| 106 | Ga0157376_10087794 | 3300014969 | Bacteria | 2685 |
| 107 | Ga0197907_10103166 | 3300020069 | Bacteria | 853 |
| 108 | Ga0197907_10367872 | 3300020069 | Bacteria | 522 |
| 109 | Ga0206356_10250408 | 3300020070 | Bacteria | 1883 |
| 110 | Ga0206354_10401512 | 3300020081 | Bacteria | 765 |
| 111 | Ga0224712_10088133 | 3300022467 | Bacteria | 1295 |
| 112 | Ga0207692_10033296 | 3300025898 | Bacteria | 2484 |
| 113 | Ga0207692_10038360 | 3300025898 | Bacteria | 2349 |
| 114 | Ga0207692_10062054 | 3300025898 | Bacteria | 1939 |
| 115 | Ga0207710_10398657 | 3300025900 | Unclassified | 706 |
| 116 | Ga0207685_10004970 | 3300025905 | Bacteria | 3451 |
| 117 | Ga0207699_10027077 | 3300025906 | Bacteria | 3169 |
| 118 | Ga0207699_10040944 | 3300025906 | Bacteria | 2672 |
| 119 | Ga0207705_10070912 | 3300025909 | Bacteria | 2526 |
| 120 | Ga0207705_10195649 | 3300025909 | Bacteria | 1530 |
| 121 | Ga0207654_10937404 | 3300025911 | Archaea | 628 |
| 122 | Ga0207707_10120844 | 3300025912 | Bacteria | 2290 |
| 123 | Ga0207707_10349269 | 3300025912 | Bacteria | 1274 |
| 124 | Ga0207695_10099536 | 3300025913 | Bacteria | 2905 |
| 125 | Ga0207671_10078168 | 3300025914 | Unclassified | 2478 |
| 126 | Ga0207693_10011542 | 3300025915 | Bacteria | 7144 |
| 127 | Ga0207693_10028873 | 3300025915 | Bacteria | 4384 |
| 128 | Ga0207693_10661577 | 3300025915 | Bacteria | 811 |
| 129 | Ga0207663_10007689 | 3300025916 | Bacteria | 5605 |
| 130 | Ga0207663_10258699 | 3300025916 | Unclassified | 1284 |
| 131 | Ga0207660_10142593 | 3300025917 | Bacteria | 1833 |
| 132 | Ga0207657_10007057 | 3300025919 | Bacteria | 11541 |
| 133 | Ga0207657_10088248 | 3300025919 | Bacteria | 2593 |
| 134 | Ga0207657_10234632 | 3300025919 | Bacteria | 1466 |
| 135 | Ga0207652_10088960 | 3300025921 | Bacteria | 2710 |
| 136 | Ga0207652_10489970 | 3300025921 | Bacteria | 1107 |
| 137 | Ga0207646_10003186 | 3300025922 | Bacteria | 18746 |
| 138 | Ga0207646_10910805 | 3300025922 | Unclassified | 780 |
| 139 | Ga0207646_11314721 | 3300025922 | Bacteria | 631 |
| 140 | Ga0207694_10082151 | 3300025924 | Bacteria | 2532 |
| 141 | Ga0207687_10466119 | 3300025927 | Bacteria | 1050 |
| 142 | Ga0207700_10113164 | 3300025928 | Bacteria | 2188 |
| 143 | Ga0207700_10505556 | 3300025928 | Unclassified | 1070 |
| 144 | Ga0207700_10616444 | 3300025928 | Unclassified | 966 |
| 145 | Ga0207664_10024083 | 3300025929 | Bacteria | 4571 |
| 146 | Ga0207664_10035398 | 3300025929 | Bacteria | 3852 |
| 147 | Ga0207664_10043236 | 3300025929 | Bacteria | 3522 |
| 148 | Ga0207664_10129302 | 3300025929 | Bacteria | 2124 |
| 149 | Ga0207664_10153151 | 3300025929 | Bacteria | 1960 |
| 150 | Ga0207664_10495680 | 3300025929 | Bacteria | 1093 |
| 151 | Ga0207644_10083537 | 3300025931 | Unclassified | 2365 |
| 152 | Ga0207644_10115018 | 3300025931 | Bacteria | 2040 |
| 153 | Ga0207644_10185952 | 3300025931 | Unclassified | 1631 |
| 154 | Ga0207644_10237836 | 3300025931 | Bacteria | 1449 |
| 155 | Ga0207690_10105277 | 3300025932 | Bacteria | 2023 |
| 156 | Ga0207690_10635464 | 3300025932 | Bacteria | 874 |
| 157 | Ga0207706_10337298 | 3300025933 | Bacteria | 1311 |
| 158 | Ga0207709_11602104 | 3300025935 | Bacteria | 541 |
| 159 | Ga0207704_10550059 | 3300025938 | Bacteria | 938 |
| 160 | Ga0207665_10009328 | 3300025939 | Bacteria | 6439 |
| 161 | Ga0207665_10035443 | 3300025939 | Bacteria | 3312 |
| 162 | Ga0207679_10111311 | 3300025945 | Unclassified | 2161 |
| 163 | Ga0207667_10292677 | 3300025949 | Unclassified | 1664 |
| 164 | Ga0207667_10589658 | 3300025949 | Bacteria | 1122 |
| 165 | Ga0207677_11703656 | 3300026023 | Bacteria | 584 |
| 166 | Ga0207703_11615463 | 3300026035 | Bacteria | 624 |
| 167 | Ga0207702_10624603 | 3300026078 | Bacteria | 1058 |
| 168 | Ga0207702_10786994 | 3300026078 | Bacteria | 940 |
| 169 | Ga0207702_11063090 | 3300026078 | Unclassified | 803 |
| 170 | Ga0207641_11324492 | 3300026088 | Unclassified | 721 |
| 171 | Ga0207674_10915260 | 3300026116 | Unclassified | 845 |
| 172 | Ga0207683_11068341 | 3300026121 | Bacteria | 749 |
| 173 | Ga0207683_11294639 | 3300026121 | Unclassified | 675 |
| 174 | Ga0265337_1208617 | 3300028556 | Bacteria | 531 |
| 175 | Ga0265326_10005975 | 3300028558 | Bacteria | 3810 |
| 176 | Ga0265319_1014709 | 3300028563 | Bacteria | 3060 |
| 177 | Ga0265319_1055604 | 3300028563 | Bacteria | 1295 |
| 178 | Ga0265334_10024806 | 3300028573 | Bacteria | 2429 |
| 179 | Ga0265318_10004275 | 3300028577 | Bacteria | 6960 |
| 180 | Ga0265323_10232999 | 3300028653 | Bacteria | 575 |
| 181 | Ga0265322_10058301 | 3300028654 | Bacteria | 1095 |
| 182 | Ga0265336_10004174 | 3300028666 | Bacteria | 5500 |
| 183 | Ga0265336_10245802 | 3300028666 | Unclassified | 531 |
| 184 | Ga0265338_10001177 | 3300028800 | Bacteria | 43159 |
| 185 | Ga0265338_10004797 | 3300028800 | Bacteria | 18070 |
| 186 | Ga0265338_10018501 | 3300028800 | Bacteria | 7456 |
| 187 | Ga0265338_10021008 | 3300028800 | Bacteria | 6829 |
| 188 | Ga0265338_10033213 | 3300028800 | Bacteria | 5012 |
| 189 | Ga0265330_10027575 | 3300031235 | Bacteria | 2565 |
| 190 | Ga0265332_10004042 | 3300031238 | Bacteria | 6972 |
| 191 | Ga0265328_10002766 | 3300031239 | Bacteria | 7856 |
| 192 | Ga0265320_10058020 | 3300031240 | Bacteria | 1854 |
| 193 | Ga0265325_10000684 | 3300031241 | Bacteria | 24693 |
| 194 | Ga0265329_10022282 | 3300031242 | Bacteria | 2120 |
| 195 | Ga0265339_10012718 | 3300031249 | Bacteria | 5122 |
| 196 | Ga0265339_10061265 | 3300031249 | Bacteria | 2025 |
| 197 | Ga0265331_10156067 | 3300031250 | Bacteria | 1035 |
| 198 | Ga0265327_10027268 | 3300031251 | Bacteria | 3291 |
| 199 | Ga0265327_10124791 | 3300031251 | Bacteria | 1216 |
| 200 | Ga0265327_10199208 | 3300031251 | Bacteria | 907 |
| 201 | Ga0265327_10298724 | 3300031251 | Bacteria | 709 |
| 202 | Ga0265316_10016433 | 3300031344 | Bacteria | 6418 |
| 203 | Ga0265313_10020060 | 3300031595 | Bacteria | 3699 |
| 204 | Ga0265313_10035236 | 3300031595 | Bacteria | 2523 |
| 205 | Ga0265314_10122407 | 3300031711 | Bacteria | 1635 |
| 206 | Ga0265342_10017636 | 3300031712 | Bacteria | 4639 |
| 207 | Ga0316583_10050612 | 3300032133 | Bacteria | 1462 |
| 208 | Ga0373959_0188718 | 3300034820 | Unclassified | 539 |
| 209 | Ga0373936_0182168 | 3300035113 | Bacteria | 922 |
| 210 | Ga0373953_0200969 | 3300035117 | Bacteria | 862 |
| 211 | Ga0373954_0310542 | 3300035118 | Bacteria | 778 |
| 212 | Ga0373956_0438553 | 3300035119 | Bacteria | 623 |
| 213 | Ga0373956_0604195 | 3300035119 | Bacteria | 524 |
| 214 | Ga0373957_0196029 | 3300035120 | Unclassified | 841 |
| 215 | Ga0373957_0397865 | 3300035120 | Bacteria | 592 |
| 216 | Ga0373943_0022641 | 3300035170 | Bacteria | 2914 |
| 217 | Ga0373955_0597776 | 3300035172 | Bacteria | 676 |
| 218 | Ga0373962_0090696 | 3300035242 | Unclassified | 941 |
| 219 | Ga0373924_0121002 | 3300035410 | Bacteria | 1136 |
| 220 | Ga0373924_0172495 | 3300035410 | Bacteria | 951 |
| 221 | Ga0373931_0252441 | 3300035691 | Bacteria | 1073 |
| 222 | Ga0373933_0069698 | 3300035724 | Bacteria | 2138 |
| 223 | Ga0373933_0106457 | 3300035724 | Bacteria | 1745 |
| 224 | Ga0373933_0525665 | 3300035724 | Bacteria | 776 |
| 225 | Ga0373933_0731832 | 3300035724 | Bacteria | 651 |
| 226 | Ga0373937_0000355 | 3300036401 | Bacteria | 42585 |
| 227 | Ga0373937_0039968 | 3300036401 | Bacteria | 4275 |
| 228 | Ga0373937_0091047 | 3300036401 | Bacteria | 2826 |
| 229 | Ga0373937_0876014 | 3300036401 | Unclassified | 847 |
| 230 | Ga0373925_1253700 | 3300037068 | Bacteria | 609 |
| 231 | Ga0395899_0246701 | 3300037312 | Bacteria | 1227 |
| 232 | Ga0395899_0626434 | 3300037312 | Bacteria | 682 |
| 233 | Ga0395900_0059737 | 3300037418 | Bacteria | 3925 |
| 234 | Ga0395900_1289561 | 3300037418 | Unclassified | 644 |
| 235 | Ga0395898_0053278 | 3300037466 | Bacteria | 3951 |
| 236 | Ga0395898_0200307 | 3300037466 | Bacteria | 1906 |
| 237 | Ga0395898_0814911 | 3300037466 | Bacteria | 873 |
| 238 | Ga0395898_0820830 | 3300037466 | Bacteria | 870 |
| 239 | Ga0395898_0872146 | 3300037466 | Bacteria | 839 |
| 240 | Ga0395905_1045266 | 3300037471 | Bacteria | 720 |
| 241 | Ga0395901_0142909 | 3300038443 | Bacteria | 2515 |
| 242 | Ga0395901_0147006 | 3300038443 | Bacteria | 2477 |
| 243 | Ga0395901_0343709 | 3300038443 | Bacteria | 1541 |
| 244 | Ga0395901_1575466 | 3300038443 | Bacteria | 611 |
| 245 | Ga0436360_0128350 | 3300039438 | Bacteria | 9271 |
| 246 | Ga0466969_0003132 | 3300044656 | Bacteria | 8811 |
| 247 | Ga0466969_0027410 | 3300044656 | Bacteria | 2917 |
| 248 | Ga0466969_0461545 | 3300044656 | Unclassified | 578 |
| 249 | Ga0466965_0236559 | 3300044683 | Unclassified | 977 |
| 250 | Ga0466965_0339470 | 3300044683 | Bacteria | 821 |
| 251 | Ga0466965_0404816 | 3300044683 | Bacteria | 754 |
| 252 | Ga0466966_0003367 | 3300044684 | Bacteria | 10543 |
| 253 | Ga0466966_0040111 | 3300044684 | Bacteria | 3013 |
| 254 | Ga0466966_0053060 | 3300044684 | Bacteria | 2573 |
| 255 | Ga0466966_0069423 | 3300044684 | Bacteria | 2211 |
| 256 | Ga0466966_0393229 | 3300044684 | Bacteria | 833 |
| 257 | Ga0466966_0859688 | 3300044684 | Bacteria | 547 |
| 258 | Ga0466961_0008344 | 3300044693 | Bacteria | 6595 |
| 259 | Ga0466961_0030240 | 3300044693 | Bacteria | 3480 |
| 260 | Ga0466961_0084053 | 3300044693 | Bacteria | 2013 |
| 261 | Ga0466961_0104670 | 3300044693 | Bacteria | 1782 |
| 262 | Ga0466961_0110660 | 3300044693 | Bacteria | 1728 |
| 263 | Ga0466961_0285096 | 3300044693 | Bacteria | 1010 |
| 264 | Ga0466963_0000670 | 3300044694 | Bacteria | 16566 |
| 265 | Ga0466963_0001565 | 3300044694 | Bacteria | 12405 |
| 266 | Ga0466963_0006848 | 3300044694 | Bacteria | 6780 |
| 267 | Ga0466963_0008535 | 3300044694 | Bacteria | 6148 |
| 268 | Ga0466963_0030930 | 3300044694 | Bacteria | 3457 |
| 269 | Ga0466963_0031901 | 3300044694 | Bacteria | 3407 |
| 270 | Ga0466963_0058286 | 3300044694 | Bacteria | 2574 |
| 271 | Ga0466963_0069923 | 3300044694 | Bacteria | 2360 |
| 272 | Ga0466963_0141205 | 3300044694 | Bacteria | 1668 |
| 273 | Ga0466963_0160354 | 3300044694 | Bacteria | 1565 |
| 274 | Ga0466963_0190001 | 3300044694 | Bacteria | 1435 |
| 275 | Ga0466963_0308726 | 3300044694 | Bacteria | 1113 |
| 276 | Ga0466963_0339963 | 3300044694 | Unclassified | 1057 |
| 277 | Ga0466963_0492479 | 3300044694 | Bacteria | 865 |
| 278 | Ga0466963_0531406 | 3300044694 | Unclassified | 830 |
| 279 | Ga0466964_0010906 | 3300044706 | Bacteria | 3433 |
| 280 | Ga0466964_0013113 | 3300044706 | Bacteria | 3142 |
| 281 | Ga0466964_0020749 | 3300044706 | Bacteria | 2533 |
| 282 | Ga0466964_0029674 | 3300044706 | Bacteria | 2160 |
| 283 | Ga0466964_0044673 | 3300044706 | Bacteria | 1800 |
| 284 | Ga0466964_0047383 | 3300044706 | Bacteria | 1754 |
| 285 | Ga0466964_0048272 | 3300044706 | Bacteria | 1740 |
| 286 | Ga0466964_0108866 | 3300044706 | Bacteria | 1233 |
| 287 | Ga0466971_0009152 | 3300044719 | Bacteria | 4331 |
| 288 | Ga0466971_0017291 | 3300044719 | Bacteria | 3189 |
| 289 | Ga0466971_0021103 | 3300044719 | Bacteria | 2897 |
| 290 | Ga0466971_0031917 | 3300044719 | Bacteria | 2359 |
| 291 | Ga0466971_0129238 | 3300044719 | Bacteria | 1172 |
| 292 | Ga0466971_0153577 | 3300044719 | Bacteria | 1075 |
| 293 | Ga0466971_0208203 | 3300044719 | Bacteria | 924 |
| 294 | Ga0466968_0002132 | 3300044735 | Bacteria | 7206 |
| 295 | Ga0466968_0027952 | 3300044735 | Bacteria | 2323 |
| 296 | Ga0466968_0119552 | 3300044735 | Bacteria | 1191 |
| 297 | Ga0466968_0370845 | 3300044735 | Bacteria | 698 |
| 298 | Ga0466968_0417674 | 3300044735 | Bacteria | 659 |
| 299 | Ga0466968_0451705 | 3300044735 | Bacteria | 635 |
| 300 | Ga0466970_0149575 | 3300044765 | Unclassified | 1289 |
| 301 | Ga0466970_0903060 | 3300044765 | Bacteria | 519 |
| 302 | Ga0466957_0006041 | 3300044842 | Bacteria | 6835 |
| 303 | Ga0466957_0052993 | 3300044842 | Bacteria | 2472 |
| 304 | Ga0466957_0053228 | 3300044842 | Bacteria | 2467 |
| 305 | Ga0466957_0058781 | 3300044842 | Bacteria | 2355 |
| 306 | Ga0466957_0126387 | 3300044842 | Bacteria | 1634 |
| 307 | Ga0466957_0209301 | 3300044842 | Bacteria | 1283 |
| 308 | Ga0466957_0244618 | 3300044842 | Bacteria | 1191 |
| 309 | Ga0466957_0484861 | 3300044842 | Unclassified | 855 |
| 310 | Ga0466957_0667383 | 3300044842 | Bacteria | 732 |
| 311 | Ga0466957_1050814 | 3300044842 | Bacteria | 586 |
| 312 | Ga0466957_1267593 | 3300044842 | Bacteria | 534 |
| 313 | Ga0466960_0033619 | 3300044901 | Bacteria | 2384 |
| 314 | Ga0466960_0033826 | 3300044901 | Bacteria | 2378 |
| 315 | Ga0466960_0783164 | 3300044901 | Unclassified | 576 |
| 316 | Ga0466960_0862359 | 3300044901 | Archaea | 551 |
| 317 | Ga0466960_0920806 | 3300044901 | Bacteria | 534 |
| 318 | Ga0466959_0013342 | 3300045049 | Bacteria | 5956 |
| 319 | Ga0466959_0021777 | 3300045049 | Bacteria | 4731 |
| 320 | Ga0466959_0033703 | 3300045049 | Bacteria | 3787 |
| 321 | Ga0466959_0044436 | 3300045049 | Bacteria | 3273 |
| 322 | Ga0466959_0536804 | 3300045049 | Bacteria | 789 |
| 323 | Ga0466959_0864681 | 3300045049 | Bacteria | 603 |
| 324 | Ga0466958_0003106 | 3300045836 | Bacteria | 8528 |
| 325 | Ga0466958_0007030 | 3300045836 | Bacteria | 6157 |
| 326 | Ga0466958_0018533 | 3300045836 | Bacteria | 4041 |
| 327 | Ga0466958_0021374 | 3300045836 | Bacteria | 3780 |
| 328 | Ga0466958_0028148 | 3300045836 | Bacteria | 3330 |
| 329 | Ga0466958_0054158 | 3300045836 | Unclassified | 2433 |
| 330 | Ga0466958_0059463 | 3300045836 | Bacteria | 2325 |
| 331 | Ga0466958_0077480 | 3300045836 | Bacteria | 2041 |
| 332 | Ga0466958_0193055 | 3300045836 | Bacteria | 1294 |
| 333 | Ga0466958_0230631 | 3300045836 | Bacteria | 1182 |
| 334 | Ga0466958_0303952 | 3300045836 | Bacteria | 1024 |
| 335 | Ga0466958_0436780 | 3300045836 | Bacteria | 847 |
| 336 | Ga0466967_0000173 | 3300045976 | Bacteria | 26504 |
| 337 | Ga0466967_0012563 | 3300045976 | Bacteria | 6486 |
| 338 | Ga0466967_0018176 | 3300045976 | Bacteria | 5610 |
| 339 | Ga0466967_0023676 | 3300045976 | Bacteria | 5036 |
| 340 | Ga0466967_0027634 | 3300045976 | Bacteria | 4722 |
| 341 | Ga0466967_0035273 | 3300045976 | Bacteria | 4255 |
| 342 | Ga0466967_0035961 | 3300045976 | Bacteria | 4223 |
| 343 | Ga0466967_0058650 | 3300045976 | Bacteria | 3403 |
| 344 | Ga0466967_0070089 | 3300045976 | Bacteria | 3135 |
| 345 | Ga0466967_0077176 | 3300045976 | Unclassified | 2998 |
| 346 | Ga0466967_0161374 | 3300045976 | Bacteria | 2104 |
| 347 | Ga0466967_0163118 | 3300045976 | Bacteria | 2093 |
| 348 | Ga0466967_0176867 | 3300045976 | Bacteria | 2010 |
| 349 | Ga0466967_0228161 | 3300045976 | Bacteria | 1772 |
| 350 | Ga0466967_0459134 | 3300045976 | Bacteria | 1246 |
| 351 | Ga0466967_0564218 | 3300045976 | Bacteria | 1121 |
| 352 | Ga0466967_0921036 | 3300045976 | Bacteria | 869 |
| 353 | Ga0466967_1446623 | 3300045976 | Unclassified | 684 |
| 354 | Ga0495592_0000635 | 3300046454 | Bacteria | 24391 |
| 355 | Ga0495592_0000769 | 3300046454 | Bacteria | 22286 |
| 356 | Ga0495592_0212123 | 3300046454 | Bacteria | 1299 |
| 357 | Ga0495592_0261950 | 3300046454 | Unclassified | 1138 |
| 358 | Ga0495592_0668919 | 3300046454 | Unclassified | 627 |
| 359 | Ga0495603_0024562 | 3300046455 | Bacteria | 3646 |
| 360 | Ga0495603_0246247 | 3300046455 | Bacteria | 1029 |
| 361 | Ga0495603_0313105 | 3300046455 | Bacteria | 901 |
| 362 | Ga0495629_0176525 | 3300046459 | Bacteria | 1481 |
| 363 | Ga0495629_0198162 | 3300046459 | Bacteria | 1389 |
| 364 | Ga0495629_0338494 | 3300046459 | Bacteria | 1027 |
| 365 | Ga0495641_0015557 | 3300046461 | Bacteria | 4053 |
| 366 | Ga0495641_0053659 | 3300046461 | Bacteria | 1833 |
| 367 | Ga0495641_0094935 | 3300046461 | Bacteria | 1332 |
| 368 | Ga0495641_0107129 | 3300046461 | Bacteria | 1247 |
| 369 | Ga0495641_0542659 | 3300046461 | Bacteria | 531 |
| 370 | Ga0495651_0000029 | 3300046462 | Bacteria | 105042 |
| 371 | Ga0495651_0107030 | 3300046462 | Bacteria | 2072 |
| 372 | Ga0495651_0183063 | 3300046462 | Bacteria | 1481 |
| 373 | Ga0495653_0003221 | 3300046463 | Bacteria | 13077 |
| 374 | Ga0495653_0047046 | 3300046463 | Bacteria | 3338 |
| 375 | Ga0495653_0088200 | 3300046463 | Bacteria | 2276 |
| 376 | Ga0495653_0127755 | 3300046463 | Bacteria | 1803 |
| 377 | Ga0495653_0166497 | 3300046463 | Bacteria | 1525 |
| 378 | Ga0495580_0361154 | 3300046472 | Bacteria | 983 |
| 379 | Ga0495580_0992380 | 3300046472 | Bacteria | 536 |
| 380 | Ga0495582_0153713 | 3300046473 | Unclassified | 1307 |
| 381 | Ga0495605_0027320 | 3300046474 | Bacteria | 2958 |
| 382 | Ga0495639_0367711 | 3300046475 | Bacteria | 724 |
| 383 | Ga0495662_0039012 | 3300046476 | Bacteria | 2295 |
| 384 | Ga0495664_0129784 | 3300046477 | Unclassified | 1526 |
| 385 | Ga0495664_0410674 | 3300046477 | Bacteria | 812 |
| 386 | Ga0495664_0498022 | 3300046477 | Bacteria | 728 |
| 387 | Ga0495584_0089259 | 3300046491 | Bacteria | 1554 |
| 388 | Ga0495585_0174450 | 3300046492 | Bacteria | 1108 |
| 389 | Ga0495607_0068048 | 3300046501 | Bacteria | 1999 |
| 390 | Ga0495608_0004327 | 3300046511 | Bacteria | 10173 |
| 391 | Ga0495608_0030165 | 3300046511 | Bacteria | 3674 |
| 392 | Ga0495608_0088328 | 3300046511 | Bacteria | 2007 |
| 393 | Ga0495608_0116914 | 3300046511 | Bacteria | 1711 |
| 394 | Ga0495608_0533349 | 3300046511 | Bacteria | 708 |
| 395 | Ga0495608_0589637 | 3300046511 | Bacteria | 668 |
| 396 | Ga0495608_0602121 | 3300046511 | Unclassified | 659 |
| 397 | Ga0495618_0001935 | 3300046514 | Bacteria | 13569 |
| 398 | Ga0495618_0436659 | 3300046514 | Bacteria | 796 |
| 399 | Ga0495618_0777389 | 3300046514 | Unclassified | 559 |
| 400 | Ga0495628_0000016 | 3300046516 | Bacteria | 170260 |
| 401 | Ga0495628_0073325 | 3300046516 | Bacteria | 2667 |
| 402 | Ga0495630_0020297 | 3300046517 | Bacteria | 4899 |
| 403 | Ga0495630_0045205 | 3300046517 | Bacteria | 3290 |
| 404 | Ga0495630_0160740 | 3300046517 | Bacteria | 1710 |
| 405 | Ga0495630_0410867 | 3300046517 | Bacteria | 1037 |
| 406 | Ga0495630_0733101 | 3300046517 | Bacteria | 756 |
| 407 | Ga0495630_1525266 | 3300046517 | Bacteria | 501 |
| 408 | Ga0495637_0243925 | 3300046520 | Unclassified | 648 |
| 409 | Ga0495644_0043806 | 3300046523 | Bacteria | 1683 |
| 410 | Ga0495652_0001228 | 3300046529 | Bacteria | 28728 |
| 411 | Ga0495652_0037452 | 3300046529 | Bacteria | 4208 |
| 412 | Ga0495652_0420550 | 3300046529 | Bacteria | 942 |
| 413 | Ga0495652_0935319 | 3300046529 | Bacteria | 570 |
| 414 | Ga0495665_0501105 | 3300046531 | Unclassified | 612 |
| 415 | Ga0495640_0060035 | 3300046533 | Bacteria | 2587 |
| 416 | Ga0495640_0418793 | 3300046533 | Bacteria | 821 |
| 417 | Ga0495640_0495076 | 3300046533 | Bacteria | 744 |
| 418 | Ga0495586_0255403 | 3300046535 | Bacteria | 1000 |
| 419 | Ga0495586_0535742 | 3300046535 | Unclassified | 676 |
| 420 | Ga0495587_0000434 | 3300046536 | Bacteria | 29352 |
| 421 | Ga0495587_0095724 | 3300046536 | Bacteria | 1713 |
| 422 | Ga0495587_0827391 | 3300046536 | Bacteria | 505 |
| 423 | Ga0495598_0084750 | 3300046537 | Bacteria | 1023 |
| 424 | Ga0495645_0000367 | 3300046543 | Bacteria | 31425 |
| 425 | Ga0495645_0136597 | 3300046543 | Bacteria | 1714 |
| 426 | Ga0495667_0045691 | 3300046559 | Bacteria | 2898 |
| 427 | Ga0495667_0062037 | 3300046559 | Bacteria | 2450 |
| 428 | Ga0495667_0064138 | 3300046559 | Unclassified | 2403 |
| 429 | Ga0495667_0111279 | 3300046559 | Bacteria | 1769 |
| 430 | Ga0495656_0001482 | 3300046615 | Bacteria | 7677 |
| 431 | Ga0495668_0121227 | 3300046616 | Bacteria | 1431 |
| 432 | Ga0495634_0147067 | 3300046642 | Bacteria | 1492 |
| 433 | Ga0495634_0450340 | 3300046642 | Unclassified | 759 |
| 434 | Ga0495635_0047562 | 3300046663 | Bacteria | 2958 |
| 435 | Ga0495635_0086776 | 3300046663 | Bacteria | 2141 |
| 436 | Ga0495635_0223212 | 3300046663 | Bacteria | 1274 |
| 437 | Ga0495659_0056016 | 3300046664 | Bacteria | 1446 |
| 438 | Ga0495661_0194469 | 3300046665 | Bacteria | 1066 |
| 439 | Ga0495588_0464550 | 3300046674 | Bacteria | 664 |
| 440 | Ga0495657_0005282 | 3300046675 | Bacteria | 10223 |
| 441 | Ga0495657_0048527 | 3300046675 | Bacteria | 2863 |
| 442 | Ga0495657_0133210 | 3300046675 | Bacteria | 1555 |
| 443 | Ga0495657_0187056 | 3300046675 | Bacteria | 1267 |
| 444 | Ga0495599_0000187 | 3300046678 | Bacteria | 40807 |
| 445 | Ga0495599_0057861 | 3300046678 | Bacteria | 2425 |
| 446 | Ga0495599_0477213 | 3300046678 | Bacteria | 736 |
| 447 | Ga0495623_0000121 | 3300046679 | Bacteria | 47882 |
| 448 | Ga0495623_0423354 | 3300046679 | Bacteria | 713 |
| 449 | Ga0495623_0426405 | 3300046679 | Bacteria | 710 |
| 450 | Ga0495623_0488043 | 3300046679 | Bacteria | 652 |
| 451 | Ga0495646_0017898 | 3300046680 | Bacteria | 4489 |
| 452 | Ga0495646_0408922 | 3300046680 | Bacteria | 705 |
| 453 | Ga0495647_0054592 | 3300046681 | Bacteria | 1562 |
| 454 | Ga0495647_0107947 | 3300046681 | Bacteria | 1159 |
| 455 | Ga0495658_0056370 | 3300046683 | Bacteria | 2241 |
| 456 | Ga0495658_0067189 | 3300046683 | Bacteria | 2073 |
| 457 | Ga0495613_0005669 | 3300046689 | Bacteria | 9354 |
| 458 | Ga0495613_0067674 | 3300046689 | Bacteria | 2607 |
| 459 | Ga0495613_0203188 | 3300046689 | Bacteria | 1396 |
| 460 | Ga0495613_0299847 | 3300046689 | Bacteria | 1113 |
| 461 | Ga0495613_0506225 | 3300046689 | Bacteria | 813 |
| 462 | Ga0495624_0014162 | 3300046690 | Bacteria | 5421 |
| 463 | Ga0495624_0049072 | 3300046690 | Bacteria | 2677 |
| 464 | Ga0495624_0328317 | 3300046690 | Bacteria | 921 |
| 465 | Ga0495670_0110411 | 3300046691 | Bacteria | 1422 |
| 466 | Ga0495589_0028301 | 3300046794 | Bacteria | 2829 |
| 467 | Ga0495600_0053882 | 3300046809 | Bacteria | 2627 |
| 468 | Ga0495600_0219476 | 3300046809 | Bacteria | 1216 |
| 469 | Ga0495581_0218518 | 3300047315 | Bacteria | 1114 |
| 470 | Ga0495604_0000628 | 3300047317 | Bacteria | 30365 |
| 471 | Ga0495604_0109045 | 3300047317 | Bacteria | 2021 |
| 472 | Ga0495604_0117920 | 3300047317 | Bacteria | 1925 |
| 473 | Ga0495636_0313738 | 3300047318 | Bacteria | 735 |
| 474 | Ga0495674_0113555 | 3300047319 | Bacteria | 2294 |
| 475 | Ga0495674_0292986 | 3300047319 | Bacteria | 1330 |
| 476 | Ga0495674_0633361 | 3300047319 | Bacteria | 844 |
| 477 | Ga0495674_1163992 | 3300047319 | Bacteria | 584 |
| 478 | Ga0495676_0083226 | 3300047321 | Bacteria | 2419 |
| 479 | Ga0495676_0172361 | 3300047321 | Unclassified | 1522 |
| 480 | Ga0495676_0200531 | 3300047321 | Bacteria | 1387 |
| 481 | Ga0495676_0204732 | 3300047321 | Bacteria | 1369 |
| 482 | Ga0495676_0275704 | 3300047321 | Bacteria | 1140 |
| 483 | Ga0495676_0521758 | 3300047321 | Bacteria | 778 |
| 484 | Ga0495676_0990192 | 3300047321 | Bacteria | 537 |
| 485 | Ga0495676_1073294 | 3300047321 | Unclassified | 512 |
| 486 | Ga0495680_0001674 | 3300047322 | Bacteria | 23560 |
| 487 | Ga0495680_0002048 | 3300047322 | Bacteria | 21061 |
| 488 | Ga0495680_0043895 | 3300047322 | Bacteria | 3537 |
| 489 | Ga0495680_0071201 | 3300047322 | Bacteria | 2648 |
| 490 | Ga0495680_0181349 | 3300047322 | Bacteria | 1520 |
| 491 | Ga0495680_1007901 | 3300047322 | Unclassified | 532 |
| 492 | Ga0495675_0000031 | 3300047444 | Bacteria | 99240 |
| 493 | Ga0495675_0200354 | 3300047444 | Bacteria | 1215 |
| 494 | Ga0495675_0223747 | 3300047444 | Bacteria | 1138 |
| 495 | Ga0495679_032728 | 3300047446 | Bacteria | 1665 |
| 496 | Ga0495684_0032060 | 3300047471 | Bacteria | 4033 |
| 497 | Ga0495684_0158741 | 3300047471 | Bacteria | 1688 |
| 498 | Ga0495684_0203498 | 3300047471 | Bacteria | 1458 |
| 499 | Ga0495684_1026873 | 3300047471 | Unclassified | 522 |
| 500 | Ga0495593_0107154 | 3300047673 | Bacteria | 1429 |
| 501 | Ga0495602_0000133 | 3300048088 | Bacteria | 69392 |
| 502 | Ga0495602_0187305 | 3300048088 | Bacteria | 1590 |
| 503 | Ga0495602_0779631 | 3300048088 | Bacteria | 643 |
| 504 | Ga0495614_0125844 | 3300048089 | Unclassified | 1132 |
| 505 | Ga0495614_0604513 | 3300048089 | Unclassified | 527 |
| 506 | Ga0496100_0004881 | 3300048903 | Bacteria | 7168 |
| 507 | Ga0496100_0080894 | 3300048903 | Bacteria | 2193 |
| 508 | Ga0496100_0179106 | 3300048903 | Bacteria | 1532 |
| 509 | Ga0496100_0512142 | 3300048903 | Bacteria | 925 |
| 510 | Ga0496100_0716701 | 3300048903 | Unclassified | 781 |
| 511 | Ga0496101_0002611 | 3300048904 | Bacteria | 11068 |
| 512 | Ga0496101_0004138 | 3300048904 | Bacteria | 9083 |
| 513 | Ga0496101_0048867 | 3300048904 | Bacteria | 3041 |
| 514 | Ga0496101_0179896 | 3300048904 | Bacteria | 1628 |
| 515 | Ga0496101_0218680 | 3300048904 | Bacteria | 1478 |
| 516 | Ga0496101_0242471 | 3300048904 | Bacteria | 1403 |
| 517 | Ga0496101_1050818 | 3300048904 | Bacteria | 640 |
| 518 | Ga0496102_0005424 | 3300048905 | Bacteria | 10820 |
| 519 | Ga0496102_0076014 | 3300048905 | Bacteria | 3088 |
| 520 | Ga0496102_0396101 | 3300048905 | Unclassified | 1298 |
| 521 | Ga0496103_0296597 | 3300048906 | Bacteria | 1040 |
| 522 | Ga0496103_0320927 | 3300048906 | Unclassified | 996 |
| 523 | Ga0496104_0009726 | 3300048907 | Bacteria | 8571 |
| 524 | Ga0496104_0089286 | 3300048907 | Bacteria | 2944 |
| 525 | Ga0496104_0110041 | 3300048907 | Bacteria | 2640 |
| 526 | Ga0496104_0122313 | 3300048907 | Bacteria | 2499 |
| 527 | Ga0496104_0165850 | 3300048907 | Bacteria | 2118 |
| 528 | Ga0496104_0261711 | 3300048907 | Bacteria | 1642 |
| 529 | Ga0496105_0000923 | 3300048908 | Bacteria | 20034 |
| 530 | Ga0496105_0001598 | 3300048908 | Bacteria | 16044 |
| 531 | Ga0496105_0020322 | 3300048908 | Bacteria | 5365 |
| 532 | Ga0496105_0028825 | 3300048908 | Bacteria | 4541 |
| 533 | Ga0496105_0039115 | 3300048908 | Bacteria | 3908 |
| 534 | Ga0496105_0061878 | 3300048908 | Bacteria | 3089 |
| 535 | Ga0496105_0319160 | 3300048908 | Bacteria | 1245 |
| 536 | Ga0496106_0003798 | 3300048909 | Bacteria | 11253 |
| 537 | Ga0496106_0017249 | 3300048909 | Bacteria | 5344 |
| 538 | Ga0496106_0074853 | 3300048909 | Bacteria | 2593 |
| 539 | Ga0496106_0123596 | 3300048909 | Bacteria | 2025 |
| 540 | Ga0496107_0003164 | 3300048910 | Bacteria | 10940 |
| 541 | Ga0496107_0004023 | 3300048910 | Bacteria | 9901 |
| 542 | Ga0496107_0070548 | 3300048910 | Bacteria | 2537 |
| 543 | Ga0496107_0131274 | 3300048910 | Bacteria | 1849 |
| 544 | Ga0496108_0001935 | 3300048911 | Bacteria | 16596 |
| 545 | Ga0496108_0009005 | 3300048911 | Bacteria | 8086 |
| 546 | Ga0496108_0031320 | 3300048911 | Bacteria | 4412 |
| 547 | Ga0496108_0051123 | 3300048911 | Bacteria | 3462 |
| 548 | Ga0496108_0184235 | 3300048911 | Bacteria | 1808 |
| 549 | Ga0496109_0009729 | 3300048912 | Bacteria | 8207 |
| 550 | Ga0496109_0056072 | 3300048912 | Bacteria | 3595 |
| 551 | Ga0496109_0137633 | 3300048912 | Bacteria | 2282 |
| 552 | Ga0496109_0182388 | 3300048912 | Bacteria | 1972 |
| 553 | Ga0496109_0203091 | 3300048912 | Bacteria | 1863 |
| 554 | Ga0496109_0424745 | 3300048912 | Bacteria | 1256 |
| 555 | Ga0496109_0797366 | 3300048912 | Bacteria | 882 |
| 556 | Ga0496109_1439609 | 3300048912 | Bacteria | 624 |
| 557 | Ga0496110_0005340 | 3300048913 | Bacteria | 10064 |
| 558 | Ga0496110_0464964 | 3300048913 | Bacteria | 1153 |
| 559 | Ga0496110_0745888 | 3300048913 | Bacteria | 882 |
| 560 | Ga0496111_0019399 | 3300048914 | Bacteria | 4722 |
| 561 | Ga0496111_0276871 | 3300048914 | Bacteria | 1245 |
| 562 | Ga0496111_0420786 | 3300048914 | Bacteria | 987 |
| 563 | Ga0496112_0010065 | 3300048915 | Bacteria | 8562 |
| 564 | Ga0496112_0035607 | 3300048915 | Bacteria | 4851 |
| 565 | Ga0496112_0081287 | 3300048915 | Bacteria | 3204 |
| 566 | Ga0496112_0126197 | 3300048915 | Bacteria | 2530 |
| 567 | Ga0496112_0847350 | 3300048915 | Bacteria | 838 |
| 568 | Ga0496112_0864343 | 3300048915 | Bacteria | 827 |
| 569 | Ga0496112_1746275 | 3300048915 | Bacteria | 534 |
| 570 | Ga0496113_0067974 | 3300048916 | Bacteria | 2703 |
| 571 | Ga0496113_0113480 | 3300048916 | Bacteria | 2112 |
| 572 | Ga0496113_0312119 | 3300048916 | Unclassified | 1260 |
| 573 | Ga0496113_0729316 | 3300048916 | Bacteria | 790 |
| 574 | Ga0496114_0001888 | 3300048917 | Bacteria | 15905 |
| 575 | Ga0496114_0003560 | 3300048917 | Bacteria | 11962 |
| 576 | Ga0496114_0036843 | 3300048917 | Bacteria | 4044 |
| 577 | Ga0496114_0323284 | 3300048917 | Bacteria | 1363 |
| 578 | Ga0496115_0003641 | 3300048918 | Bacteria | 11090 |
| 579 | Ga0496115_0006847 | 3300048918 | Bacteria | 8366 |
| 580 | Ga0496115_0022854 | 3300048918 | Bacteria | 4849 |
| 581 | Ga0496115_0033480 | 3300048918 | Bacteria | 4057 |
| 582 | Ga0496115_0059138 | 3300048918 | Bacteria | 3086 |
| 583 | Ga0496115_0072734 | 3300048918 | Bacteria | 2790 |
| 584 | Ga0496115_0161684 | 3300048918 | Bacteria | 1850 |
| 585 | Ga0501047_0855534 | 3300049581 | Bacteria | 723 |
| 586 | Ga0501067_0090721 | 3300049583 | Bacteria | 1696 |
| 587 | Ga0501067_0470328 | 3300049583 | Bacteria | 702 |
| 588 | Ga0501069_0051595 | 3300049585 | Bacteria | 2289 |
| 589 | Ga0501070_0008235 | 3300049586 | Bacteria | 8814 |
| 590 | Ga0501070_0981790 | 3300049586 | Unclassified | 656 |
| 591 | Ga0501072_0129203 | 3300049588 | Bacteria | 2013 |
| 592 | Ga0501073_0007213 | 3300049589 | Bacteria | 8278 |
| 593 | Ga0501074_0191393 | 3300049590 | Bacteria | 1458 |
| 594 | Ga0501079_0132825 | 3300049741 | Bacteria | 1937 |
| 595 | Ga0501080_0134498 | 3300049742 | Bacteria | 2288 |
| 596 | Ga0501083_0001504 | 3300049744 | Bacteria | 15925 |
| 597 | nmdc:mga0n895_9466_c1 | 3300050512 | Bacteria | 8524 |
| 598 | nmdc:mga0rr50_1008665_c1 | 3300050513 | Bacteria | 709 |
| 599 | nmdc:mga0rr50_1139172_c1 | 3300050513 | Unclassified | 663 |
| 600 | nmdc:mga0rr50_291746_c1 | 3300050513 | Bacteria | 1363 |
| 601 | nmdc:mga0a205_213277_c1 | 3300050515 | Bacteria | 1818 |
| 602 | Ga0495601_0001112 | 3300053077 | Bacteria | 14736 |
| 603 | Ga0495601_0024350 | 3300053077 | Bacteria | 3727 |
| 604 | Ga0495601_0096030 | 3300053077 | Bacteria | 1911 |
| 605 | Ga0495601_0173304 | 3300053077 | Bacteria | 1410 |
| 606 | Ga0495612_0013653 | 3300053078 | Bacteria | 3271 |
| 607 | Ga0495612_0074082 | 3300053078 | Bacteria | 1423 |
| 608 | Ga0495612_0165677 | 3300053078 | Bacteria | 966 |
| 609 | Ga0495612_0530468 | 3300053078 | Bacteria | 541 |
| 610 | Ga0495595_0015621 | 3300053084 | Bacteria | 3239 |
| 611 | Ga0495595_0179180 | 3300053084 | Bacteria | 1050 |
| 612 | Ga0495595_0341208 | 3300053084 | Bacteria | 755 |
| 613 | Ga0495595_0416983 | 3300053084 | Bacteria | 681 |
| 614 | Ga0495595_0508818 | 3300053084 | Bacteria | 614 |
| 615 | Ga0495619_0001848 | 3300053085 | Bacteria | 14098 |
| 616 | Ga0495619_0067227 | 3300053085 | Bacteria | 2392 |
| 617 | Ga0495619_0141845 | 3300053085 | Bacteria | 1655 |
| 618 | Ga0495619_0256881 | 3300053085 | Unclassified | 1211 |
| 619 | Ga0495619_0273576 | 3300053085 | Bacteria | 1170 |
| 620 | Ga0495619_0644951 | 3300053085 | Bacteria | 722 |
| 621 | Ga0495619_0846356 | 3300053085 | Unclassified | 617 |
| 622 | Ga0466962_0006426 | 3300061719 | Bacteria | 5641 |
| 623 | Ga0466962_0013053 | 3300061719 | Bacteria | 3996 |
| 624 | Ga0466962_0040044 | 3300061719 | Bacteria | 2244 |
| 625 | Ga0466962_0108844 | 3300061719 | Bacteria | 1333 |
| 626 | Ga0466962_0119796 | 3300061719 | Bacteria | 1269 |
| 627 | Ga0466962_0172052 | 3300061719 | Bacteria | 1055 |
| 628 | Ga0466962_0175269 | 3300061719 | Unclassified | 1045 |
| 629 | Ga0466962_0306313 | 3300061719 | Bacteria | 786 |
| 630 | Ga0466963_0001933 | |||
| 631 | Ga0070658_10160868 | |||
| 632 | Ga0070683_100240301 | |||
| 633 | Ga0070683_101242637 | |||
| 634 | Ga0070680_100469154 | |||
| 635 | Ga0070682_100050938 | |||
| 636 | Ga0070682_100415726 | |||
| 637 | Ga0068868_102111326 | |||
| 638 | Ga0070660_100067598 | |||
| 639 | Ga0070660_100121845 | |||
| 640 | Ga0070660_101644130 | |||
| 641 | Ga0070661_101146179 | |||
| 642 | Ga0070671_100029890 | |||
| 643 | Ga0070671_100105915 | |||
| 644 | Ga0070673_101699706 | |||
| 645 | Ga0070659_100732517 | |||
| 646 | Ga0070709_10003918 | |||
| 647 | Ga0070709_10955568 | |||
| 648 | Ga0070714_100034648 | |||
| 649 | Ga0070714_100072777 | |||
| 650 | Ga0070714_100285161 | |||
| 651 | Ga0070714_100679293 | |||
| 652 | Ga0070714_101551825 | |||
| 653 | Ga0070714_101775040 | |||
| 654 | Ga0070714_102119860 | |||
| 655 | Ga0070713_100034841 | |||
| 656 | Ga0070713_100178910 | |||
| 657 | Ga0070713_100811008 | |||
| 658 | Ga0070710_10002373 | |||
| 659 | Ga0070710_10041104 | |||
| 660 | Ga0070711_100025521 | |||
| 661 | Ga0070711_100076539 | |||
| 662 | Ga0070711_100250950 | |||
| 663 | Ga0070705_101026520 | |||
| 664 | Ga0070694_100160343 | |||
| 665 | Ga0070694_100554032 | |||
| 666 | Ga0070708_100226279 | |||
| 667 | Ga0070678_100497376 | |||
| 668 | Ga0070678_101571680 | |||
| 669 | Ga0070662_101280012 | |||
| 670 | Ga0070706_100751915 | |||
| 671 | Ga0070707_100000419 | |||
| 672 | Ga0070707_100212793 | |||
| 673 | Ga0070707_102318418 | |||
| 674 | Ga0070679_100079637 | |||
| 675 | Ga0070679_100735202 | |||
| 676 | Ga0070684_100049801 | |||
| 677 | Ga0070684_100141021 | |||
| 678 | Ga0070686_100146523 | |||
| 679 | Ga0070695_100015857 | |||
| 680 | Ga0070695_100321633 | |||
| 681 | Ga0070693_100681537 | |||
| 682 | Ga0070693_100695597 | |||
| 683 | Ga0070704_100133834 | |||
| 684 | Ga0068855_100477196 | |||
| 685 | Ga0068855_100482832 | |||
| 686 | Ga0068855_100761798 | |||
| 687 | Ga0068855_102428674 | |||
| 688 | Ga0070664_100575470 | |||
| 689 | Ga0068857_100121899 | |||
| 690 | Ga0068856_100219354 | |||
| 691 | Ga0068856_100535237 | |||
| 692 | Ga0068856_100845957 | |||
| 693 | Ga0068852_100249827 | |||
| 694 | Ga0068863_100717687 | |||
| 695 | Ga0070717_10010680 | |||
| 696 | Ga0070717_10024344 | |||
| 697 | Ga0070717_10026448 | |||
| 698 | Ga0070717_10150946 | |||
| 699 | Ga0070717_10906574 | |||
| 700 | Ga0070715_10016586 | |||
| 701 | Ga0070716_100015994 | |||
| 702 | Ga0070712_100062466 | |||
| 703 | Ga0070712_100223954 | |||
| 704 | Ga0070712_100302762 | |||
| 705 | Ga0070712_101569541 | |||
| 706 | Ga0097621_100096707 | |||
| 707 | Ga0075431_100857839 | |||
| 708 | Ga0075433_11911313 | |||
| 709 | Ga0075434_100013149 | |||
| 710 | Ga0068865_100726458 | |||
| 711 | Ga0075435_100180144 | |||
| 712 | Ga0075435_100199825 | |||
| 713 | Ga0075435_101100975 | |||
| 714 | Ga0105240_11124695 | |||
| 715 | Ga0105245_10083785 | |||
| 716 | Ga0105243_10880831 | |||
| 717 | Ga0105241_10836707 | |||
| 718 | Ga0105237_10696417 | |||
| 719 | Ga0105238_11724750 | |||
| 720 | Ga0105238_12484137 | |||
| 721 | Ga0105239_10371441 | |||
| 722 | Ga0105239_12309279 | |||
| 723 | Ga0157373_10219222 | |||
| 724 | Ga0157370_10041650 | |||
| 725 | Ga0157369_10077018 | |||
| 726 | Ga0157369_10404359 | |||
| 727 | Ga0157374_10456614 | |||
| 728 | Ga0157374_10817392 | |||
| 729 | Ga0157374_10954345 | |||
| 730 | Ga0163162_10015311 | |||
| 731 | Ga0157372_10993016 | |||
| 732 | Ga0157375_10731748 | |||
| 733 | Ga0182008_10112202 | |||
| 734 | Ga0157377_10314726 | |||
| 735 | Ga0157376_10087794 | |||
| 736 | Ga0197907_10103166 | |||
| 737 | Ga0197907_10367872 | |||
| 738 | Ga0206356_10250408 | |||
| 739 | Ga0206354_10401512 | |||
| 740 | Ga0224712_10088133 | |||
| 741 | Ga0207692_10033296 | |||
| 742 | Ga0207692_10038360 | |||
| 743 | Ga0207692_10062054 | |||
| 744 | Ga0207710_10398657 | |||
| 745 | Ga0207685_10004970 | |||
| 746 | Ga0207699_10027077 | |||
| 747 | Ga0207699_10040944 | |||
| 748 | Ga0207705_10070912 | |||
| 749 | Ga0207705_10195649 | |||
| 750 | Ga0207654_10937404 | |||
| 751 | Ga0207707_10120844 | |||
| 752 | Ga0207707_10349269 | |||
| 753 | Ga0207695_10099536 | |||
| 754 | Ga0207671_10078168 | |||
| 755 | Ga0207693_10011542 | |||
| 756 | Ga0207693_10028873 | |||
| 757 | Ga0207693_10661577 | |||
| 758 | Ga0207663_10007689 | |||
| 759 | Ga0207663_10258699 | |||
| 760 | Ga0207660_10142593 | |||
| 761 | Ga0207657_10007057 | |||
| 762 | Ga0207657_10088248 | |||
| 763 | Ga0207657_10234632 | |||
| 764 | Ga0207652_10088960 | |||
| 765 | Ga0207652_10489970 | |||
| 766 | Ga0207646_10003186 | |||
| 767 | Ga0207646_10910805 | |||
| 768 | Ga0207646_11314721 | |||
| 769 | Ga0207694_10082151 | |||
| 770 | Ga0207687_10466119 | |||
| 771 | Ga0207700_10113164 | |||
| 772 | Ga0207700_10505556 | |||
| 773 | Ga0207700_10616444 | |||
| 774 | Ga0207664_10024083 | |||
| 775 | Ga0207664_10035398 | |||
| 776 | Ga0207664_10043236 | |||
| 777 | Ga0207664_10129302 | |||
| 778 | Ga0207664_10153151 | |||
| 779 | Ga0207664_10495680 | |||
| 780 | Ga0207644_10083537 | |||
| 781 | Ga0207644_10115018 | |||
| 782 | Ga0207644_10185952 | |||
| 783 | Ga0207644_10237836 | |||
| 784 | Ga0207690_10105277 | |||
| 785 | Ga0207690_10635464 | |||
| 786 | Ga0207706_10337298 | |||
| 787 | Ga0207709_11602104 | |||
| 788 | Ga0207704_10550059 | |||
| 789 | Ga0207665_10009328 | |||
| 790 | Ga0207665_10035443 | |||
| 791 | Ga0207679_10111311 | |||
| 792 | Ga0207667_10292677 | |||
| 793 | Ga0207667_10589658 | |||
| 794 | Ga0207677_11703656 | |||
| 795 | Ga0207703_11615463 | |||
| 796 | Ga0207702_10624603 | |||
| 797 | Ga0207702_10786994 | |||
| 798 | Ga0207702_11063090 | |||
| 799 | Ga0207641_11324492 | |||
| 800 | Ga0207674_10915260 | |||
| 801 | Ga0207683_11068341 | |||
| 802 | Ga0207683_11294639 | |||
| 803 | Ga0265337_1208617 | |||
| 804 | Ga0265326_10005975 | |||
| 805 | Ga0265319_1014709 | |||
| 806 | Ga0265319_1055604 | |||
| 807 | Ga0265334_10024806 | |||
| 808 | Ga0265318_10004275 | |||
| 809 | Ga0265323_10232999 | |||
| 810 | Ga0265322_10058301 | |||
| 811 | Ga0265336_10004174 | |||
| 812 | Ga0265336_10245802 | |||
| 813 | Ga0265338_10001177 | |||
| 814 | Ga0265338_10004797 | |||
| 815 | Ga0265338_10018501 | |||
| 816 | Ga0265338_10021008 | |||
| 817 | Ga0265338_10033213 | |||
| 818 | Ga0265330_10027575 | |||
| 819 | Ga0265332_10004042 | |||
| 820 | Ga0265328_10002766 | |||
| 821 | Ga0265320_10058020 | |||
| 822 | Ga0265325_10000684 | |||
| 823 | Ga0265329_10022282 | |||
| 824 | Ga0265339_10012718 | |||
| 825 | Ga0265339_10061265 | |||
| 826 | Ga0265331_10156067 | |||
| 827 | Ga0265327_10027268 | |||
| 828 | Ga0265327_10124791 | |||
| 829 | Ga0265327_10199208 | |||
| 830 | Ga0265327_10298724 | |||
| 831 | Ga0265316_10016433 | |||
| 832 | Ga0265313_10020060 | |||
| 833 | Ga0265313_10035236 | |||
| 834 | Ga0265314_10122407 | |||
| 835 | Ga0265342_10017636 | |||
| 836 | Ga0316583_10050612 | |||
| 837 | Ga0373959_0188718 | |||
| 838 | Ga0373936_0182168 | |||
| 839 | Ga0373953_0200969 | |||
| 840 | Ga0373954_0310542 | |||
| 841 | Ga0373956_0438553 | |||
| 842 | Ga0373956_0604195 | |||
| 843 | Ga0373957_0196029 | |||
| 844 | Ga0373957_0397865 | |||
| 845 | Ga0373943_0022641 | |||
| 846 | Ga0373955_0597776 | |||
| 847 | Ga0373962_0090696 | |||
| 848 | Ga0373924_0121002 | |||
| 849 | Ga0373924_0172495 | |||
| 850 | Ga0373931_0252441 | |||
| 851 | Ga0373933_0069698 | |||
| 852 | Ga0373933_0106457 | |||
| 853 | Ga0373933_0525665 | |||
| 854 | Ga0373933_0731832 | |||
| 855 | Ga0373937_0000355 | |||
| 856 | Ga0373937_0039968 | |||
| 857 | Ga0373937_0091047 | |||
| 858 | Ga0373937_0876014 | |||
| 859 | Ga0373925_1253700 | |||
| 860 | Ga0395899_0246701 | |||
| 861 | Ga0395899_0626434 | |||
| 862 | Ga0395900_0059737 | |||
| 863 | Ga0395900_1289561 | |||
| 864 | Ga0395898_0053278 | |||
| 865 | Ga0395898_0200307 | |||
| 866 | Ga0395898_0814911 | |||
| 867 | Ga0395898_0820830 | |||
| 868 | Ga0395898_0872146 | |||
| 869 | Ga0395905_1045266 | |||
| 870 | Ga0395901_0142909 | |||
| 871 | Ga0395901_0147006 | |||
| 872 | Ga0395901_0343709 | |||
| 873 | Ga0395901_1575466 | |||
| 874 | Ga0436360_0128350 | |||
| 875 | Ga0466969_0003132 | |||
| 876 | Ga0466969_0027410 | |||
| 877 | Ga0466969_0461545 | |||
| 878 | Ga0466965_0236559 | |||
| 879 | Ga0466965_0339470 | |||
| 880 | Ga0466965_0404816 | |||
| 881 | Ga0466966_0003367 | |||
| 882 | Ga0466966_0040111 | |||
| 883 | Ga0466966_0053060 | |||
| 884 | Ga0466966_0069423 | |||
| 885 | Ga0466966_0393229 | |||
| 886 | Ga0466966_0859688 | |||
| 887 | Ga0466961_0008344 | |||
| 888 | Ga0466961_0030240 | |||
| 889 | Ga0466961_0084053 | |||
| 890 | Ga0466961_0104670 | |||
| 891 | Ga0466961_0110660 | |||
| 892 | Ga0466961_0285096 | |||
| 893 | Ga0466963_0000670 | |||
| 894 | Ga0466963_0001565 | |||
| 895 | Ga0466963_0006848 | |||
| 896 | Ga0466963_0008535 | |||
| 897 | Ga0466963_0030930 | |||
| 898 | Ga0466963_0031901 | |||
| 899 | Ga0466963_0058286 | |||
| 900 | Ga0466963_0069923 | |||
| 901 | Ga0466963_0141205 | |||
| 902 | Ga0466963_0160354 | |||
| 903 | Ga0466963_0190001 | |||
| 904 | Ga0466963_0308726 | |||
| 905 | Ga0466963_0339963 | |||
| 906 | Ga0466963_0492479 | |||
| 907 | Ga0466963_0531406 | |||
| 908 | Ga0466964_0010906 | |||
| 909 | Ga0466964_0013113 | |||
| 910 | Ga0466964_0020749 | |||
| 911 | Ga0466964_0029674 | |||
| 912 | Ga0466964_0044673 | |||
| 913 | Ga0466964_0047383 | |||
| 914 | Ga0466964_0048272 | |||
| 915 | Ga0466964_0108866 | |||
| 916 | Ga0466971_0009152 | |||
| 917 | Ga0466971_0017291 | |||
| 918 | Ga0466971_0021103 | |||
| 919 | Ga0466971_0031917 | |||
| 920 | Ga0466971_0129238 | |||
| 921 | Ga0466971_0153577 | |||
| 922 | Ga0466971_0208203 | |||
| 923 | Ga0466968_0002132 | |||
| 924 | Ga0466968_0027952 | |||
| 925 | Ga0466968_0119552 | |||
| 926 | Ga0466968_0370845 | |||
| 927 | Ga0466968_0417674 | |||
| 928 | Ga0466968_0451705 | |||
| 929 | Ga0466970_0149575 | |||
| 930 | Ga0466970_0903060 | |||
| 931 | Ga0466957_0006041 | |||
| 932 | Ga0466957_0052993 | |||
| 933 | Ga0466957_0053228 | |||
| 934 | Ga0466957_0058781 | |||
| 935 | Ga0466957_0126387 | |||
| 936 | Ga0466957_0209301 | |||
| 937 | Ga0466957_0244618 | |||
| 938 | Ga0466957_0484861 | |||
| 939 | Ga0466957_0667383 | |||
| 940 | Ga0466957_1050814 | |||
| 941 | Ga0466957_1267593 | |||
| 942 | Ga0466960_0033619 | |||
| 943 | Ga0466960_0033826 | |||
| 944 | Ga0466960_0783164 | |||
| 945 | Ga0466960_0862359 | |||
| 946 | Ga0466960_0920806 | |||
| 947 | Ga0466959_0013342 | |||
| 948 | Ga0466959_0021777 | |||
| 949 | Ga0466959_0033703 | |||
| 950 | Ga0466959_0044436 | |||
| 951 | Ga0466959_0536804 | |||
| 952 | Ga0466959_0864681 | |||
| 953 | Ga0466958_0003106 | |||
| 954 | Ga0466958_0007030 | |||
| 955 | Ga0466958_0018533 | |||
| 956 | Ga0466958_0021374 | |||
| 957 | Ga0466958_0028148 | |||
| 958 | Ga0466958_0054158 | |||
| 959 | Ga0466958_0059463 | |||
| 960 | Ga0466958_0077480 | |||
| 961 | Ga0466958_0193055 | |||
| 962 | Ga0466958_0230631 | |||
| 963 | Ga0466958_0303952 | |||
| 964 | Ga0466958_0436780 | |||
| 965 | Ga0466967_0000173 | |||
| 966 | Ga0466967_0012563 | |||
| 967 | Ga0466967_0018176 | |||
| 968 | Ga0466967_0023676 | |||
| 969 | Ga0466967_0027634 | |||
| 970 | Ga0466967_0035273 | |||
| 971 | Ga0466967_0035961 | |||
| 972 | Ga0466967_0058650 | |||
| 973 | Ga0466967_0070089 | |||
| 974 | Ga0466967_0077176 | |||
| 975 | Ga0466967_0161374 | |||
| 976 | Ga0466967_0163118 | |||
| 977 | Ga0466967_0176867 | |||
| 978 | Ga0466967_0228161 | |||
| 979 | Ga0466967_0459134 | |||
| 980 | Ga0466967_0564218 | |||
| 981 | Ga0466967_0921036 | |||
| 982 | Ga0466967_1446623 | |||
| 983 | Ga0495592_0000635 | |||
| 984 | Ga0495592_0000769 | |||
| 985 | Ga0495592_0212123 | |||
| 986 | Ga0495592_0261950 | |||
| 987 | Ga0495592_0668919 | |||
| 988 | Ga0495603_0024562 | |||
| 989 | Ga0495603_0246247 | |||
| 990 | Ga0495603_0313105 | |||
| 991 | Ga0495629_0176525 | |||
| 992 | Ga0495629_0198162 | |||
| 993 | Ga0495629_0338494 | |||
| 994 | Ga0495641_0015557 | |||
| 995 | Ga0495641_0053659 | |||
| 996 | Ga0495641_0094935 | |||
| 997 | Ga0495641_0107129 | |||
| 998 | Ga0495641_0542659 | |||
| 999 | Ga0495651_0000029 | |||
| 1000 | Ga0495651_0107030 | |||
| 1001 | Ga0495651_0183063 | |||
| 1002 | Ga0495653_0003221 | |||
| 1003 | Ga0495653_0047046 | |||
| 1004 | Ga0495653_0088200 | |||
| 1005 | Ga0495653_0127755 | |||
| 1006 | Ga0495653_0166497 | |||
| 1007 | Ga0495580_0361154 | |||
| 1008 | Ga0495580_0992380 | |||
| 1009 | Ga0495582_0153713 | |||
| 1010 | Ga0495605_0027320 | |||
| 1011 | Ga0495639_0367711 | |||
| 1012 | Ga0495662_0039012 | |||
| 1013 | Ga0495664_0129784 | |||
| 1014 | Ga0495664_0410674 | |||
| 1015 | Ga0495664_0498022 | |||
| 1016 | Ga0495584_0089259 | |||
| 1017 | Ga0495585_0174450 | |||
| 1018 | Ga0495607_0068048 | |||
| 1019 | Ga0495608_0004327 | |||
| 1020 | Ga0495608_0030165 | |||
| 1021 | Ga0495608_0088328 | |||
| 1022 | Ga0495608_0116914 | |||
| 1023 | Ga0495608_0533349 | |||
| 1024 | Ga0495608_0589637 | |||
| 1025 | Ga0495608_0602121 | |||
| 1026 | Ga0495618_0001935 | |||
| 1027 | Ga0495618_0436659 | |||
| 1028 | Ga0495618_0777389 | |||
| 1029 | Ga0495628_0000016 | |||
| 1030 | Ga0495628_0073325 | |||
| 1031 | Ga0495630_0020297 | |||
| 1032 | Ga0495630_0045205 | |||
| 1033 | Ga0495630_0160740 | |||
| 1034 | Ga0495630_0410867 | |||
| 1035 | Ga0495630_0733101 | |||
| 1036 | Ga0495630_1525266 | |||
| 1037 | Ga0495637_0243925 | |||
| 1038 | Ga0495644_0043806 | |||
| 1039 | Ga0495652_0001228 | |||
| 1040 | Ga0495652_0037452 | |||
| 1041 | Ga0495652_0420550 | |||
| 1042 | Ga0495652_0935319 | |||
| 1043 | Ga0495665_0501105 | |||
| 1044 | Ga0495640_0060035 | |||
| 1045 | Ga0495640_0418793 | |||
| 1046 | Ga0495640_0495076 | |||
| 1047 | Ga0495586_0255403 | |||
| 1048 | Ga0495586_0535742 | |||
| 1049 | Ga0495587_0000434 | |||
| 1050 | Ga0495587_0095724 | |||
| 1051 | Ga0495587_0827391 | |||
| 1052 | Ga0495598_0084750 | |||
| 1053 | Ga0495645_0000367 | |||
| 1054 | Ga0495645_0136597 | |||
| 1055 | Ga0495667_0045691 | |||
| 1056 | Ga0495667_0062037 | |||
| 1057 | Ga0495667_0064138 | |||
| 1058 | Ga0495667_0111279 | |||
| 1059 | Ga0495656_0001482 | |||
| 1060 | Ga0495668_0121227 | |||
| 1061 | Ga0495634_0147067 | |||
| 1062 | Ga0495634_0450340 | |||
| 1063 | Ga0495635_0047562 | |||
| 1064 | Ga0495635_0086776 | |||
| 1065 | Ga0495635_0223212 | |||
| 1066 | Ga0495659_0056016 | |||
| 1067 | Ga0495661_0194469 | |||
| 1068 | Ga0495588_0464550 | |||
| 1069 | Ga0495657_0005282 | |||
| 1070 | Ga0495657_0048527 | |||
| 1071 | Ga0495657_0133210 | |||
| 1072 | Ga0495657_0187056 | |||
| 1073 | Ga0495599_0000187 | |||
| 1074 | Ga0495599_0057861 | |||
| 1075 | Ga0495599_0477213 | |||
| 1076 | Ga0495623_0000121 | |||
| 1077 | Ga0495623_0423354 | |||
| 1078 | Ga0495623_0426405 | |||
| 1079 | Ga0495623_0488043 | |||
| 1080 | Ga0495646_0017898 | |||
| 1081 | Ga0495646_0408922 | |||
| 1082 | Ga0495647_0054592 | |||
| 1083 | Ga0495647_0107947 | |||
| 1084 | Ga0495658_0056370 | |||
| 1085 | Ga0495658_0067189 | |||
| 1086 | Ga0495613_0005669 | |||
| 1087 | Ga0495613_0067674 | |||
| 1088 | Ga0495613_0203188 | |||
| 1089 | Ga0495613_0299847 | |||
| 1090 | Ga0495613_0506225 | |||
| 1091 | Ga0495624_0014162 | |||
| 1092 | Ga0495624_0049072 | |||
| 1093 | Ga0495624_0328317 | |||
| 1094 | Ga0495670_0110411 | |||
| 1095 | Ga0495589_0028301 | |||
| 1096 | Ga0495600_0053882 | |||
| 1097 | Ga0495600_0219476 | |||
| 1098 | Ga0495581_0218518 | |||
| 1099 | Ga0495604_0000628 | |||
| 1100 | Ga0495604_0109045 | |||
| 1101 | Ga0495604_0117920 | |||
| 1102 | Ga0495636_0313738 | |||
| 1103 | Ga0495674_0113555 | |||
| 1104 | Ga0495674_0292986 | |||
| 1105 | Ga0495674_0633361 | |||
| 1106 | Ga0495674_1163992 | |||
| 1107 | Ga0495676_0083226 | |||
| 1108 | Ga0495676_0172361 | |||
| 1109 | Ga0495676_0200531 | |||
| 1110 | Ga0495676_0204732 | |||
| 1111 | Ga0495676_0275704 | |||
| 1112 | Ga0495676_0521758 | |||
| 1113 | Ga0495676_0990192 | |||
| 1114 | Ga0495676_1073294 | |||
| 1115 | Ga0495680_0001674 | |||
| 1116 | Ga0495680_0002048 | |||
| 1117 | Ga0495680_0043895 | |||
| 1118 | Ga0495680_0071201 | |||
| 1119 | Ga0495680_0181349 | |||
| 1120 | Ga0495680_1007901 | |||
| 1121 | Ga0495675_0000031 | |||
| 1122 | Ga0495675_0200354 | |||
| 1123 | Ga0495675_0223747 | |||
| 1124 | Ga0495679_032728 | |||
| 1125 | Ga0495684_0032060 | |||
| 1126 | Ga0495684_0158741 | |||
| 1127 | Ga0495684_0203498 | |||
| 1128 | Ga0495684_1026873 | |||
| 1129 | Ga0495593_0107154 | |||
| 1130 | Ga0495602_0000133 | |||
| 1131 | Ga0495602_0187305 | |||
| 1132 | Ga0495602_0779631 | |||
| 1133 | Ga0495614_0125844 | |||
| 1134 | Ga0495614_0604513 | |||
| 1135 | Ga0496100_0004881 | |||
| 1136 | Ga0496100_0080894 | |||
| 1137 | Ga0496100_0179106 | |||
| 1138 | Ga0496100_0512142 | |||
| 1139 | Ga0496100_0716701 | |||
| 1140 | Ga0496101_0002611 | |||
| 1141 | Ga0496101_0004138 | |||
| 1142 | Ga0496101_0048867 | |||
| 1143 | Ga0496101_0179896 | |||
| 1144 | Ga0496101_0218680 | |||
| 1145 | Ga0496101_0242471 | |||
| 1146 | Ga0496101_1050818 | |||
| 1147 | Ga0496102_0005424 | |||
| 1148 | Ga0496102_0076014 | |||
| 1149 | Ga0496102_0396101 | |||
| 1150 | Ga0496103_0296597 | |||
| 1151 | Ga0496103_0320927 | |||
| 1152 | Ga0496104_0009726 | |||
| 1153 | Ga0496104_0089286 | |||
| 1154 | Ga0496104_0110041 | |||
| 1155 | Ga0496104_0122313 | |||
| 1156 | Ga0496104_0165850 | |||
| 1157 | Ga0496104_0261711 | |||
| 1158 | Ga0496105_0000923 | |||
| 1159 | Ga0496105_0001598 | |||
| 1160 | Ga0496105_0020322 | |||
| 1161 | Ga0496105_0028825 | |||
| 1162 | Ga0496105_0039115 | |||
| 1163 | Ga0496105_0061878 | |||
| 1164 | Ga0496105_0319160 | |||
| 1165 | Ga0496106_0003798 | |||
| 1166 | Ga0496106_0017249 | |||
| 1167 | Ga0496106_0074853 | |||
| 1168 | Ga0496106_0123596 | |||
| 1169 | Ga0496107_0003164 | |||
| 1170 | Ga0496107_0004023 | |||
| 1171 | Ga0496107_0070548 | |||
| 1172 | Ga0496107_0131274 | |||
| 1173 | Ga0496108_0001935 | |||
| 1174 | Ga0496108_0009005 | |||
| 1175 | Ga0496108_0031320 | |||
| 1176 | Ga0496108_0051123 | |||
| 1177 | Ga0496108_0184235 | |||
| 1178 | Ga0496109_0009729 | |||
| 1179 | Ga0496109_0056072 | |||
| 1180 | Ga0496109_0137633 | |||
| 1181 | Ga0496109_0182388 | |||
| 1182 | Ga0496109_0203091 | |||
| 1183 | Ga0496109_0424745 | |||
| 1184 | Ga0496109_0797366 | |||
| 1185 | Ga0496109_1439609 | |||
| 1186 | Ga0496110_0005340 | |||
| 1187 | Ga0496110_0464964 | |||
| 1188 | Ga0496110_0745888 | |||
| 1189 | Ga0496111_0019399 | |||
| 1190 | Ga0496111_0276871 | |||
| 1191 | Ga0496111_0420786 | |||
| 1192 | Ga0496112_0010065 | |||
| 1193 | Ga0496112_0035607 | |||
| 1194 | Ga0496112_0081287 | |||
| 1195 | Ga0496112_0126197 | |||
| 1196 | Ga0496112_0847350 | |||
| 1197 | Ga0496112_0864343 | |||
| 1198 | Ga0496112_1746275 | |||
| 1199 | Ga0496113_0067974 | |||
| 1200 | Ga0496113_0113480 | |||
| 1201 | Ga0496113_0312119 | |||
| 1202 | Ga0496113_0729316 | |||
| 1203 | Ga0496114_0001888 | |||
| 1204 | Ga0496114_0003560 | |||
| 1205 | Ga0496114_0036843 | |||
| 1206 | Ga0496114_0323284 | |||
| 1207 | Ga0496115_0003641 | |||
| 1208 | Ga0496115_0006847 | |||
| 1209 | Ga0496115_0022854 | |||
| 1210 | Ga0496115_0033480 | |||
| 1211 | Ga0496115_0059138 | |||
| 1212 | Ga0496115_0072734 | |||
| 1213 | Ga0496115_0161684 | |||
| 1214 | Ga0501047_0855534 | |||
| 1215 | Ga0501067_0090721 | |||
| 1216 | Ga0501067_0470328 | |||
| 1217 | Ga0501069_0051595 | |||
| 1218 | Ga0501070_0008235 | |||
| 1219 | Ga0501070_0981790 | |||
| 1220 | Ga0501072_0129203 | |||
| 1221 | Ga0501073_0007213 | |||
| 1222 | Ga0501074_0191393 | |||
| 1223 | Ga0501079_0132825 | |||
| 1224 | Ga0501080_0134498 | |||
| 1225 | Ga0501083_0001504 | |||
| 1226 | nmdc:mga0n895_9466_c1 | |||
| 1227 | nmdc:mga0rr50_1008665_c1 | |||
| 1228 | nmdc:mga0rr50_1139172_c1 | |||
| 1229 | nmdc:mga0rr50_291746_c1 | |||
| 1230 | nmdc:mga0a205_213277_c1 | |||
| 1231 | Ga0495601_0001112 | |||
| 1232 | Ga0495601_0024350 | |||
| 1233 | Ga0495601_0096030 | |||
| 1234 | Ga0495601_0173304 | |||
| 1235 | Ga0495612_0013653 | |||
| 1236 | Ga0495612_0074082 | |||
| 1237 | Ga0495612_0165677 | |||
| 1238 | Ga0495612_0530468 | |||
| 1239 | Ga0495595_0015621 | |||
| 1240 | Ga0495595_0179180 | |||
| 1241 | Ga0495595_0341208 | |||
| 1242 | Ga0495595_0416983 | |||
| 1243 | Ga0495595_0508818 | |||
| 1244 | Ga0495619_0001848 | |||
| 1245 | Ga0495619_0067227 | |||
| 1246 | Ga0495619_0141845 | |||
| 1247 | Ga0495619_0256881 | |||
| 1248 | Ga0495619_0273576 | |||
| 1249 | Ga0495619_0644951 | |||
| 1250 | Ga0495619_0846356 | |||
| 1251 | Ga0466962_0006426 | |||
| 1252 | Ga0466962_0013053 | |||
| 1253 | Ga0466962_0040044 | |||
| 1254 | Ga0466962_0108844 | |||
| 1255 | Ga0466962_0119796 | |||
| 1256 | Ga0466962_0172052 | |||
| 1257 | Ga0466962_0175269 | |||
| 1258 | Ga0466962_0306313 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rb6-assembly3.cif.gz_B-2 | x-ray structure of the protein q8ei81. northeast structural genomics consortium target sor78a | 0.7146 | 35 | 90 |
| 3fif-assembly8.cif.gz_H | crystal structure of the ygdr protein from e.coli. northeast structural genomics target er382a. | 0.7077 | 35 | 90 |
| 2k57-assembly1.cif.gz_A | solution nmr structure of putative lipoprotein from pseudomonas syringae gene locus pspto2350. northeast structural genomics target psr76a. | 0.7052 | 36 | 89 |
| 5cai-assembly1.cif.gz_A | crystal structure of a putative lipoprotein from the duf903 family (kpn_03160) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.30 a resolution | 0.7013 | 35 | 89 |
| 6mgh-assembly2.cif.gz_B | x-ray structure of monomeric near-infrared fluorescent protein mirfp670nano | 0.687 | 17 | 50 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6mghD00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7258 | 15 | 49 | 3.30.450.40 |
| 2k57A00 | Mainly Beta;Roll;SH3 type barrels.; | 0.7052 | 36 | 89 | 2.30.30.100 |
| af_P9WH17_92_157_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.6828 | 36 | 90 | 2.30.30.100 |
| 5caiC00 | Mainly Beta;Roll;SH3 type barrels.; | 0.6764 | 38 | 88 | 2.30.30.100 |
| 2rd1C00 | Mainly Beta;Roll;SH3 type barrels.; | 0.6741 | 37 | 90 | 2.30.30.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A518D7W5-F1-model_v4 | Uncharacterized protein | 0.8734 | 37 | 88 |
|
| AF-A0A538E564-F1-model_v4 | Uncharacterized protein | 0.8656 | 15 | 105 |
|
| AF-A0A538E564-F1-model_v4 | Uncharacterized protein | 0.8227 | 15 | 105 |
|
| AF-A0A7V9FY00-F1-model_v4 | Uncharacterized protein | 0.8037 | 8 | 107 |
|
| AF-A0A1A9NM06-F1-model_v4 | Uncharacterized protein | 0.7858 | 16 | 89 |
|