F470765

General Info

Members Datasets Scaffolds Average Seq Length
629 248 1258 107

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0001933|Ga0466963_0001933_5896_6234
Length 112
Sequence VSDGVPELWTPVAEMPHEAFVERLHRAIASFAEAAGVAKPLVEVELADTSRFVLERIDPEPGFGMVTLYVTDARDDAPDALIVPIGSLRRIELSKAPEERVQRFGFSVPPAT

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
106 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
107 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
128 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.56
Rhizosphere 87.44
Stem 0
Stem Tuber 0
Unclassified 11.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0001933 3300044694 Bacteria 11347
2 Ga0070658_10160868 3300005327 Bacteria 1883
3 Ga0070683_100240301 3300005329 Bacteria 1722
4 Ga0070683_101242637 3300005329 Bacteria 716
5 Ga0070680_100469154 3300005336 Bacteria 1076
6 Ga0070682_100050938 3300005337 Bacteria 2587
7 Ga0070682_100415726 3300005337 Unclassified 1021
8 Ga0068868_102111326 3300005338 Bacteria 536
9 Ga0070660_100067598 3300005339 Bacteria 2784
10 Ga0070660_100121845 3300005339 Bacteria 2081
11 Ga0070660_101644130 3300005339 Bacteria 547
12 Ga0070661_101146179 3300005344 Unclassified 649
13 Ga0070671_100029890 3300005355 Bacteria 4495
14 Ga0070671_100105915 3300005355 Unclassified 2360
15 Ga0070673_101699706 3300005364 Bacteria 597
16 Ga0070659_100732517 3300005366 Bacteria 857
17 Ga0070709_10003918 3300005434 Bacteria 8026
18 Ga0070709_10955568 3300005434 Bacteria 680
19 Ga0070714_100034648 3300005435 Bacteria 4228
20 Ga0070714_100072777 3300005435 Bacteria 2976
21 Ga0070714_100285161 3300005435 Bacteria 1535
22 Ga0070714_100679293 3300005435 Bacteria 993
23 Ga0070714_101551825 3300005435 Unclassified 647
24 Ga0070714_101775040 3300005435 Bacteria 602
25 Ga0070714_102119860 3300005435 Bacteria 548
26 Ga0070713_100034841 3300005436 Bacteria 4049
27 Ga0070713_100178910 3300005436 Bacteria 1905
28 Ga0070713_100811008 3300005436 Bacteria 897
29 Ga0070710_10002373 3300005437 Bacteria 8916
30 Ga0070710_10041104 3300005437 Bacteria 2550
31 Ga0070711_100025521 3300005439 Bacteria 3867
32 Ga0070711_100076539 3300005439 Bacteria 2372
33 Ga0070711_100250950 3300005439 Bacteria 1388
34 Ga0070705_101026520 3300005440 Unclassified 671
35 Ga0070694_100160343 3300005444 Unclassified 1650
36 Ga0070694_100554032 3300005444 Bacteria 921
37 Ga0070708_100226279 3300005445 Bacteria 1755
38 Ga0070678_100497376 3300005456 Bacteria 1075
39 Ga0070678_101571680 3300005456 Bacteria 617
40 Ga0070662_101280012 3300005457 Bacteria 631
41 Ga0070706_100751915 3300005467 Bacteria 903
42 Ga0070707_100000419 3300005468 Bacteria 41972
43 Ga0070707_100212793 3300005468 Bacteria 1884
44 Ga0070707_102318418 3300005468 Unclassified 504
45 Ga0070679_100079637 3300005530 Bacteria 3265
46 Ga0070679_100735202 3300005530 Bacteria 930
47 Ga0070684_100049801 3300005535 Bacteria 3637
48 Ga0070684_100141021 3300005535 Bacteria 2180
49 Ga0070686_100146523 3300005544 Bacteria 1649
50 Ga0070695_100015857 3300005545 Bacteria 4553
51 Ga0070695_100321633 3300005545 Bacteria 1150
52 Ga0070693_100681537 3300005547 Bacteria 751
53 Ga0070693_100695597 3300005547 Bacteria 744
54 Ga0070704_100133834 3300005549 Bacteria 1926
55 Ga0068855_100477196 3300005563 Bacteria 1358
56 Ga0068855_100482832 3300005563 Bacteria 1349
57 Ga0068855_100761798 3300005563 Bacteria 1031
58 Ga0068855_102428674 3300005563 Bacteria 523
59 Ga0070664_100575470 3300005564 Bacteria 1043
60 Ga0068857_100121899 3300005577 Unclassified 2348
61 Ga0068856_100219354 3300005614 Bacteria 1917
62 Ga0068856_100535237 3300005614 Bacteria 1193
63 Ga0068856_100845957 3300005614 Bacteria 934
64 Ga0068852_100249827 3300005616 Bacteria 1699
65 Ga0068863_100717687 3300005841 Bacteria 994
66 Ga0070717_10010680 3300006028 Bacteria 6943
67 Ga0070717_10024344 3300006028 Bacteria 4806
68 Ga0070717_10026448 3300006028 Bacteria 4628
69 Ga0070717_10150946 3300006028 Bacteria 2010
70 Ga0070717_10906574 3300006028 Unclassified 802
71 Ga0070715_10016586 3300006163 Bacteria 2770
72 Ga0070716_100015994 3300006173 Bacteria 3866
73 Ga0070712_100062466 3300006175 Unclassified 2634
74 Ga0070712_100223954 3300006175 Bacteria 1490
75 Ga0070712_100302762 3300006175 Bacteria 1294
76 Ga0070712_101569541 3300006175 Unclassified 576
77 Ga0097621_100096707 3300006237 Unclassified 2478
78 Ga0075431_100857839 3300006847 Bacteria 879
79 Ga0075433_11911313 3300006852 Bacteria 509
80 Ga0075434_100013149 3300006871 Bacteria 7862
81 Ga0068865_100726458 3300006881 Bacteria 851
82 Ga0075435_100180144 3300007076 Bacteria 1786
83 Ga0075435_100199825 3300007076 Bacteria 1694
84 Ga0075435_101100975 3300007076 Bacteria 694
85 Ga0105240_11124695 3300009093 Bacteria 835
86 Ga0105245_10083785 3300009098 Bacteria 2919
87 Ga0105243_10880831 3300009148 Bacteria 889
88 Ga0105241_10836707 3300009174 Unclassified 850
89 Ga0105237_10696417 3300009545 Bacteria 1023
90 Ga0105238_11724750 3300009551 Bacteria 658
91 Ga0105238_12484137 3300009551 Bacteria 554
92 Ga0105239_10371441 3300010375 Bacteria 1616
93 Ga0105239_12309279 3300010375 Unclassified 626
94 Ga0157373_10219222 3300013100 Bacteria 1342
95 Ga0157370_10041650 3300013104 Bacteria 4428
96 Ga0157369_10077018 3300013105 Bacteria 3574
97 Ga0157369_10404359 3300013105 Bacteria 1416
98 Ga0157374_10456614 3300013296 Bacteria 1279
99 Ga0157374_10817392 3300013296 Bacteria 948
100 Ga0157374_10954345 3300013296 Unclassified 876
101 Ga0163162_10015311 3300013306 Bacteria 7491
102 Ga0157372_10993016 3300013307 Bacteria 972
103 Ga0157375_10731748 3300013308 Bacteria 1141
104 Ga0182008_10112202 3300014497 Bacteria 1351
105 Ga0157377_10314726 3300014745 Bacteria 1038
106 Ga0157376_10087794 3300014969 Bacteria 2685
107 Ga0197907_10103166 3300020069 Bacteria 853
108 Ga0197907_10367872 3300020069 Bacteria 522
109 Ga0206356_10250408 3300020070 Bacteria 1883
110 Ga0206354_10401512 3300020081 Bacteria 765
111 Ga0224712_10088133 3300022467 Bacteria 1295
112 Ga0207692_10033296 3300025898 Bacteria 2484
113 Ga0207692_10038360 3300025898 Bacteria 2349
114 Ga0207692_10062054 3300025898 Bacteria 1939
115 Ga0207710_10398657 3300025900 Unclassified 706
116 Ga0207685_10004970 3300025905 Bacteria 3451
117 Ga0207699_10027077 3300025906 Bacteria 3169
118 Ga0207699_10040944 3300025906 Bacteria 2672
119 Ga0207705_10070912 3300025909 Bacteria 2526
120 Ga0207705_10195649 3300025909 Bacteria 1530
121 Ga0207654_10937404 3300025911 Archaea 628
122 Ga0207707_10120844 3300025912 Bacteria 2290
123 Ga0207707_10349269 3300025912 Bacteria 1274
124 Ga0207695_10099536 3300025913 Bacteria 2905
125 Ga0207671_10078168 3300025914 Unclassified 2478
126 Ga0207693_10011542 3300025915 Bacteria 7144
127 Ga0207693_10028873 3300025915 Bacteria 4384
128 Ga0207693_10661577 3300025915 Bacteria 811
129 Ga0207663_10007689 3300025916 Bacteria 5605
130 Ga0207663_10258699 3300025916 Unclassified 1284
131 Ga0207660_10142593 3300025917 Bacteria 1833
132 Ga0207657_10007057 3300025919 Bacteria 11541
133 Ga0207657_10088248 3300025919 Bacteria 2593
134 Ga0207657_10234632 3300025919 Bacteria 1466
135 Ga0207652_10088960 3300025921 Bacteria 2710
136 Ga0207652_10489970 3300025921 Bacteria 1107
137 Ga0207646_10003186 3300025922 Bacteria 18746
138 Ga0207646_10910805 3300025922 Unclassified 780
139 Ga0207646_11314721 3300025922 Bacteria 631
140 Ga0207694_10082151 3300025924 Bacteria 2532
141 Ga0207687_10466119 3300025927 Bacteria 1050
142 Ga0207700_10113164 3300025928 Bacteria 2188
143 Ga0207700_10505556 3300025928 Unclassified 1070
144 Ga0207700_10616444 3300025928 Unclassified 966
145 Ga0207664_10024083 3300025929 Bacteria 4571
146 Ga0207664_10035398 3300025929 Bacteria 3852
147 Ga0207664_10043236 3300025929 Bacteria 3522
148 Ga0207664_10129302 3300025929 Bacteria 2124
149 Ga0207664_10153151 3300025929 Bacteria 1960
150 Ga0207664_10495680 3300025929 Bacteria 1093
151 Ga0207644_10083537 3300025931 Unclassified 2365
152 Ga0207644_10115018 3300025931 Bacteria 2040
153 Ga0207644_10185952 3300025931 Unclassified 1631
154 Ga0207644_10237836 3300025931 Bacteria 1449
155 Ga0207690_10105277 3300025932 Bacteria 2023
156 Ga0207690_10635464 3300025932 Bacteria 874
157 Ga0207706_10337298 3300025933 Bacteria 1311
158 Ga0207709_11602104 3300025935 Bacteria 541
159 Ga0207704_10550059 3300025938 Bacteria 938
160 Ga0207665_10009328 3300025939 Bacteria 6439
161 Ga0207665_10035443 3300025939 Bacteria 3312
162 Ga0207679_10111311 3300025945 Unclassified 2161
163 Ga0207667_10292677 3300025949 Unclassified 1664
164 Ga0207667_10589658 3300025949 Bacteria 1122
165 Ga0207677_11703656 3300026023 Bacteria 584
166 Ga0207703_11615463 3300026035 Bacteria 624
167 Ga0207702_10624603 3300026078 Bacteria 1058
168 Ga0207702_10786994 3300026078 Bacteria 940
169 Ga0207702_11063090 3300026078 Unclassified 803
170 Ga0207641_11324492 3300026088 Unclassified 721
171 Ga0207674_10915260 3300026116 Unclassified 845
172 Ga0207683_11068341 3300026121 Bacteria 749
173 Ga0207683_11294639 3300026121 Unclassified 675
174 Ga0265337_1208617 3300028556 Bacteria 531
175 Ga0265326_10005975 3300028558 Bacteria 3810
176 Ga0265319_1014709 3300028563 Bacteria 3060
177 Ga0265319_1055604 3300028563 Bacteria 1295
178 Ga0265334_10024806 3300028573 Bacteria 2429
179 Ga0265318_10004275 3300028577 Bacteria 6960
180 Ga0265323_10232999 3300028653 Bacteria 575
181 Ga0265322_10058301 3300028654 Bacteria 1095
182 Ga0265336_10004174 3300028666 Bacteria 5500
183 Ga0265336_10245802 3300028666 Unclassified 531
184 Ga0265338_10001177 3300028800 Bacteria 43159
185 Ga0265338_10004797 3300028800 Bacteria 18070
186 Ga0265338_10018501 3300028800 Bacteria 7456
187 Ga0265338_10021008 3300028800 Bacteria 6829
188 Ga0265338_10033213 3300028800 Bacteria 5012
189 Ga0265330_10027575 3300031235 Bacteria 2565
190 Ga0265332_10004042 3300031238 Bacteria 6972
191 Ga0265328_10002766 3300031239 Bacteria 7856
192 Ga0265320_10058020 3300031240 Bacteria 1854
193 Ga0265325_10000684 3300031241 Bacteria 24693
194 Ga0265329_10022282 3300031242 Bacteria 2120
195 Ga0265339_10012718 3300031249 Bacteria 5122
196 Ga0265339_10061265 3300031249 Bacteria 2025
197 Ga0265331_10156067 3300031250 Bacteria 1035
198 Ga0265327_10027268 3300031251 Bacteria 3291
199 Ga0265327_10124791 3300031251 Bacteria 1216
200 Ga0265327_10199208 3300031251 Bacteria 907
201 Ga0265327_10298724 3300031251 Bacteria 709
202 Ga0265316_10016433 3300031344 Bacteria 6418
203 Ga0265313_10020060 3300031595 Bacteria 3699
204 Ga0265313_10035236 3300031595 Bacteria 2523
205 Ga0265314_10122407 3300031711 Bacteria 1635
206 Ga0265342_10017636 3300031712 Bacteria 4639
207 Ga0316583_10050612 3300032133 Bacteria 1462
208 Ga0373959_0188718 3300034820 Unclassified 539
209 Ga0373936_0182168 3300035113 Bacteria 922
210 Ga0373953_0200969 3300035117 Bacteria 862
211 Ga0373954_0310542 3300035118 Bacteria 778
212 Ga0373956_0438553 3300035119 Bacteria 623
213 Ga0373956_0604195 3300035119 Bacteria 524
214 Ga0373957_0196029 3300035120 Unclassified 841
215 Ga0373957_0397865 3300035120 Bacteria 592
216 Ga0373943_0022641 3300035170 Bacteria 2914
217 Ga0373955_0597776 3300035172 Bacteria 676
218 Ga0373962_0090696 3300035242 Unclassified 941
219 Ga0373924_0121002 3300035410 Bacteria 1136
220 Ga0373924_0172495 3300035410 Bacteria 951
221 Ga0373931_0252441 3300035691 Bacteria 1073
222 Ga0373933_0069698 3300035724 Bacteria 2138
223 Ga0373933_0106457 3300035724 Bacteria 1745
224 Ga0373933_0525665 3300035724 Bacteria 776
225 Ga0373933_0731832 3300035724 Bacteria 651
226 Ga0373937_0000355 3300036401 Bacteria 42585
227 Ga0373937_0039968 3300036401 Bacteria 4275
228 Ga0373937_0091047 3300036401 Bacteria 2826
229 Ga0373937_0876014 3300036401 Unclassified 847
230 Ga0373925_1253700 3300037068 Bacteria 609
231 Ga0395899_0246701 3300037312 Bacteria 1227
232 Ga0395899_0626434 3300037312 Bacteria 682
233 Ga0395900_0059737 3300037418 Bacteria 3925
234 Ga0395900_1289561 3300037418 Unclassified 644
235 Ga0395898_0053278 3300037466 Bacteria 3951
236 Ga0395898_0200307 3300037466 Bacteria 1906
237 Ga0395898_0814911 3300037466 Bacteria 873
238 Ga0395898_0820830 3300037466 Bacteria 870
239 Ga0395898_0872146 3300037466 Bacteria 839
240 Ga0395905_1045266 3300037471 Bacteria 720
241 Ga0395901_0142909 3300038443 Bacteria 2515
242 Ga0395901_0147006 3300038443 Bacteria 2477
243 Ga0395901_0343709 3300038443 Bacteria 1541
244 Ga0395901_1575466 3300038443 Bacteria 611
245 Ga0436360_0128350 3300039438 Bacteria 9271
246 Ga0466969_0003132 3300044656 Bacteria 8811
247 Ga0466969_0027410 3300044656 Bacteria 2917
248 Ga0466969_0461545 3300044656 Unclassified 578
249 Ga0466965_0236559 3300044683 Unclassified 977
250 Ga0466965_0339470 3300044683 Bacteria 821
251 Ga0466965_0404816 3300044683 Bacteria 754
252 Ga0466966_0003367 3300044684 Bacteria 10543
253 Ga0466966_0040111 3300044684 Bacteria 3013
254 Ga0466966_0053060 3300044684 Bacteria 2573
255 Ga0466966_0069423 3300044684 Bacteria 2211
256 Ga0466966_0393229 3300044684 Bacteria 833
257 Ga0466966_0859688 3300044684 Bacteria 547
258 Ga0466961_0008344 3300044693 Bacteria 6595
259 Ga0466961_0030240 3300044693 Bacteria 3480
260 Ga0466961_0084053 3300044693 Bacteria 2013
261 Ga0466961_0104670 3300044693 Bacteria 1782
262 Ga0466961_0110660 3300044693 Bacteria 1728
263 Ga0466961_0285096 3300044693 Bacteria 1010
264 Ga0466963_0000670 3300044694 Bacteria 16566
265 Ga0466963_0001565 3300044694 Bacteria 12405
266 Ga0466963_0006848 3300044694 Bacteria 6780
267 Ga0466963_0008535 3300044694 Bacteria 6148
268 Ga0466963_0030930 3300044694 Bacteria 3457
269 Ga0466963_0031901 3300044694 Bacteria 3407
270 Ga0466963_0058286 3300044694 Bacteria 2574
271 Ga0466963_0069923 3300044694 Bacteria 2360
272 Ga0466963_0141205 3300044694 Bacteria 1668
273 Ga0466963_0160354 3300044694 Bacteria 1565
274 Ga0466963_0190001 3300044694 Bacteria 1435
275 Ga0466963_0308726 3300044694 Bacteria 1113
276 Ga0466963_0339963 3300044694 Unclassified 1057
277 Ga0466963_0492479 3300044694 Bacteria 865
278 Ga0466963_0531406 3300044694 Unclassified 830
279 Ga0466964_0010906 3300044706 Bacteria 3433
280 Ga0466964_0013113 3300044706 Bacteria 3142
281 Ga0466964_0020749 3300044706 Bacteria 2533
282 Ga0466964_0029674 3300044706 Bacteria 2160
283 Ga0466964_0044673 3300044706 Bacteria 1800
284 Ga0466964_0047383 3300044706 Bacteria 1754
285 Ga0466964_0048272 3300044706 Bacteria 1740
286 Ga0466964_0108866 3300044706 Bacteria 1233
287 Ga0466971_0009152 3300044719 Bacteria 4331
288 Ga0466971_0017291 3300044719 Bacteria 3189
289 Ga0466971_0021103 3300044719 Bacteria 2897
290 Ga0466971_0031917 3300044719 Bacteria 2359
291 Ga0466971_0129238 3300044719 Bacteria 1172
292 Ga0466971_0153577 3300044719 Bacteria 1075
293 Ga0466971_0208203 3300044719 Bacteria 924
294 Ga0466968_0002132 3300044735 Bacteria 7206
295 Ga0466968_0027952 3300044735 Bacteria 2323
296 Ga0466968_0119552 3300044735 Bacteria 1191
297 Ga0466968_0370845 3300044735 Bacteria 698
298 Ga0466968_0417674 3300044735 Bacteria 659
299 Ga0466968_0451705 3300044735 Bacteria 635
300 Ga0466970_0149575 3300044765 Unclassified 1289
301 Ga0466970_0903060 3300044765 Bacteria 519
302 Ga0466957_0006041 3300044842 Bacteria 6835
303 Ga0466957_0052993 3300044842 Bacteria 2472
304 Ga0466957_0053228 3300044842 Bacteria 2467
305 Ga0466957_0058781 3300044842 Bacteria 2355
306 Ga0466957_0126387 3300044842 Bacteria 1634
307 Ga0466957_0209301 3300044842 Bacteria 1283
308 Ga0466957_0244618 3300044842 Bacteria 1191
309 Ga0466957_0484861 3300044842 Unclassified 855
310 Ga0466957_0667383 3300044842 Bacteria 732
311 Ga0466957_1050814 3300044842 Bacteria 586
312 Ga0466957_1267593 3300044842 Bacteria 534
313 Ga0466960_0033619 3300044901 Bacteria 2384
314 Ga0466960_0033826 3300044901 Bacteria 2378
315 Ga0466960_0783164 3300044901 Unclassified 576
316 Ga0466960_0862359 3300044901 Archaea 551
317 Ga0466960_0920806 3300044901 Bacteria 534
318 Ga0466959_0013342 3300045049 Bacteria 5956
319 Ga0466959_0021777 3300045049 Bacteria 4731
320 Ga0466959_0033703 3300045049 Bacteria 3787
321 Ga0466959_0044436 3300045049 Bacteria 3273
322 Ga0466959_0536804 3300045049 Bacteria 789
323 Ga0466959_0864681 3300045049 Bacteria 603
324 Ga0466958_0003106 3300045836 Bacteria 8528
325 Ga0466958_0007030 3300045836 Bacteria 6157
326 Ga0466958_0018533 3300045836 Bacteria 4041
327 Ga0466958_0021374 3300045836 Bacteria 3780
328 Ga0466958_0028148 3300045836 Bacteria 3330
329 Ga0466958_0054158 3300045836 Unclassified 2433
330 Ga0466958_0059463 3300045836 Bacteria 2325
331 Ga0466958_0077480 3300045836 Bacteria 2041
332 Ga0466958_0193055 3300045836 Bacteria 1294
333 Ga0466958_0230631 3300045836 Bacteria 1182
334 Ga0466958_0303952 3300045836 Bacteria 1024
335 Ga0466958_0436780 3300045836 Bacteria 847
336 Ga0466967_0000173 3300045976 Bacteria 26504
337 Ga0466967_0012563 3300045976 Bacteria 6486
338 Ga0466967_0018176 3300045976 Bacteria 5610
339 Ga0466967_0023676 3300045976 Bacteria 5036
340 Ga0466967_0027634 3300045976 Bacteria 4722
341 Ga0466967_0035273 3300045976 Bacteria 4255
342 Ga0466967_0035961 3300045976 Bacteria 4223
343 Ga0466967_0058650 3300045976 Bacteria 3403
344 Ga0466967_0070089 3300045976 Bacteria 3135
345 Ga0466967_0077176 3300045976 Unclassified 2998
346 Ga0466967_0161374 3300045976 Bacteria 2104
347 Ga0466967_0163118 3300045976 Bacteria 2093
348 Ga0466967_0176867 3300045976 Bacteria 2010
349 Ga0466967_0228161 3300045976 Bacteria 1772
350 Ga0466967_0459134 3300045976 Bacteria 1246
351 Ga0466967_0564218 3300045976 Bacteria 1121
352 Ga0466967_0921036 3300045976 Bacteria 869
353 Ga0466967_1446623 3300045976 Unclassified 684
354 Ga0495592_0000635 3300046454 Bacteria 24391
355 Ga0495592_0000769 3300046454 Bacteria 22286
356 Ga0495592_0212123 3300046454 Bacteria 1299
357 Ga0495592_0261950 3300046454 Unclassified 1138
358 Ga0495592_0668919 3300046454 Unclassified 627
359 Ga0495603_0024562 3300046455 Bacteria 3646
360 Ga0495603_0246247 3300046455 Bacteria 1029
361 Ga0495603_0313105 3300046455 Bacteria 901
362 Ga0495629_0176525 3300046459 Bacteria 1481
363 Ga0495629_0198162 3300046459 Bacteria 1389
364 Ga0495629_0338494 3300046459 Bacteria 1027
365 Ga0495641_0015557 3300046461 Bacteria 4053
366 Ga0495641_0053659 3300046461 Bacteria 1833
367 Ga0495641_0094935 3300046461 Bacteria 1332
368 Ga0495641_0107129 3300046461 Bacteria 1247
369 Ga0495641_0542659 3300046461 Bacteria 531
370 Ga0495651_0000029 3300046462 Bacteria 105042
371 Ga0495651_0107030 3300046462 Bacteria 2072
372 Ga0495651_0183063 3300046462 Bacteria 1481
373 Ga0495653_0003221 3300046463 Bacteria 13077
374 Ga0495653_0047046 3300046463 Bacteria 3338
375 Ga0495653_0088200 3300046463 Bacteria 2276
376 Ga0495653_0127755 3300046463 Bacteria 1803
377 Ga0495653_0166497 3300046463 Bacteria 1525
378 Ga0495580_0361154 3300046472 Bacteria 983
379 Ga0495580_0992380 3300046472 Bacteria 536
380 Ga0495582_0153713 3300046473 Unclassified 1307
381 Ga0495605_0027320 3300046474 Bacteria 2958
382 Ga0495639_0367711 3300046475 Bacteria 724
383 Ga0495662_0039012 3300046476 Bacteria 2295
384 Ga0495664_0129784 3300046477 Unclassified 1526
385 Ga0495664_0410674 3300046477 Bacteria 812
386 Ga0495664_0498022 3300046477 Bacteria 728
387 Ga0495584_0089259 3300046491 Bacteria 1554
388 Ga0495585_0174450 3300046492 Bacteria 1108
389 Ga0495607_0068048 3300046501 Bacteria 1999
390 Ga0495608_0004327 3300046511 Bacteria 10173
391 Ga0495608_0030165 3300046511 Bacteria 3674
392 Ga0495608_0088328 3300046511 Bacteria 2007
393 Ga0495608_0116914 3300046511 Bacteria 1711
394 Ga0495608_0533349 3300046511 Bacteria 708
395 Ga0495608_0589637 3300046511 Bacteria 668
396 Ga0495608_0602121 3300046511 Unclassified 659
397 Ga0495618_0001935 3300046514 Bacteria 13569
398 Ga0495618_0436659 3300046514 Bacteria 796
399 Ga0495618_0777389 3300046514 Unclassified 559
400 Ga0495628_0000016 3300046516 Bacteria 170260
401 Ga0495628_0073325 3300046516 Bacteria 2667
402 Ga0495630_0020297 3300046517 Bacteria 4899
403 Ga0495630_0045205 3300046517 Bacteria 3290
404 Ga0495630_0160740 3300046517 Bacteria 1710
405 Ga0495630_0410867 3300046517 Bacteria 1037
406 Ga0495630_0733101 3300046517 Bacteria 756
407 Ga0495630_1525266 3300046517 Bacteria 501
408 Ga0495637_0243925 3300046520 Unclassified 648
409 Ga0495644_0043806 3300046523 Bacteria 1683
410 Ga0495652_0001228 3300046529 Bacteria 28728
411 Ga0495652_0037452 3300046529 Bacteria 4208
412 Ga0495652_0420550 3300046529 Bacteria 942
413 Ga0495652_0935319 3300046529 Bacteria 570
414 Ga0495665_0501105 3300046531 Unclassified 612
415 Ga0495640_0060035 3300046533 Bacteria 2587
416 Ga0495640_0418793 3300046533 Bacteria 821
417 Ga0495640_0495076 3300046533 Bacteria 744
418 Ga0495586_0255403 3300046535 Bacteria 1000
419 Ga0495586_0535742 3300046535 Unclassified 676
420 Ga0495587_0000434 3300046536 Bacteria 29352
421 Ga0495587_0095724 3300046536 Bacteria 1713
422 Ga0495587_0827391 3300046536 Bacteria 505
423 Ga0495598_0084750 3300046537 Bacteria 1023
424 Ga0495645_0000367 3300046543 Bacteria 31425
425 Ga0495645_0136597 3300046543 Bacteria 1714
426 Ga0495667_0045691 3300046559 Bacteria 2898
427 Ga0495667_0062037 3300046559 Bacteria 2450
428 Ga0495667_0064138 3300046559 Unclassified 2403
429 Ga0495667_0111279 3300046559 Bacteria 1769
430 Ga0495656_0001482 3300046615 Bacteria 7677
431 Ga0495668_0121227 3300046616 Bacteria 1431
432 Ga0495634_0147067 3300046642 Bacteria 1492
433 Ga0495634_0450340 3300046642 Unclassified 759
434 Ga0495635_0047562 3300046663 Bacteria 2958
435 Ga0495635_0086776 3300046663 Bacteria 2141
436 Ga0495635_0223212 3300046663 Bacteria 1274
437 Ga0495659_0056016 3300046664 Bacteria 1446
438 Ga0495661_0194469 3300046665 Bacteria 1066
439 Ga0495588_0464550 3300046674 Bacteria 664
440 Ga0495657_0005282 3300046675 Bacteria 10223
441 Ga0495657_0048527 3300046675 Bacteria 2863
442 Ga0495657_0133210 3300046675 Bacteria 1555
443 Ga0495657_0187056 3300046675 Bacteria 1267
444 Ga0495599_0000187 3300046678 Bacteria 40807
445 Ga0495599_0057861 3300046678 Bacteria 2425
446 Ga0495599_0477213 3300046678 Bacteria 736
447 Ga0495623_0000121 3300046679 Bacteria 47882
448 Ga0495623_0423354 3300046679 Bacteria 713
449 Ga0495623_0426405 3300046679 Bacteria 710
450 Ga0495623_0488043 3300046679 Bacteria 652
451 Ga0495646_0017898 3300046680 Bacteria 4489
452 Ga0495646_0408922 3300046680 Bacteria 705
453 Ga0495647_0054592 3300046681 Bacteria 1562
454 Ga0495647_0107947 3300046681 Bacteria 1159
455 Ga0495658_0056370 3300046683 Bacteria 2241
456 Ga0495658_0067189 3300046683 Bacteria 2073
457 Ga0495613_0005669 3300046689 Bacteria 9354
458 Ga0495613_0067674 3300046689 Bacteria 2607
459 Ga0495613_0203188 3300046689 Bacteria 1396
460 Ga0495613_0299847 3300046689 Bacteria 1113
461 Ga0495613_0506225 3300046689 Bacteria 813
462 Ga0495624_0014162 3300046690 Bacteria 5421
463 Ga0495624_0049072 3300046690 Bacteria 2677
464 Ga0495624_0328317 3300046690 Bacteria 921
465 Ga0495670_0110411 3300046691 Bacteria 1422
466 Ga0495589_0028301 3300046794 Bacteria 2829
467 Ga0495600_0053882 3300046809 Bacteria 2627
468 Ga0495600_0219476 3300046809 Bacteria 1216
469 Ga0495581_0218518 3300047315 Bacteria 1114
470 Ga0495604_0000628 3300047317 Bacteria 30365
471 Ga0495604_0109045 3300047317 Bacteria 2021
472 Ga0495604_0117920 3300047317 Bacteria 1925
473 Ga0495636_0313738 3300047318 Bacteria 735
474 Ga0495674_0113555 3300047319 Bacteria 2294
475 Ga0495674_0292986 3300047319 Bacteria 1330
476 Ga0495674_0633361 3300047319 Bacteria 844
477 Ga0495674_1163992 3300047319 Bacteria 584
478 Ga0495676_0083226 3300047321 Bacteria 2419
479 Ga0495676_0172361 3300047321 Unclassified 1522
480 Ga0495676_0200531 3300047321 Bacteria 1387
481 Ga0495676_0204732 3300047321 Bacteria 1369
482 Ga0495676_0275704 3300047321 Bacteria 1140
483 Ga0495676_0521758 3300047321 Bacteria 778
484 Ga0495676_0990192 3300047321 Bacteria 537
485 Ga0495676_1073294 3300047321 Unclassified 512
486 Ga0495680_0001674 3300047322 Bacteria 23560
487 Ga0495680_0002048 3300047322 Bacteria 21061
488 Ga0495680_0043895 3300047322 Bacteria 3537
489 Ga0495680_0071201 3300047322 Bacteria 2648
490 Ga0495680_0181349 3300047322 Bacteria 1520
491 Ga0495680_1007901 3300047322 Unclassified 532
492 Ga0495675_0000031 3300047444 Bacteria 99240
493 Ga0495675_0200354 3300047444 Bacteria 1215
494 Ga0495675_0223747 3300047444 Bacteria 1138
495 Ga0495679_032728 3300047446 Bacteria 1665
496 Ga0495684_0032060 3300047471 Bacteria 4033
497 Ga0495684_0158741 3300047471 Bacteria 1688
498 Ga0495684_0203498 3300047471 Bacteria 1458
499 Ga0495684_1026873 3300047471 Unclassified 522
500 Ga0495593_0107154 3300047673 Bacteria 1429
501 Ga0495602_0000133 3300048088 Bacteria 69392
502 Ga0495602_0187305 3300048088 Bacteria 1590
503 Ga0495602_0779631 3300048088 Bacteria 643
504 Ga0495614_0125844 3300048089 Unclassified 1132
505 Ga0495614_0604513 3300048089 Unclassified 527
506 Ga0496100_0004881 3300048903 Bacteria 7168
507 Ga0496100_0080894 3300048903 Bacteria 2193
508 Ga0496100_0179106 3300048903 Bacteria 1532
509 Ga0496100_0512142 3300048903 Bacteria 925
510 Ga0496100_0716701 3300048903 Unclassified 781
511 Ga0496101_0002611 3300048904 Bacteria 11068
512 Ga0496101_0004138 3300048904 Bacteria 9083
513 Ga0496101_0048867 3300048904 Bacteria 3041
514 Ga0496101_0179896 3300048904 Bacteria 1628
515 Ga0496101_0218680 3300048904 Bacteria 1478
516 Ga0496101_0242471 3300048904 Bacteria 1403
517 Ga0496101_1050818 3300048904 Bacteria 640
518 Ga0496102_0005424 3300048905 Bacteria 10820
519 Ga0496102_0076014 3300048905 Bacteria 3088
520 Ga0496102_0396101 3300048905 Unclassified 1298
521 Ga0496103_0296597 3300048906 Bacteria 1040
522 Ga0496103_0320927 3300048906 Unclassified 996
523 Ga0496104_0009726 3300048907 Bacteria 8571
524 Ga0496104_0089286 3300048907 Bacteria 2944
525 Ga0496104_0110041 3300048907 Bacteria 2640
526 Ga0496104_0122313 3300048907 Bacteria 2499
527 Ga0496104_0165850 3300048907 Bacteria 2118
528 Ga0496104_0261711 3300048907 Bacteria 1642
529 Ga0496105_0000923 3300048908 Bacteria 20034
530 Ga0496105_0001598 3300048908 Bacteria 16044
531 Ga0496105_0020322 3300048908 Bacteria 5365
532 Ga0496105_0028825 3300048908 Bacteria 4541
533 Ga0496105_0039115 3300048908 Bacteria 3908
534 Ga0496105_0061878 3300048908 Bacteria 3089
535 Ga0496105_0319160 3300048908 Bacteria 1245
536 Ga0496106_0003798 3300048909 Bacteria 11253
537 Ga0496106_0017249 3300048909 Bacteria 5344
538 Ga0496106_0074853 3300048909 Bacteria 2593
539 Ga0496106_0123596 3300048909 Bacteria 2025
540 Ga0496107_0003164 3300048910 Bacteria 10940
541 Ga0496107_0004023 3300048910 Bacteria 9901
542 Ga0496107_0070548 3300048910 Bacteria 2537
543 Ga0496107_0131274 3300048910 Bacteria 1849
544 Ga0496108_0001935 3300048911 Bacteria 16596
545 Ga0496108_0009005 3300048911 Bacteria 8086
546 Ga0496108_0031320 3300048911 Bacteria 4412
547 Ga0496108_0051123 3300048911 Bacteria 3462
548 Ga0496108_0184235 3300048911 Bacteria 1808
549 Ga0496109_0009729 3300048912 Bacteria 8207
550 Ga0496109_0056072 3300048912 Bacteria 3595
551 Ga0496109_0137633 3300048912 Bacteria 2282
552 Ga0496109_0182388 3300048912 Bacteria 1972
553 Ga0496109_0203091 3300048912 Bacteria 1863
554 Ga0496109_0424745 3300048912 Bacteria 1256
555 Ga0496109_0797366 3300048912 Bacteria 882
556 Ga0496109_1439609 3300048912 Bacteria 624
557 Ga0496110_0005340 3300048913 Bacteria 10064
558 Ga0496110_0464964 3300048913 Bacteria 1153
559 Ga0496110_0745888 3300048913 Bacteria 882
560 Ga0496111_0019399 3300048914 Bacteria 4722
561 Ga0496111_0276871 3300048914 Bacteria 1245
562 Ga0496111_0420786 3300048914 Bacteria 987
563 Ga0496112_0010065 3300048915 Bacteria 8562
564 Ga0496112_0035607 3300048915 Bacteria 4851
565 Ga0496112_0081287 3300048915 Bacteria 3204
566 Ga0496112_0126197 3300048915 Bacteria 2530
567 Ga0496112_0847350 3300048915 Bacteria 838
568 Ga0496112_0864343 3300048915 Bacteria 827
569 Ga0496112_1746275 3300048915 Bacteria 534
570 Ga0496113_0067974 3300048916 Bacteria 2703
571 Ga0496113_0113480 3300048916 Bacteria 2112
572 Ga0496113_0312119 3300048916 Unclassified 1260
573 Ga0496113_0729316 3300048916 Bacteria 790
574 Ga0496114_0001888 3300048917 Bacteria 15905
575 Ga0496114_0003560 3300048917 Bacteria 11962
576 Ga0496114_0036843 3300048917 Bacteria 4044
577 Ga0496114_0323284 3300048917 Bacteria 1363
578 Ga0496115_0003641 3300048918 Bacteria 11090
579 Ga0496115_0006847 3300048918 Bacteria 8366
580 Ga0496115_0022854 3300048918 Bacteria 4849
581 Ga0496115_0033480 3300048918 Bacteria 4057
582 Ga0496115_0059138 3300048918 Bacteria 3086
583 Ga0496115_0072734 3300048918 Bacteria 2790
584 Ga0496115_0161684 3300048918 Bacteria 1850
585 Ga0501047_0855534 3300049581 Bacteria 723
586 Ga0501067_0090721 3300049583 Bacteria 1696
587 Ga0501067_0470328 3300049583 Bacteria 702
588 Ga0501069_0051595 3300049585 Bacteria 2289
589 Ga0501070_0008235 3300049586 Bacteria 8814
590 Ga0501070_0981790 3300049586 Unclassified 656
591 Ga0501072_0129203 3300049588 Bacteria 2013
592 Ga0501073_0007213 3300049589 Bacteria 8278
593 Ga0501074_0191393 3300049590 Bacteria 1458
594 Ga0501079_0132825 3300049741 Bacteria 1937
595 Ga0501080_0134498 3300049742 Bacteria 2288
596 Ga0501083_0001504 3300049744 Bacteria 15925
597 nmdc:mga0n895_9466_c1 3300050512 Bacteria 8524
598 nmdc:mga0rr50_1008665_c1 3300050513 Bacteria 709
599 nmdc:mga0rr50_1139172_c1 3300050513 Unclassified 663
600 nmdc:mga0rr50_291746_c1 3300050513 Bacteria 1363
601 nmdc:mga0a205_213277_c1 3300050515 Bacteria 1818
602 Ga0495601_0001112 3300053077 Bacteria 14736
603 Ga0495601_0024350 3300053077 Bacteria 3727
604 Ga0495601_0096030 3300053077 Bacteria 1911
605 Ga0495601_0173304 3300053077 Bacteria 1410
606 Ga0495612_0013653 3300053078 Bacteria 3271
607 Ga0495612_0074082 3300053078 Bacteria 1423
608 Ga0495612_0165677 3300053078 Bacteria 966
609 Ga0495612_0530468 3300053078 Bacteria 541
610 Ga0495595_0015621 3300053084 Bacteria 3239
611 Ga0495595_0179180 3300053084 Bacteria 1050
612 Ga0495595_0341208 3300053084 Bacteria 755
613 Ga0495595_0416983 3300053084 Bacteria 681
614 Ga0495595_0508818 3300053084 Bacteria 614
615 Ga0495619_0001848 3300053085 Bacteria 14098
616 Ga0495619_0067227 3300053085 Bacteria 2392
617 Ga0495619_0141845 3300053085 Bacteria 1655
618 Ga0495619_0256881 3300053085 Unclassified 1211
619 Ga0495619_0273576 3300053085 Bacteria 1170
620 Ga0495619_0644951 3300053085 Bacteria 722
621 Ga0495619_0846356 3300053085 Unclassified 617
622 Ga0466962_0006426 3300061719 Bacteria 5641
623 Ga0466962_0013053 3300061719 Bacteria 3996
624 Ga0466962_0040044 3300061719 Bacteria 2244
625 Ga0466962_0108844 3300061719 Bacteria 1333
626 Ga0466962_0119796 3300061719 Bacteria 1269
627 Ga0466962_0172052 3300061719 Bacteria 1055
628 Ga0466962_0175269 3300061719 Unclassified 1045
629 Ga0466962_0306313 3300061719 Bacteria 786
630 Ga0466963_0001933
631 Ga0070658_10160868
632 Ga0070683_100240301
633 Ga0070683_101242637
634 Ga0070680_100469154
635 Ga0070682_100050938
636 Ga0070682_100415726
637 Ga0068868_102111326
638 Ga0070660_100067598
639 Ga0070660_100121845
640 Ga0070660_101644130
641 Ga0070661_101146179
642 Ga0070671_100029890
643 Ga0070671_100105915
644 Ga0070673_101699706
645 Ga0070659_100732517
646 Ga0070709_10003918
647 Ga0070709_10955568
648 Ga0070714_100034648
649 Ga0070714_100072777
650 Ga0070714_100285161
651 Ga0070714_100679293
652 Ga0070714_101551825
653 Ga0070714_101775040
654 Ga0070714_102119860
655 Ga0070713_100034841
656 Ga0070713_100178910
657 Ga0070713_100811008
658 Ga0070710_10002373
659 Ga0070710_10041104
660 Ga0070711_100025521
661 Ga0070711_100076539
662 Ga0070711_100250950
663 Ga0070705_101026520
664 Ga0070694_100160343
665 Ga0070694_100554032
666 Ga0070708_100226279
667 Ga0070678_100497376
668 Ga0070678_101571680
669 Ga0070662_101280012
670 Ga0070706_100751915
671 Ga0070707_100000419
672 Ga0070707_100212793
673 Ga0070707_102318418
674 Ga0070679_100079637
675 Ga0070679_100735202
676 Ga0070684_100049801
677 Ga0070684_100141021
678 Ga0070686_100146523
679 Ga0070695_100015857
680 Ga0070695_100321633
681 Ga0070693_100681537
682 Ga0070693_100695597
683 Ga0070704_100133834
684 Ga0068855_100477196
685 Ga0068855_100482832
686 Ga0068855_100761798
687 Ga0068855_102428674
688 Ga0070664_100575470
689 Ga0068857_100121899
690 Ga0068856_100219354
691 Ga0068856_100535237
692 Ga0068856_100845957
693 Ga0068852_100249827
694 Ga0068863_100717687
695 Ga0070717_10010680
696 Ga0070717_10024344
697 Ga0070717_10026448
698 Ga0070717_10150946
699 Ga0070717_10906574
700 Ga0070715_10016586
701 Ga0070716_100015994
702 Ga0070712_100062466
703 Ga0070712_100223954
704 Ga0070712_100302762
705 Ga0070712_101569541
706 Ga0097621_100096707
707 Ga0075431_100857839
708 Ga0075433_11911313
709 Ga0075434_100013149
710 Ga0068865_100726458
711 Ga0075435_100180144
712 Ga0075435_100199825
713 Ga0075435_101100975
714 Ga0105240_11124695
715 Ga0105245_10083785
716 Ga0105243_10880831
717 Ga0105241_10836707
718 Ga0105237_10696417
719 Ga0105238_11724750
720 Ga0105238_12484137
721 Ga0105239_10371441
722 Ga0105239_12309279
723 Ga0157373_10219222
724 Ga0157370_10041650
725 Ga0157369_10077018
726 Ga0157369_10404359
727 Ga0157374_10456614
728 Ga0157374_10817392
729 Ga0157374_10954345
730 Ga0163162_10015311
731 Ga0157372_10993016
732 Ga0157375_10731748
733 Ga0182008_10112202
734 Ga0157377_10314726
735 Ga0157376_10087794
736 Ga0197907_10103166
737 Ga0197907_10367872
738 Ga0206356_10250408
739 Ga0206354_10401512
740 Ga0224712_10088133
741 Ga0207692_10033296
742 Ga0207692_10038360
743 Ga0207692_10062054
744 Ga0207710_10398657
745 Ga0207685_10004970
746 Ga0207699_10027077
747 Ga0207699_10040944
748 Ga0207705_10070912
749 Ga0207705_10195649
750 Ga0207654_10937404
751 Ga0207707_10120844
752 Ga0207707_10349269
753 Ga0207695_10099536
754 Ga0207671_10078168
755 Ga0207693_10011542
756 Ga0207693_10028873
757 Ga0207693_10661577
758 Ga0207663_10007689
759 Ga0207663_10258699
760 Ga0207660_10142593
761 Ga0207657_10007057
762 Ga0207657_10088248
763 Ga0207657_10234632
764 Ga0207652_10088960
765 Ga0207652_10489970
766 Ga0207646_10003186
767 Ga0207646_10910805
768 Ga0207646_11314721
769 Ga0207694_10082151
770 Ga0207687_10466119
771 Ga0207700_10113164
772 Ga0207700_10505556
773 Ga0207700_10616444
774 Ga0207664_10024083
775 Ga0207664_10035398
776 Ga0207664_10043236
777 Ga0207664_10129302
778 Ga0207664_10153151
779 Ga0207664_10495680
780 Ga0207644_10083537
781 Ga0207644_10115018
782 Ga0207644_10185952
783 Ga0207644_10237836
784 Ga0207690_10105277
785 Ga0207690_10635464
786 Ga0207706_10337298
787 Ga0207709_11602104
788 Ga0207704_10550059
789 Ga0207665_10009328
790 Ga0207665_10035443
791 Ga0207679_10111311
792 Ga0207667_10292677
793 Ga0207667_10589658
794 Ga0207677_11703656
795 Ga0207703_11615463
796 Ga0207702_10624603
797 Ga0207702_10786994
798 Ga0207702_11063090
799 Ga0207641_11324492
800 Ga0207674_10915260
801 Ga0207683_11068341
802 Ga0207683_11294639
803 Ga0265337_1208617
804 Ga0265326_10005975
805 Ga0265319_1014709
806 Ga0265319_1055604
807 Ga0265334_10024806
808 Ga0265318_10004275
809 Ga0265323_10232999
810 Ga0265322_10058301
811 Ga0265336_10004174
812 Ga0265336_10245802
813 Ga0265338_10001177
814 Ga0265338_10004797
815 Ga0265338_10018501
816 Ga0265338_10021008
817 Ga0265338_10033213
818 Ga0265330_10027575
819 Ga0265332_10004042
820 Ga0265328_10002766
821 Ga0265320_10058020
822 Ga0265325_10000684
823 Ga0265329_10022282
824 Ga0265339_10012718
825 Ga0265339_10061265
826 Ga0265331_10156067
827 Ga0265327_10027268
828 Ga0265327_10124791
829 Ga0265327_10199208
830 Ga0265327_10298724
831 Ga0265316_10016433
832 Ga0265313_10020060
833 Ga0265313_10035236
834 Ga0265314_10122407
835 Ga0265342_10017636
836 Ga0316583_10050612
837 Ga0373959_0188718
838 Ga0373936_0182168
839 Ga0373953_0200969
840 Ga0373954_0310542
841 Ga0373956_0438553
842 Ga0373956_0604195
843 Ga0373957_0196029
844 Ga0373957_0397865
845 Ga0373943_0022641
846 Ga0373955_0597776
847 Ga0373962_0090696
848 Ga0373924_0121002
849 Ga0373924_0172495
850 Ga0373931_0252441
851 Ga0373933_0069698
852 Ga0373933_0106457
853 Ga0373933_0525665
854 Ga0373933_0731832
855 Ga0373937_0000355
856 Ga0373937_0039968
857 Ga0373937_0091047
858 Ga0373937_0876014
859 Ga0373925_1253700
860 Ga0395899_0246701
861 Ga0395899_0626434
862 Ga0395900_0059737
863 Ga0395900_1289561
864 Ga0395898_0053278
865 Ga0395898_0200307
866 Ga0395898_0814911
867 Ga0395898_0820830
868 Ga0395898_0872146
869 Ga0395905_1045266
870 Ga0395901_0142909
871 Ga0395901_0147006
872 Ga0395901_0343709
873 Ga0395901_1575466
874 Ga0436360_0128350
875 Ga0466969_0003132
876 Ga0466969_0027410
877 Ga0466969_0461545
878 Ga0466965_0236559
879 Ga0466965_0339470
880 Ga0466965_0404816
881 Ga0466966_0003367
882 Ga0466966_0040111
883 Ga0466966_0053060
884 Ga0466966_0069423
885 Ga0466966_0393229
886 Ga0466966_0859688
887 Ga0466961_0008344
888 Ga0466961_0030240
889 Ga0466961_0084053
890 Ga0466961_0104670
891 Ga0466961_0110660
892 Ga0466961_0285096
893 Ga0466963_0000670
894 Ga0466963_0001565
895 Ga0466963_0006848
896 Ga0466963_0008535
897 Ga0466963_0030930
898 Ga0466963_0031901
899 Ga0466963_0058286
900 Ga0466963_0069923
901 Ga0466963_0141205
902 Ga0466963_0160354
903 Ga0466963_0190001
904 Ga0466963_0308726
905 Ga0466963_0339963
906 Ga0466963_0492479
907 Ga0466963_0531406
908 Ga0466964_0010906
909 Ga0466964_0013113
910 Ga0466964_0020749
911 Ga0466964_0029674
912 Ga0466964_0044673
913 Ga0466964_0047383
914 Ga0466964_0048272
915 Ga0466964_0108866
916 Ga0466971_0009152
917 Ga0466971_0017291
918 Ga0466971_0021103
919 Ga0466971_0031917
920 Ga0466971_0129238
921 Ga0466971_0153577
922 Ga0466971_0208203
923 Ga0466968_0002132
924 Ga0466968_0027952
925 Ga0466968_0119552
926 Ga0466968_0370845
927 Ga0466968_0417674
928 Ga0466968_0451705
929 Ga0466970_0149575
930 Ga0466970_0903060
931 Ga0466957_0006041
932 Ga0466957_0052993
933 Ga0466957_0053228
934 Ga0466957_0058781
935 Ga0466957_0126387
936 Ga0466957_0209301
937 Ga0466957_0244618
938 Ga0466957_0484861
939 Ga0466957_0667383
940 Ga0466957_1050814
941 Ga0466957_1267593
942 Ga0466960_0033619
943 Ga0466960_0033826
944 Ga0466960_0783164
945 Ga0466960_0862359
946 Ga0466960_0920806
947 Ga0466959_0013342
948 Ga0466959_0021777
949 Ga0466959_0033703
950 Ga0466959_0044436
951 Ga0466959_0536804
952 Ga0466959_0864681
953 Ga0466958_0003106
954 Ga0466958_0007030
955 Ga0466958_0018533
956 Ga0466958_0021374
957 Ga0466958_0028148
958 Ga0466958_0054158
959 Ga0466958_0059463
960 Ga0466958_0077480
961 Ga0466958_0193055
962 Ga0466958_0230631
963 Ga0466958_0303952
964 Ga0466958_0436780
965 Ga0466967_0000173
966 Ga0466967_0012563
967 Ga0466967_0018176
968 Ga0466967_0023676
969 Ga0466967_0027634
970 Ga0466967_0035273
971 Ga0466967_0035961
972 Ga0466967_0058650
973 Ga0466967_0070089
974 Ga0466967_0077176
975 Ga0466967_0161374
976 Ga0466967_0163118
977 Ga0466967_0176867
978 Ga0466967_0228161
979 Ga0466967_0459134
980 Ga0466967_0564218
981 Ga0466967_0921036
982 Ga0466967_1446623
983 Ga0495592_0000635
984 Ga0495592_0000769
985 Ga0495592_0212123
986 Ga0495592_0261950
987 Ga0495592_0668919
988 Ga0495603_0024562
989 Ga0495603_0246247
990 Ga0495603_0313105
991 Ga0495629_0176525
992 Ga0495629_0198162
993 Ga0495629_0338494
994 Ga0495641_0015557
995 Ga0495641_0053659
996 Ga0495641_0094935
997 Ga0495641_0107129
998 Ga0495641_0542659
999 Ga0495651_0000029
1000 Ga0495651_0107030
1001 Ga0495651_0183063
1002 Ga0495653_0003221
1003 Ga0495653_0047046
1004 Ga0495653_0088200
1005 Ga0495653_0127755
1006 Ga0495653_0166497
1007 Ga0495580_0361154
1008 Ga0495580_0992380
1009 Ga0495582_0153713
1010 Ga0495605_0027320
1011 Ga0495639_0367711
1012 Ga0495662_0039012
1013 Ga0495664_0129784
1014 Ga0495664_0410674
1015 Ga0495664_0498022
1016 Ga0495584_0089259
1017 Ga0495585_0174450
1018 Ga0495607_0068048
1019 Ga0495608_0004327
1020 Ga0495608_0030165
1021 Ga0495608_0088328
1022 Ga0495608_0116914
1023 Ga0495608_0533349
1024 Ga0495608_0589637
1025 Ga0495608_0602121
1026 Ga0495618_0001935
1027 Ga0495618_0436659
1028 Ga0495618_0777389
1029 Ga0495628_0000016
1030 Ga0495628_0073325
1031 Ga0495630_0020297
1032 Ga0495630_0045205
1033 Ga0495630_0160740
1034 Ga0495630_0410867
1035 Ga0495630_0733101
1036 Ga0495630_1525266
1037 Ga0495637_0243925
1038 Ga0495644_0043806
1039 Ga0495652_0001228
1040 Ga0495652_0037452
1041 Ga0495652_0420550
1042 Ga0495652_0935319
1043 Ga0495665_0501105
1044 Ga0495640_0060035
1045 Ga0495640_0418793
1046 Ga0495640_0495076
1047 Ga0495586_0255403
1048 Ga0495586_0535742
1049 Ga0495587_0000434
1050 Ga0495587_0095724
1051 Ga0495587_0827391
1052 Ga0495598_0084750
1053 Ga0495645_0000367
1054 Ga0495645_0136597
1055 Ga0495667_0045691
1056 Ga0495667_0062037
1057 Ga0495667_0064138
1058 Ga0495667_0111279
1059 Ga0495656_0001482
1060 Ga0495668_0121227
1061 Ga0495634_0147067
1062 Ga0495634_0450340
1063 Ga0495635_0047562
1064 Ga0495635_0086776
1065 Ga0495635_0223212
1066 Ga0495659_0056016
1067 Ga0495661_0194469
1068 Ga0495588_0464550
1069 Ga0495657_0005282
1070 Ga0495657_0048527
1071 Ga0495657_0133210
1072 Ga0495657_0187056
1073 Ga0495599_0000187
1074 Ga0495599_0057861
1075 Ga0495599_0477213
1076 Ga0495623_0000121
1077 Ga0495623_0423354
1078 Ga0495623_0426405
1079 Ga0495623_0488043
1080 Ga0495646_0017898
1081 Ga0495646_0408922
1082 Ga0495647_0054592
1083 Ga0495647_0107947
1084 Ga0495658_0056370
1085 Ga0495658_0067189
1086 Ga0495613_0005669
1087 Ga0495613_0067674
1088 Ga0495613_0203188
1089 Ga0495613_0299847
1090 Ga0495613_0506225
1091 Ga0495624_0014162
1092 Ga0495624_0049072
1093 Ga0495624_0328317
1094 Ga0495670_0110411
1095 Ga0495589_0028301
1096 Ga0495600_0053882
1097 Ga0495600_0219476
1098 Ga0495581_0218518
1099 Ga0495604_0000628
1100 Ga0495604_0109045
1101 Ga0495604_0117920
1102 Ga0495636_0313738
1103 Ga0495674_0113555
1104 Ga0495674_0292986
1105 Ga0495674_0633361
1106 Ga0495674_1163992
1107 Ga0495676_0083226
1108 Ga0495676_0172361
1109 Ga0495676_0200531
1110 Ga0495676_0204732
1111 Ga0495676_0275704
1112 Ga0495676_0521758
1113 Ga0495676_0990192
1114 Ga0495676_1073294
1115 Ga0495680_0001674
1116 Ga0495680_0002048
1117 Ga0495680_0043895
1118 Ga0495680_0071201
1119 Ga0495680_0181349
1120 Ga0495680_1007901
1121 Ga0495675_0000031
1122 Ga0495675_0200354
1123 Ga0495675_0223747
1124 Ga0495679_032728
1125 Ga0495684_0032060
1126 Ga0495684_0158741
1127 Ga0495684_0203498
1128 Ga0495684_1026873
1129 Ga0495593_0107154
1130 Ga0495602_0000133
1131 Ga0495602_0187305
1132 Ga0495602_0779631
1133 Ga0495614_0125844
1134 Ga0495614_0604513
1135 Ga0496100_0004881
1136 Ga0496100_0080894
1137 Ga0496100_0179106
1138 Ga0496100_0512142
1139 Ga0496100_0716701
1140 Ga0496101_0002611
1141 Ga0496101_0004138
1142 Ga0496101_0048867
1143 Ga0496101_0179896
1144 Ga0496101_0218680
1145 Ga0496101_0242471
1146 Ga0496101_1050818
1147 Ga0496102_0005424
1148 Ga0496102_0076014
1149 Ga0496102_0396101
1150 Ga0496103_0296597
1151 Ga0496103_0320927
1152 Ga0496104_0009726
1153 Ga0496104_0089286
1154 Ga0496104_0110041
1155 Ga0496104_0122313
1156 Ga0496104_0165850
1157 Ga0496104_0261711
1158 Ga0496105_0000923
1159 Ga0496105_0001598
1160 Ga0496105_0020322
1161 Ga0496105_0028825
1162 Ga0496105_0039115
1163 Ga0496105_0061878
1164 Ga0496105_0319160
1165 Ga0496106_0003798
1166 Ga0496106_0017249
1167 Ga0496106_0074853
1168 Ga0496106_0123596
1169 Ga0496107_0003164
1170 Ga0496107_0004023
1171 Ga0496107_0070548
1172 Ga0496107_0131274
1173 Ga0496108_0001935
1174 Ga0496108_0009005
1175 Ga0496108_0031320
1176 Ga0496108_0051123
1177 Ga0496108_0184235
1178 Ga0496109_0009729
1179 Ga0496109_0056072
1180 Ga0496109_0137633
1181 Ga0496109_0182388
1182 Ga0496109_0203091
1183 Ga0496109_0424745
1184 Ga0496109_0797366
1185 Ga0496109_1439609
1186 Ga0496110_0005340
1187 Ga0496110_0464964
1188 Ga0496110_0745888
1189 Ga0496111_0019399
1190 Ga0496111_0276871
1191 Ga0496111_0420786
1192 Ga0496112_0010065
1193 Ga0496112_0035607
1194 Ga0496112_0081287
1195 Ga0496112_0126197
1196 Ga0496112_0847350
1197 Ga0496112_0864343
1198 Ga0496112_1746275
1199 Ga0496113_0067974
1200 Ga0496113_0113480
1201 Ga0496113_0312119
1202 Ga0496113_0729316
1203 Ga0496114_0001888
1204 Ga0496114_0003560
1205 Ga0496114_0036843
1206 Ga0496114_0323284
1207 Ga0496115_0003641
1208 Ga0496115_0006847
1209 Ga0496115_0022854
1210 Ga0496115_0033480
1211 Ga0496115_0059138
1212 Ga0496115_0072734
1213 Ga0496115_0161684
1214 Ga0501047_0855534
1215 Ga0501067_0090721
1216 Ga0501067_0470328
1217 Ga0501069_0051595
1218 Ga0501070_0008235
1219 Ga0501070_0981790
1220 Ga0501072_0129203
1221 Ga0501073_0007213
1222 Ga0501074_0191393
1223 Ga0501079_0132825
1224 Ga0501080_0134498
1225 Ga0501083_0001504
1226 nmdc:mga0n895_9466_c1
1227 nmdc:mga0rr50_1008665_c1
1228 nmdc:mga0rr50_1139172_c1
1229 nmdc:mga0rr50_291746_c1
1230 nmdc:mga0a205_213277_c1
1231 Ga0495601_0001112
1232 Ga0495601_0024350
1233 Ga0495601_0096030
1234 Ga0495601_0173304
1235 Ga0495612_0013653
1236 Ga0495612_0074082
1237 Ga0495612_0165677
1238 Ga0495612_0530468
1239 Ga0495595_0015621
1240 Ga0495595_0179180
1241 Ga0495595_0341208
1242 Ga0495595_0416983
1243 Ga0495595_0508818
1244 Ga0495619_0001848
1245 Ga0495619_0067227
1246 Ga0495619_0141845
1247 Ga0495619_0256881
1248 Ga0495619_0273576
1249 Ga0495619_0644951
1250 Ga0495619_0846356
1251 Ga0466962_0006426
1252 Ga0466962_0013053
1253 Ga0466962_0040044
1254 Ga0466962_0108844
1255 Ga0466962_0119796
1256 Ga0466962_0172052
1257 Ga0466962_0175269
1258 Ga0466962_0306313

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rb6-assembly3.cif.gz_B-2 x-ray structure of the protein q8ei81. northeast structural genomics consortium target sor78a 0.7146 35 90
3fif-assembly8.cif.gz_H crystal structure of the ygdr protein from e.coli. northeast structural genomics target er382a. 0.7077 35 90
2k57-assembly1.cif.gz_A solution nmr structure of putative lipoprotein from pseudomonas syringae gene locus pspto2350. northeast structural genomics target psr76a. 0.7052 36 89
5cai-assembly1.cif.gz_A crystal structure of a putative lipoprotein from the duf903 family (kpn_03160) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.30 a resolution 0.7013 35 89
6mgh-assembly2.cif.gz_B x-ray structure of monomeric near-infrared fluorescent protein mirfp670nano 0.687 17 50
ID Description Score Start End Superfamily
6mghD00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7258 15 49 3.30.450.40
2k57A00 Mainly Beta;Roll;SH3 type barrels.; 0.7052 36 89 2.30.30.100
af_P9WH17_92_157_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.6828 36 90 2.30.30.100
5caiC00 Mainly Beta;Roll;SH3 type barrels.; 0.6764 38 88 2.30.30.100
2rd1C00 Mainly Beta;Roll;SH3 type barrels.; 0.6741 37 90 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A518D7W5-F1-model_v4 Uncharacterized protein 0.8734 37 88
AF-A0A538E564-F1-model_v4 Uncharacterized protein 0.8656 15 105
AF-A0A538E564-F1-model_v4 Uncharacterized protein 0.8227 15 105
AF-A0A7V9FY00-F1-model_v4 Uncharacterized protein 0.8037 8 107
AF-A0A1A9NM06-F1-model_v4 Uncharacterized protein 0.7858 16 89

Map