F470719

General Info

Members Datasets Scaffolds Average Seq Length
629 275 1258 254

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100720356|Ga0068855_1007203562
Length 293
Sequence VSNARRSHASLRTPATTSRCPCTTPPPCRPRNAALKILFVADVFGTPGRAAVEERLAGLKEELGAGFCVVNGENVADGSGITPRLAERLLAAGADVLTLGNHVWRRREINDYLEGAERVVRPANLGASAPGRGLVVVPAADGTPVAVVNLQGSLFMQTPVGPFELVDDLVEQARSQAKVIVVDFHAEATSEKIALARVLDGRVTAVIGTHTHVQTSDARVQAGGTAAITDAGMTGPHDSVIGVKAELAIRRMRTGMPVRFEPASGGVRIEGALIECGAEGRALSCEAVRVPVP

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
169 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
172 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
203 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
269 2554235283 Bacillus safensis VK Isolate Rhizosphere
270 2643221735 Bacillus sp. Root920 Isolate Unclassified
271 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
272 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
273 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
274 2919726948 Bacillus pumilus 4489 Isolate Unclassified
275 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0.32
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 10.33
Rhizosphere 89.19
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100720356 3300005563 Bacteria 1066
2 JGI24034J26672_10007966 3300002239 Bacteria 1544
3 JGI25151J46595_10000012 3300003187 Bacteria 254028
4 Ga0070658_10056716 3300005327 Bacteria 3184
5 Ga0070683_100004784 3300005329 Bacteria 11205
6 Ga0070683_100244671 3300005329 Bacteria 1706
7 Ga0070683_100556369 3300005329 Bacteria 1097
8 Ga0070690_100161380 3300005330 Bacteria 1536
9 Ga0070670_100129364 3300005331 Bacteria 2179
10 Ga0068869_100013356 3300005334 Bacteria 5461
11 Ga0070682_100062469 3300005337 Bacteria 2359
12 Ga0070682_100390513 3300005337 Bacteria 1049
13 Ga0068868_100007590 3300005338 Bacteria 7729
14 Ga0068868_100023336 3300005338 Bacteria 4681
15 Ga0068868_100107651 3300005338 Bacteria 2262
16 Ga0070660_100077720 3300005339 Bacteria 2601
17 Ga0070689_100034243 3300005340 Bacteria 3875
18 Ga0070687_100079096 3300005343 Bacteria 1789
19 Ga0070692_10094144 3300005345 Bacteria 1633
20 Ga0070674_100049656 3300005356 Bacteria 2885
21 Ga0070673_100018896 3300005364 Bacteria 4939
22 Ga0070673_100073949 3300005364 Bacteria 2745
23 Ga0070688_100031212 3300005365 Bacteria 3204
24 Ga0070659_100036918 3300005366 Bacteria 3809
25 Ga0070703_10077203 3300005406 Bacteria 1126
26 Ga0070709_10041102 3300005434 Bacteria 2847
27 Ga0070709_10214889 3300005434 Bacteria 1368
28 Ga0070714_100010921 3300005435 Bacteria 7191
29 Ga0070714_100016463 3300005435 Bacteria 5972
30 Ga0070713_100047874 3300005436 Bacteria 3517
31 Ga0070713_100277484 3300005436 Bacteria 1536
32 Ga0070710_10019818 3300005437 Bacteria 3482
33 Ga0070701_10008202 3300005438 Bacteria 4504
34 Ga0070711_100009946 3300005439 Bacteria 5868
35 Ga0070705_100051238 3300005440 Bacteria 2406
36 Ga0070705_100075635 3300005440 Bacteria 2051
37 Ga0070700_100013062 3300005441 Bacteria 4657
38 Ga0070700_100019221 3300005441 Bacteria 3941
39 Ga0070700_100078091 3300005441 Bacteria 2130
40 Ga0070708_100077536 3300005445 Bacteria 3003
41 Ga0070708_100721171 3300005445 Bacteria 938
42 Ga0070663_100056121 3300005455 Bacteria 2821
43 Ga0070663_100058068 3300005455 Bacteria 2777
44 Ga0070678_100303465 3300005456 Bacteria 1357
45 Ga0068867_100073483 3300005459 Unclassified 2560
46 Ga0068867_100211594 3300005459 Bacteria 1557
47 Ga0070685_10007946 3300005466 Bacteria 5436
48 Ga0070706_100017069 3300005467 Bacteria 6706
49 Ga0070707_100089202 3300005468 Bacteria 2983
50 Ga0070698_100007770 3300005471 Bacteria 11605
51 Ga0070679_100168939 3300005530 Bacteria 2160
52 Ga0070684_100000173 3300005535 Bacteria 44303
53 Ga0070684_100008885 3300005535 Bacteria 7882
54 Ga0070684_100129986 3300005535 Bacteria 2271
55 Ga0070684_100162632 3300005535 Bacteria 2026
56 Ga0070686_100033891 3300005544 Bacteria 3141
57 Ga0070686_100069440 3300005544 Bacteria 2301
58 Ga0070696_100023638 3300005546 Bacteria 4177
59 Ga0070696_100038923 3300005546 Bacteria 3283
60 Ga0070693_100020970 3300005547 Bacteria 3454
61 Ga0070693_100123512 3300005547 Bacteria 1609
62 Ga0070693_100201285 3300005547 Bacteria 1293
63 Ga0070665_100029228 3300005548 Bacteria 5548
64 Ga0070665_100074660 3300005548 Bacteria 3396
65 Ga0070665_100158677 3300005548 Bacteria 2263
66 Ga0070704_100056853 3300005549 Bacteria 2779
67 Ga0068855_100048076 3300005563 Bacteria 5036
68 Ga0068855_100050477 3300005563 Bacteria 4902
69 Ga0070664_100036868 3300005564 Bacteria 4109
70 Ga0070664_100260889 3300005564 Bacteria 1559
71 Ga0068857_100002531 3300005577 Bacteria 14961
72 Ga0068857_100018211 3300005577 Bacteria 6159
73 Ga0068857_100027441 3300005577 Bacteria 5023
74 Ga0068854_100024464 3300005578 Bacteria 4135
75 Ga0068854_100094802 3300005578 Bacteria 2227
76 Ga0068854_100103175 3300005578 Bacteria 2140
77 Ga0068856_100003956 3300005614 Bacteria 14838
78 Ga0068856_100019704 3300005614 Bacteria 6547
79 Ga0068856_100088352 3300005614 Bacteria 3081
80 Ga0070702_100202717 3300005615 Bacteria 1314
81 Ga0068859_100235922 3300005617 Bacteria 1918
82 Ga0068864_100063634 3300005618 Bacteria 3197
83 Ga0068864_100281818 3300005618 Bacteria 1551
84 Ga0068866_10018985 3300005718 Bacteria 3120
85 Ga0068866_10106875 3300005718 Bacteria 1554
86 Ga0068861_100054622 3300005719 Bacteria 3043
87 Ga0068870_10024034 3300005840 Bacteria 3012
88 Ga0068870_10026274 3300005840 Bacteria 2901
89 Ga0068870_10179919 3300005840 Bacteria 1268
90 Ga0068863_100041279 3300005841 Bacteria 4386
91 Ga0068858_100046190 3300005842 Bacteria 4037
92 Ga0068858_100180869 3300005842 Bacteria 1991
93 Ga0068858_100231376 3300005842 Bacteria 1752
94 Ga0068860_100336901 3300005843 Bacteria 1483
95 Ga0068862_100814495 3300005844 Bacteria 913
96 Ga0081455_10026032 3300005937 Bacteria 5389
97 Ga0081455_10044612 3300005937 Bacteria 3865
98 Ga0081455_10189662 3300005937 Bacteria 1549
99 Ga0081538_10000052 3300005981 Bacteria 109642
100 Ga0081538_10001074 3300005981 Bacteria 29047
101 Ga0081540_1026716 3300005983 Unclassified 3287
102 Ga0081539_10000397 3300005985 Bacteria 93458
103 Ga0070717_10024720 3300006028 Bacteria 4772
104 Ga0075432_10013682 3300006058 Bacteria 2758
105 Ga0070716_100012223 3300006173 Bacteria 4346
106 Ga0070716_100031731 3300006173 Bacteria 2876
107 Ga0070712_100001474 3300006175 Bacteria 14338
108 Ga0097621_100055332 3300006237 Bacteria 3239
109 Ga0097621_100377587 3300006237 Bacteria 1265
110 Ga0068871_100114229 3300006358 Bacteria 2275
111 Ga0068871_100144027 3300006358 Bacteria 2028
112 Ga0075428_100249422 3300006844 Bacteria 1914
113 Ga0075428_100576918 3300006844 Bacteria 1202
114 Ga0075434_100004757 3300006871 Bacteria 12289
115 Ga0068865_100144499 3300006881 Bacteria 1797
116 Ga0068865_100229773 3300006881 Bacteria 1455
117 Ga0097620_100235912 3300006931 Bacteria 1918
118 Ga0075435_100014613 3300007076 Bacteria 5876
119 Ga0075435_100017065 3300007076 Bacteria 5485
120 Ga0105240_10010457 3300009093 Bacteria 13040
121 Ga0111539_10333336 3300009094 Bacteria 1766
122 Ga0105245_10057989 3300009098 Bacteria 3485
123 Ga0105245_10061431 3300009098 Bacteria 3387
124 Ga0105245_10064894 3300009098 Bacteria 3300
125 Ga0105245_10094826 3300009098 Bacteria 2751
126 Ga0105245_10414297 3300009098 Unclassified 1349
127 Ga0105247_10069500 3300009101 Bacteria 2198
128 Ga0114129_10037285 3300009147 Bacteria 6864
129 Ga0105243_10115504 3300009148 Bacteria 2254
130 Ga0105243_10149459 3300009148 Unclassified 2002
131 Ga0105243_10753429 3300009148 Bacteria 955
132 Ga0105241_10112693 3300009174 Bacteria 2179
133 Ga0105241_10137224 3300009174 Bacteria 1987
134 Ga0105241_10375632 3300009174 Bacteria 1241
135 Ga0105242_10057548 3300009176 Bacteria 3185
136 Ga0105242_10087479 3300009176 Bacteria 2616
137 Ga0105242_10113193 3300009176 Bacteria 2317
138 Ga0105242_10510056 3300009176 Bacteria 1145
139 Ga0105242_10824025 3300009176 Bacteria 921
140 Ga0105248_10064367 3300009177 Bacteria 4117
141 Ga0105248_10214402 3300009177 Bacteria 2169
142 Ga0105237_10043829 3300009545 Bacteria 4505
143 Ga0105237_10215261 3300009545 Bacteria 1921
144 Ga0105238_10031825 3300009551 Bacteria 5368
145 Ga0105238_10247593 3300009551 Bacteria 1760
146 Ga0105238_10319076 3300009551 Bacteria 1539
147 Ga0105239_10080041 3300010375 Bacteria 3595
148 Ga0105239_10170664 3300010375 Bacteria 2432
149 Ga0105246_10197945 3300011119 Bacteria 1560
150 Ga0105246_10296358 3300011119 Bacteria 1304
151 Ga0157369_10014592 3300013105 Bacteria 8864
152 Ga0157374_10047924 3300013296 Bacteria 3963
153 Ga0157374_10066481 3300013296 Bacteria 3388
154 Ga0163162_10235566 3300013306 Bacteria 1961
155 Ga0163162_10293022 3300013306 Bacteria 1759
156 Ga0163162_11233299 3300013306 Bacteria 849
157 Ga0157372_10028616 3300013307 Bacteria 6084
158 Ga0157372_10050621 3300013307 Bacteria 4620
159 Ga0157372_10057353 3300013307 Bacteria 4353
160 Ga0157372_10900361 3300013307 Bacteria 1027
161 Ga0157375_10538103 3300013308 Bacteria 1331
162 Ga0157377_10071981 3300014745 Bacteria 2000
163 Ga0157377_10097720 3300014745 Bacteria 1744
164 Ga0157379_10040606 3300014968 Bacteria 4153
165 Ga0157379_10046509 3300014968 Bacteria 3870
166 Ga0157376_10007354 3300014969 Bacteria 7852
167 Ga0157376_10121627 3300014969 Bacteria 2315
168 Ga0157376_10199731 3300014969 Bacteria 1839
169 Ga0163161_10231739 3300017792 Unclassified 1433
170 Ga0206356_10026517 3300020070 Bacteria 2091
171 Ga0206353_11918524 3300020082 Bacteria 6515
172 Ga0207692_10002734 3300025898 Bacteria 6806
173 Ga0207692_10065101 3300025898 Bacteria 1900
174 Ga0207642_10020300 3300025899 Bacteria 2591
175 Ga0207688_10009605 3300025901 Bacteria 5267
176 Ga0207688_10076495 3300025901 Bacteria 1906
177 Ga0207680_10301105 3300025903 Bacteria 1118
178 Ga0207685_10028563 3300025905 Bacteria 1966
179 Ga0207699_10233101 3300025906 Bacteria 1261
180 Ga0207643_10062433 3300025908 Bacteria 2129
181 Ga0207643_10125501 3300025908 Bacteria 1523
182 Ga0207684_10014049 3300025910 Bacteria 6915
183 Ga0207654_10077032 3300025911 Bacteria 1998
184 Ga0207707_10012796 3300025912 Bacteria 7298
185 Ga0207707_10020140 3300025912 Bacteria 5822
186 Ga0207707_10070187 3300025912 Bacteria 3053
187 Ga0207707_10142350 3300025912 Bacteria 2096
188 Ga0207695_10004861 3300025913 Bacteria 18136
189 Ga0207671_10065444 3300025914 Bacteria 2704
190 Ga0207671_10120512 3300025914 Unclassified 2005
191 Ga0207671_10149176 3300025914 Bacteria 1806
192 Ga0207693_10009154 3300025915 Bacteria 8083
193 Ga0207693_10015753 3300025915 Bacteria 6058
194 Ga0207663_10009163 3300025916 Bacteria 5222
195 Ga0207663_10077630 3300025916 Bacteria 2162
196 Ga0207660_10005388 3300025917 Bacteria 8305
197 Ga0207660_10139530 3300025917 Bacteria 1852
198 Ga0207662_10021101 3300025918 Bacteria 3719
199 Ga0207657_10004471 3300025919 Bacteria 14787
200 Ga0207657_10020865 3300025919 Bacteria 6183
201 Ga0207657_10377437 3300025919 Bacteria 1117
202 Ga0207649_10054832 3300025920 Bacteria 2483
203 Ga0207652_10013273 3300025921 Bacteria 6669
204 Ga0207652_10019257 3300025921 Bacteria 5611
205 Ga0207694_10041416 3300025924 Bacteria 3549
206 Ga0207650_10445298 3300025925 Bacteria 1077
207 Ga0207659_10014048 3300025926 Bacteria 5154
208 Ga0207687_10000216 3300025927 Bacteria 39182
209 Ga0207687_10029028 3300025927 Bacteria 3718
210 Ga0207687_10131553 3300025927 Bacteria 1887
211 Ga0207687_10148747 3300025927 Bacteria 1785
212 Ga0207700_10000001 3300025928 Bacteria 1122509
213 Ga0207700_10069525 3300025928 Bacteria 2703
214 Ga0207700_10353030 3300025928 Bacteria 1281
215 Ga0207664_10001804 3300025929 Bacteria 14100
216 Ga0207664_10198439 3300025929 Bacteria 1731
217 Ga0207644_10086465 3300025931 Bacteria 2328
218 Ga0207644_10649127 3300025931 Bacteria 878
219 Ga0207690_10143482 3300025932 Bacteria 1762
220 Ga0207690_10408042 3300025932 Bacteria 1084
221 Ga0207706_10154642 3300025933 Bacteria 2017
222 Ga0207706_10179954 3300025933 Bacteria 1857
223 Ga0207706_10501466 3300025933 Unclassified 1048
224 Ga0207686_10102659 3300025934 Bacteria 1912
225 Ga0207686_10275081 3300025934 Bacteria 1240
226 Ga0207709_10016013 3300025935 Bacteria 4162
227 Ga0207709_10020283 3300025935 Bacteria 3748
228 Ga0207709_10494712 3300025935 Bacteria 953
229 Ga0207704_10086531 3300025938 Unclassified 2044
230 Ga0207704_10273115 3300025938 Bacteria 1281
231 Ga0207665_10005420 3300025939 Bacteria 8518
232 Ga0207665_10034610 3300025939 Bacteria 3351
233 Ga0207711_10026708 3300025941 Bacteria 4847
234 Ga0207689_10042942 3300025942 Bacteria 3738
235 Ga0207689_10083675 3300025942 Bacteria 2623
236 Ga0207689_10103538 3300025942 Unclassified 2339
237 Ga0207689_10213684 3300025942 Unclassified 1594
238 Ga0207661_10005866 3300025944 Bacteria 8669
239 Ga0207661_10013252 3300025944 Bacteria 6019
240 Ga0207661_10239960 3300025944 Bacteria 1608
241 Ga0207679_10021459 3300025945 Bacteria 4379
242 Ga0207679_10135572 3300025945 Bacteria 1982
243 Ga0207667_10402075 3300025949 Bacteria 1394
244 Ga0207712_10072993 3300025961 Bacteria 2473
245 Ga0207668_10154070 3300025972 Bacteria 1783
246 Ga0207640_10049034 3300025981 Bacteria 2733
247 Ga0207640_10061111 3300025981 Bacteria 2494
248 Ga0207640_10061931 3300025981 Bacteria 2480
249 Ga0207640_10391909 3300025981 Bacteria 1128
250 Ga0207677_10005449 3300026023 Bacteria 6909
251 Ga0207677_10035544 3300026023 Bacteria 3238
252 Ga0207677_10343180 3300026023 Bacteria 1248
253 Ga0207703_10013795 3300026035 Bacteria 6298
254 Ga0207703_10255307 3300026035 Bacteria 1582
255 Ga0207639_10059562 3300026041 Bacteria 2942
256 Ga0207678_10050875 3300026067 Bacteria 3578
257 Ga0207708_10031941 3300026075 Bacteria 3998
258 Ga0207702_10003318 3300026078 Bacteria 14802
259 Ga0207702_10020122 3300026078 Bacteria 5529
260 Ga0207702_10027927 3300026078 Bacteria 4688
261 Ga0207702_10172337 3300026078 Unclassified 1985
262 Ga0207648_10021343 3300026089 Bacteria 5821
263 Ga0207648_10029227 3300026089 Bacteria 4888
264 Ga0207648_10059515 3300026089 Bacteria 3331
265 Ga0207676_10031850 3300026095 Bacteria 3968
266 Ga0207676_10130394 3300026095 Bacteria 2136
267 Ga0207676_10338644 3300026095 Unclassified 1387
268 Ga0207674_10016117 3300026116 Bacteria 8187
269 Ga0207674_10017004 3300026116 Bacteria 7941
270 Ga0207674_10038047 3300026116 Bacteria 4999
271 Ga0207674_10071319 3300026116 Bacteria 3491
272 Ga0207675_100018724 3300026118 Bacteria 6464
273 Ga0207683_10003250 3300026121 Bacteria 14179
274 Ga0207683_10023319 3300026121 Bacteria 5323
275 Ga0207683_10132025 3300026121 Bacteria 2246
276 Ga0207698_10020867 3300026142 Bacteria 4519
277 Ga0207698_10041237 3300026142 Bacteria 3438
278 Ga0207698_10166971 3300026142 Bacteria 1933
279 Ga0207698_10397479 3300026142 Bacteria 1316
280 Ga0207428_10033371 3300027907 Bacteria 4228
281 Ga0268266_10036441 3300028379 Bacteria 4187
282 Ga0268264_10100998 3300028381 Bacteria 2507
283 Ga0265327_10012011 3300031251 Bacteria 5892
284 Ga0307413_10447930 3300031824 Bacteria 1024
285 Ga0307406_10018394 3300031901 Bacteria 4083
286 Ga0307409_100037026 3300031995 Bacteria 3593
287 Ga0307409_100245274 3300031995 Bacteria 1634
288 Ga0307409_100377613 3300031995 Bacteria 1346
289 Ga0307416_100110380 3300032002 Bacteria 2422
290 Ga0307415_100000791 3300032126 Bacteria 14361
291 Ga0307415_100211055 3300032126 Bacteria 1549
292 Ga0373930_0037577 3300034816 Bacteria 1020
293 Ga0373941_0009095 3300035115 Bacteria 2492
294 Ga0373941_0031963 3300035115 Bacteria 1572
295 Ga0373955_0284217 3300035172 Bacteria 996
296 Ga0373942_0004083 3300035207 Bacteria 3404
297 Ga0373935_0243798 3300035692 Bacteria 1256
298 Ga0373935_0348029 3300035692 Bacteria 1056
299 Ga0316584_0097985 3300036712 Bacteria 2195
300 Ga0395899_0017624 3300037312 Bacteria 5438
301 Ga0395899_0032843 3300037312 Bacteria 3900
302 Ga0395900_0011746 3300037418 Bacteria 8953
303 Ga0395900_0015227 3300037418 Bacteria 7842
304 Ga0395900_0020327 3300037418 Bacteria 6777
305 Ga0395900_0166081 3300037418 Bacteria 2249
306 Ga0395900_0457066 3300037418 Bacteria 1232
307 Ga0395898_0003973 3300037466 Bacteria 16276
308 Ga0395898_0009419 3300037466 Bacteria 10256
309 Ga0395898_0012105 3300037466 Bacteria 8933
310 Ga0395898_0031760 3300037466 Bacteria 5274
311 Ga0395898_0064459 3300037466 Bacteria 3554
312 Ga0395898_0193501 3300037466 Bacteria 1943
313 Ga0395898_0293531 3300037466 Bacteria 1551
314 Ga0395905_0001332 3300037471 Bacteria 30138
315 Ga0395905_0002140 3300037471 Bacteria 22398
316 Ga0395905_0006033 3300037471 Bacteria 12270
317 Ga0395905_0062753 3300037471 Bacteria 3475
318 Ga0395905_0205428 3300037471 Bacteria 1846
319 Ga0395901_0003092 3300038443 Bacteria 16740
320 Ga0395901_0018423 3300038443 Bacteria 7127
321 Ga0395901_0020135 3300038443 Bacteria 6827
322 Ga0395901_0029188 3300038443 Bacteria 5676
323 Ga0395901_0035614 3300038443 Bacteria 5143
324 Ga0395901_0231387 3300038443 Bacteria 1929
325 Ga0439461_0016348 3300041410 Bacteria 1431
326 Ga0439433_0001782 3300041999 Bacteria 4473
327 Ga0439448_0076319 3300042005 Bacteria 1121
328 Ga0439452_038130 3300042010 Bacteria 1142
329 Ga0450898_004517 3300042134 Bacteria 2062
330 Ga0439446_0003136 3300042156 Bacteria 4066
331 Ga0439446_0017496 3300042156 Bacteria 2004
332 Ga0439434_0007482 3300042435 Bacteria 3199
333 Ga0439434_0047405 3300042435 Bacteria 1327
334 Ga0466963_0001587 3300044694 Bacteria 12347
335 Ga0466963_0020629 3300044694 Bacteria 4144
336 Ga0466963_0023895 3300044694 Bacteria 3886
337 Ga0466963_0088491 3300044694 Bacteria 2107
338 Ga0466964_0219865 3300044706 Bacteria 922
339 Ga0453684_0559802 3300044712 Unclassified 1258
340 Ga0466957_0009613 3300044842 Bacteria 5523
341 Ga0466960_0002081 3300044901 Bacteria 7446
342 Ga0466958_0005666 3300045836 Bacteria 6744
343 Ga0466958_0024239 3300045836 Bacteria 3570
344 Ga0466967_0000555 3300045976 Bacteria 18210
345 Ga0466967_0014314 3300045976 Bacteria 6173
346 Ga0466967_0022767 3300045976 Bacteria 5122
347 Ga0466967_0027717 3300045976 Bacteria 4716
348 Ga0466967_0299787 3300045976 Bacteria 1546
349 Ga0495629_0287657 3300046459 Bacteria 1127
350 Ga0495582_0022614 3300046473 Bacteria 3441
351 Ga0495582_0086865 3300046473 Bacteria 1741
352 Ga0495662_0111597 3300046476 Bacteria 1340
353 Ga0495584_0100028 3300046491 Bacteria 1465
354 Ga0495584_0143892 3300046491 Bacteria 1211
355 Ga0495596_0038320 3300046500 Bacteria 1895
356 Ga0495630_0354328 3300046517 Bacteria 1123
357 Ga0495663_0007023 3300046525 Bacteria 3107
358 Ga0495609_0075319 3300046538 Unclassified 1479
359 Ga0495656_0028893 3300046615 Bacteria 2228
360 Ga0495611_0116239 3300046648 Bacteria 1247
361 Ga0495588_0237156 3300046674 Bacteria 962
362 Ga0495647_0034315 3300046681 Bacteria 1900
363 Ga0495658_0077221 3300046683 Bacteria 1947
364 Ga0495658_0111647 3300046683 Bacteria 1644
365 Ga0495658_0135399 3300046683 Bacteria 1503
366 Ga0495613_0122811 3300046689 Bacteria 1864
367 Ga0495624_0072630 3300046690 Bacteria 2140
368 Ga0495671_0089847 3300046692 Bacteria 1504
369 Ga0495660_0119257 3300046810 Unclassified 1337
370 Ga0495581_0007101 3300047315 Bacteria 6485
371 Ga0495581_0049433 3300047315 Bacteria 2428
372 Ga0495636_0089250 3300047318 Bacteria 1337
373 Ga0495676_0073125 3300047321 Bacteria 2630
374 Ga0495677_0023733 3300047445 Bacteria 2226
375 Ga0495679_045111 3300047446 Bacteria 1348
376 Ga0495614_0104878 3300048089 Bacteria 1238
377 Ga0495614_0111129 3300048089 Bacteria 1203
378 Ga0496100_0000562 3300048903 Bacteria 17649
379 Ga0496100_0009228 3300048903 Bacteria 5537
380 Ga0496100_0014649 3300048903 Bacteria 4558
381 Ga0496100_0028760 3300048903 Bacteria 3431
382 Ga0496101_0019065 3300048904 Bacteria 4675
383 Ga0496101_0036097 3300048904 Bacteria 3500
384 Ga0496101_0240118 3300048904 Bacteria 1410
385 Ga0496101_0343497 3300048904 Bacteria 1172
386 Ga0496102_0012885 3300048905 Bacteria 7238
387 Ga0496102_0021890 3300048905 Bacteria 5659
388 Ga0496102_0047476 3300048905 Bacteria 3902
389 Ga0496102_0223257 3300048905 Bacteria 1776
390 Ga0496102_0887246 3300048905 Bacteria 813
391 Ga0496103_0008185 3300048906 Bacteria 6206
392 Ga0496103_0016560 3300048906 Bacteria 4398
393 Ga0496104_0008718 3300048907 Bacteria 9015
394 Ga0496104_0064659 3300048907 Bacteria 3470
395 Ga0496104_0109017 3300048907 Bacteria 2654
396 Ga0496104_0112435 3300048907 Bacteria 2612
397 Ga0496104_0161402 3300048907 Bacteria 2150
398 Ga0496105_0035273 3300048908 Bacteria 4116
399 Ga0496105_0035586 3300048908 Bacteria 4098
400 Ga0496105_0089868 3300048908 Bacteria 2537
401 Ga0496105_0151614 3300048908 Bacteria 1905
402 Ga0496106_0000947 3300048909 Bacteria 21165
403 Ga0496106_0008736 3300048909 Bacteria 7491
404 Ga0496106_0023453 3300048909 Bacteria 4584
405 Ga0496106_0150168 3300048909 Bacteria 1837
406 Ga0496107_0005049 3300048910 Bacteria 8996
407 Ga0496107_0005428 3300048910 Bacteria 8729
408 Ga0496107_0028999 3300048910 Bacteria 3935
409 Ga0496107_0041296 3300048910 Bacteria 3312
410 Ga0496107_0149791 3300048910 Bacteria 1725
411 Ga0496107_0195616 3300048910 Bacteria 1503
412 Ga0496108_0000624 3300048911 Bacteria 27681
413 Ga0496108_0002781 3300048911 Bacteria 14023
414 Ga0496108_0017252 3300048911 Bacteria 5904
415 Ga0496108_0267338 3300048911 Bacteria 1488
416 Ga0496109_0003289 3300048912 Bacteria 13492
417 Ga0496109_0003615 3300048912 Bacteria 12925
418 Ga0496109_0021879 3300048912 Bacteria 5660
419 Ga0496109_0069085 3300048912 Bacteria 3239
420 Ga0496109_0275143 3300048912 Bacteria 1586
421 Ga0496110_0005543 3300048913 Bacteria 9910
422 Ga0496110_0012925 3300048913 Bacteria 6884
423 Ga0496110_0032605 3300048913 Bacteria 4501
424 Ga0496110_0060984 3300048913 Bacteria 3328
425 Ga0496110_0100082 3300048913 Bacteria 2598
426 Ga0496110_0109704 3300048913 Bacteria 2479
427 Ga0496110_0628696 3300048913 Bacteria 973
428 Ga0496111_0007351 3300048914 Bacteria 7211
429 Ga0496111_0038339 3300048914 Bacteria 3434
430 Ga0496111_0105742 3300048914 Bacteria 2071
431 Ga0496112_0272621 3300048915 Bacteria 1640
432 Ga0496112_0427592 3300048915 Bacteria 1263
433 Ga0496113_0039573 3300048916 Bacteria 3470
434 Ga0496114_0001024 3300048917 Bacteria 21001
435 Ga0496114_0002096 3300048917 Bacteria 15161
436 Ga0496114_0146723 3300048917 Bacteria 2045
437 Ga0496114_0295140 3300048917 Bacteria 1430
438 Ga0496114_0379599 3300048917 Bacteria 1251
439 Ga0496115_0000582 3300048918 Bacteria 28154
440 Ga0496115_0003405 3300048918 Bacteria 11418
441 Ga0496115_0164252 3300048918 Bacteria 1836
442 Ga0496115_0188829 3300048918 Bacteria 1702
443 Ga0501031_0006904 3300049568 Bacteria 7409
444 Ga0501031_0007910 3300049568 Bacteria 6920
445 Ga0501031_0094763 3300049568 Bacteria 1947
446 Ga0501031_0164767 3300049568 Bacteria 1449
447 Ga0501032_0035338 3300049569 Bacteria 3417
448 Ga0501032_0056603 3300049569 Bacteria 2636
449 Ga0501033_0115598 3300049570 Bacteria 1949
450 Ga0501033_0341696 3300049570 Bacteria 1049
451 Ga0501034_0019302 3300049571 Bacteria 6976
452 Ga0501034_0440312 3300049571 Bacteria 1222
453 Ga0501036_0000560 3300049572 Bacteria 26720
454 Ga0501036_0046499 3300049572 Bacteria 3676
455 Ga0501036_0054977 3300049572 Bacteria 3372
456 Ga0501036_0224565 3300049572 Bacteria 1576
457 Ga0501036_0353237 3300049572 Bacteria 1227
458 Ga0501037_0036854 3300049573 Bacteria 3604
459 Ga0501037_0080300 3300049573 Bacteria 2367
460 Ga0501037_0085677 3300049573 Bacteria 2281
461 Ga0501037_0176613 3300049573 Bacteria 1516
462 Ga0501038_0018289 3300049574 Bacteria 6326
463 Ga0501038_0030973 3300049574 Bacteria 4730
464 Ga0501038_0087300 3300049574 Bacteria 2619
465 Ga0501038_0109552 3300049574 Bacteria 2288
466 Ga0501038_0197010 3300049574 Bacteria 1619
467 Ga0501039_0006006 3300049575 Bacteria 9209
468 Ga0501039_0011843 3300049575 Bacteria 6643
469 Ga0501039_0022712 3300049575 Bacteria 4813
470 Ga0501039_0065258 3300049575 Bacteria 2824
471 Ga0501039_0129455 3300049575 Bacteria 1980
472 Ga0501039_0264931 3300049575 Bacteria 1351
473 Ga0501039_0310388 3300049575 Bacteria 1240
474 Ga0501040_0002692 3300049576 Bacteria 11458
475 Ga0501040_0002922 3300049576 Bacteria 11052
476 Ga0501040_0003900 3300049576 Bacteria 9679
477 Ga0501040_0004718 3300049576 Bacteria 8850
478 Ga0501040_0009095 3300049576 Bacteria 6465
479 Ga0501040_0022242 3300049576 Bacteria 4242
480 Ga0501041_0009869 3300049577 Bacteria 5621
481 Ga0501041_0011683 3300049577 Bacteria 5196
482 Ga0501041_0018911 3300049577 Bacteria 4104
483 Ga0501041_0020648 3300049577 Bacteria 3939
484 Ga0501041_0224984 3300049577 Bacteria 1177
485 Ga0501042_0003011 3300049578 Bacteria 10481
486 Ga0501042_0008693 3300049578 Bacteria 6732
487 Ga0501042_0010246 3300049578 Bacteria 6274
488 Ga0501042_0071530 3300049578 Bacteria 2481
489 Ga0501042_0081449 3300049578 Bacteria 2320
490 Ga0501042_0109313 3300049578 Bacteria 1991
491 Ga0501042_0222583 3300049578 Bacteria 1361
492 Ga0501043_0012731 3300049579 Bacteria 6574
493 Ga0501043_0093179 3300049579 Bacteria 2368
494 Ga0501046_0013898 3300049580 Bacteria 6800
495 Ga0501046_0017956 3300049580 Bacteria 5896
496 Ga0501046_0062729 3300049580 Bacteria 2903
497 Ga0501047_0031214 3300049581 Bacteria 5139
498 Ga0501047_0132810 3300049581 Bacteria 2369
499 Ga0501048_0010391 3300049582 Bacteria 6951
500 Ga0501048_0020302 3300049582 Bacteria 4869
501 Ga0501048_0022268 3300049582 Bacteria 4637
502 Ga0501048_0056116 3300049582 Bacteria 2794
503 Ga0501048_0230255 3300049582 Bacteria 1315
504 Ga0501048_0350873 3300049582 Bacteria 1052
505 Ga0501067_0004665 3300049583 Bacteria 7583
506 Ga0501067_0042738 3300049583 Bacteria 2516
507 Ga0501068_0010778 3300049584 Bacteria 5140
508 Ga0501069_0004225 3300049585 Bacteria 7420
509 Ga0501069_0009787 3300049585 Bacteria 5067
510 Ga0501070_0080452 3300049586 Bacteria 2696
511 Ga0501070_0128909 3300049586 Bacteria 2090
512 Ga0501070_0182256 3300049586 Bacteria 1728
513 Ga0501071_0005907 3300049587 Bacteria 7918
514 Ga0501071_0007483 3300049587 Bacteria 7176
515 Ga0501071_0013806 3300049587 Bacteria 5512
516 Ga0501071_0061354 3300049587 Bacteria 2723
517 Ga0501071_0116427 3300049587 Bacteria 1978
518 Ga0501071_0183271 3300049587 Bacteria 1569
519 Ga0501072_0002551 3300049588 Bacteria 13647
520 Ga0501072_0003113 3300049588 Bacteria 12475
521 Ga0501072_0003655 3300049588 Bacteria 11588
522 Ga0501072_0011825 3300049588 Bacteria 6668
523 Ga0501072_0027290 3300049588 Bacteria 4455
524 Ga0501072_0030561 3300049588 Bacteria 4213
525 Ga0501072_0393690 3300049588 Bacteria 1099
526 Ga0501074_0007233 3300049590 Bacteria 8020
527 Ga0501074_0019108 3300049590 Bacteria 4975
528 Ga0501074_0022246 3300049590 Bacteria 4607
529 Ga0501074_0125560 3300049590 Bacteria 1835
530 Ga0501074_0373543 3300049590 Bacteria 1011
531 Ga0501075_0012816 3300049591 Bacteria 5968
532 Ga0501075_0027110 3300049591 Bacteria 4221
533 Ga0501075_0044425 3300049591 Bacteria 3334
534 Ga0501075_0048758 3300049591 Bacteria 3182
535 Ga0501075_0053128 3300049591 Bacteria 3047
536 Ga0501075_0057331 3300049591 Bacteria 2932
537 Ga0501075_0107252 3300049591 Bacteria 2123
538 Ga0501076_0008773 3300049592 Bacteria 7429
539 Ga0501076_0038371 3300049592 Bacteria 3760
540 Ga0501076_0049778 3300049592 Bacteria 3314
541 Ga0501076_0053813 3300049592 Bacteria 3190
542 Ga0501076_0065383 3300049592 Bacteria 2900
543 Ga0501076_0067490 3300049592 Bacteria 2856
544 Ga0501076_0179454 3300049592 Bacteria 1726
545 Ga0501077_0002026 3300049593 Bacteria 12224
546 Ga0501077_0003107 3300049593 Bacteria 9984
547 Ga0501077_0014120 3300049593 Bacteria 5011
548 Ga0501077_0034923 3300049593 Bacteria 3200
549 Ga0501077_0057722 3300049593 Bacteria 2464
550 Ga0501077_0081602 3300049593 Bacteria 2049
551 Ga0501077_0244383 3300049593 Bacteria 1141
552 Ga0501079_0011778 3300049741 Bacteria 6678
553 Ga0501079_0014740 3300049741 Bacteria 5958
554 Ga0501079_0031741 3300049741 Bacteria 4059
555 Ga0501079_0035590 3300049741 Bacteria 3833
556 Ga0501079_0055283 3300049741 Bacteria 3063
557 Ga0501079_0066269 3300049741 Bacteria 2786
558 Ga0501079_0208933 3300049741 Bacteria 1525
559 Ga0501079_0419222 3300049741 Bacteria 1051
560 Ga0501079_0557297 3300049741 Bacteria 901
561 Ga0501080_0004079 3300049742 Bacteria 12940
562 Ga0501080_0046822 3300049742 Bacteria 4025
563 Ga0501080_0113623 3300049742 Bacteria 2510
564 Ga0501080_0273707 3300049742 Bacteria 1536
565 Ga0501080_0363350 3300049742 Bacteria 1306
566 Ga0501081_0007919 3300049743 Bacteria 6891
567 Ga0501081_0010102 3300049743 Bacteria 6158
568 Ga0501081_0021825 3300049743 Bacteria 4277
569 Ga0501081_0022924 3300049743 Bacteria 4180
570 Ga0501083_0151820 3300049744 Bacteria 1516
571 Ga0501035_0006184 3300049822 Bacteria 11266
572 Ga0501035_0049384 3300049822 Bacteria 3770
573 Ga0501035_0070128 3300049822 Bacteria 3105
574 Ga0501044_0037497 3300049823 Bacteria 5066
575 Ga0501045_0000887 3300049824 Bacteria 19464
576 Ga0501045_0004417 3300049824 Bacteria 9706
577 Ga0501045_0014517 3300049824 Bacteria 5583
578 Ga0501045_0023380 3300049824 Bacteria 4429
579 Ga0501045_0130655 3300049824 Bacteria 1867
580 Ga0501045_0147629 3300049824 Bacteria 1750
581 Ga0501045_0293872 3300049824 Bacteria 1209
582 nmdc:mga05p37_777663_c1 3300050507 Bacteria 1051
583 nmdc:mga09592_194993_c1 3300050508 Bacteria 1753
584 nmdc:mga08y16_61340_c1 3300050511 Bacteria 3926
585 nmdc:mga0n895_257217_c1 3300050512 Bacteria 1772
586 nmdc:mga0n895_38969_c1 3300050512 Bacteria 4608
587 nmdc:mga0rr50_24039_c1 3300050513 Bacteria 4215
588 nmdc:mga0rr50_72879_c1 3300050513 Bacteria 2624
589 nmdc:mga08x19_70552_c1 3300050514 Bacteria 2277
590 nmdc:mga0a205_251023_c1 3300050515 Bacteria 1648
591 Ga0495601_0032258 3300053077 Bacteria 3260
592 Ga0495612_0085281 3300053078 Bacteria 1331
593 Ga0495655_0030024 3300053083 Unclassified 1312
594 Ga0495595_0095711 3300053084 Bacteria 1429
595 Ga0501084_0000453 3300054114 Bacteria 31556
596 Ga0501084_0003128 3300054114 Bacteria 13402
597 Ga0501084_0013220 3300054114 Bacteria 6830
598 Ga0501084_0015732 3300054114 Bacteria 6273
599 Ga0501084_0036541 3300054114 Bacteria 4102
600 Ga0501084_0041840 3300054114 Bacteria 3833
601 Ga0501084_0085755 3300054114 Bacteria 2644
602 Ga0501084_0115424 3300054114 Bacteria 2257
603 Ga0501084_0151549 3300054114 Bacteria 1954
604 Ga0590075_026339 3300059424 Bacteria 1464
605 Ga0590075_044470 3300059424 Bacteria 1137
606 Ga0590077_047936 3300059426 Bacteria 956
607 Ga0501082_0003088 3300060353 Bacteria 14522
608 Ga0501082_0028393 3300060353 Bacteria 4821
609 Ga0501082_0053735 3300060353 Bacteria 3471
610 Ga0501082_0085154 3300060353 Bacteria 2726
611 Ga0501082_0166128 3300060353 Bacteria 1918
612 Ga0501082_0241918 3300060353 Bacteria 1570
613 Ga0501082_0279221 3300060353 Bacteria 1454
614 Ga0501082_0346844 3300060353 Bacteria 1294
615 Ga0530510_0000145 3300061734 Bacteria 41886
616 Ga0530510_0000922 3300061734 Bacteria 19406
617 Ga0530510_0003321 3300061734 Bacteria 11065
618 Ga0530510_0015875 3300061734 Bacteria 5325
619 Ga0530510_0032997 3300061734 Bacteria 3727
620 Ga0530510_0034835 3300061734 Bacteria 3627
621 Ga0530510_0264637 3300061734 Bacteria 1283
622 Ga0530510_0457373 3300061734 Bacteria 965
623 2555469028 2554235283 Bacteria 3683090
624 2644739998 2643221735 Bacteria 3676263
625 2819724811 2818991468 Bacteria 3723169
626 2908665693 2908665501 Bacteria 3678115
627 2919094134 2919093281 Bacteria 3660974
628 2919728995 2919726948 Bacteria 3696050
629 2954774467 2954773129 Bacteria 3741715
630 Ga0068855_100720356
631 JGI24034J26672_10007966
632 JGI25151J46595_10000012
633 Ga0070658_10056716
634 Ga0070683_100004784
635 Ga0070683_100244671
636 Ga0070683_100556369
637 Ga0070690_100161380
638 Ga0070670_100129364
639 Ga0068869_100013356
640 Ga0070682_100062469
641 Ga0070682_100390513
642 Ga0068868_100007590
643 Ga0068868_100023336
644 Ga0068868_100107651
645 Ga0070660_100077720
646 Ga0070689_100034243
647 Ga0070687_100079096
648 Ga0070692_10094144
649 Ga0070674_100049656
650 Ga0070673_100018896
651 Ga0070673_100073949
652 Ga0070688_100031212
653 Ga0070659_100036918
654 Ga0070703_10077203
655 Ga0070709_10041102
656 Ga0070709_10214889
657 Ga0070714_100010921
658 Ga0070714_100016463
659 Ga0070713_100047874
660 Ga0070713_100277484
661 Ga0070710_10019818
662 Ga0070701_10008202
663 Ga0070711_100009946
664 Ga0070705_100051238
665 Ga0070705_100075635
666 Ga0070700_100013062
667 Ga0070700_100019221
668 Ga0070700_100078091
669 Ga0070708_100077536
670 Ga0070708_100721171
671 Ga0070663_100056121
672 Ga0070663_100058068
673 Ga0070678_100303465
674 Ga0068867_100073483
675 Ga0068867_100211594
676 Ga0070685_10007946
677 Ga0070706_100017069
678 Ga0070707_100089202
679 Ga0070698_100007770
680 Ga0070679_100168939
681 Ga0070684_100000173
682 Ga0070684_100008885
683 Ga0070684_100129986
684 Ga0070684_100162632
685 Ga0070686_100033891
686 Ga0070686_100069440
687 Ga0070696_100023638
688 Ga0070696_100038923
689 Ga0070693_100020970
690 Ga0070693_100123512
691 Ga0070693_100201285
692 Ga0070665_100029228
693 Ga0070665_100074660
694 Ga0070665_100158677
695 Ga0070704_100056853
696 Ga0068855_100048076
697 Ga0068855_100050477
698 Ga0070664_100036868
699 Ga0070664_100260889
700 Ga0068857_100002531
701 Ga0068857_100018211
702 Ga0068857_100027441
703 Ga0068854_100024464
704 Ga0068854_100094802
705 Ga0068854_100103175
706 Ga0068856_100003956
707 Ga0068856_100019704
708 Ga0068856_100088352
709 Ga0070702_100202717
710 Ga0068859_100235922
711 Ga0068864_100063634
712 Ga0068864_100281818
713 Ga0068866_10018985
714 Ga0068866_10106875
715 Ga0068861_100054622
716 Ga0068870_10024034
717 Ga0068870_10026274
718 Ga0068870_10179919
719 Ga0068863_100041279
720 Ga0068858_100046190
721 Ga0068858_100180869
722 Ga0068858_100231376
723 Ga0068860_100336901
724 Ga0068862_100814495
725 Ga0081455_10026032
726 Ga0081455_10044612
727 Ga0081455_10189662
728 Ga0081538_10000052
729 Ga0081538_10001074
730 Ga0081540_1026716
731 Ga0081539_10000397
732 Ga0070717_10024720
733 Ga0075432_10013682
734 Ga0070716_100012223
735 Ga0070716_100031731
736 Ga0070712_100001474
737 Ga0097621_100055332
738 Ga0097621_100377587
739 Ga0068871_100114229
740 Ga0068871_100144027
741 Ga0075428_100249422
742 Ga0075428_100576918
743 Ga0075434_100004757
744 Ga0068865_100144499
745 Ga0068865_100229773
746 Ga0097620_100235912
747 Ga0075435_100014613
748 Ga0075435_100017065
749 Ga0105240_10010457
750 Ga0111539_10333336
751 Ga0105245_10057989
752 Ga0105245_10061431
753 Ga0105245_10064894
754 Ga0105245_10094826
755 Ga0105245_10414297
756 Ga0105247_10069500
757 Ga0114129_10037285
758 Ga0105243_10115504
759 Ga0105243_10149459
760 Ga0105243_10753429
761 Ga0105241_10112693
762 Ga0105241_10137224
763 Ga0105241_10375632
764 Ga0105242_10057548
765 Ga0105242_10087479
766 Ga0105242_10113193
767 Ga0105242_10510056
768 Ga0105242_10824025
769 Ga0105248_10064367
770 Ga0105248_10214402
771 Ga0105237_10043829
772 Ga0105237_10215261
773 Ga0105238_10031825
774 Ga0105238_10247593
775 Ga0105238_10319076
776 Ga0105239_10080041
777 Ga0105239_10170664
778 Ga0105246_10197945
779 Ga0105246_10296358
780 Ga0157369_10014592
781 Ga0157374_10047924
782 Ga0157374_10066481
783 Ga0163162_10235566
784 Ga0163162_10293022
785 Ga0163162_11233299
786 Ga0157372_10028616
787 Ga0157372_10050621
788 Ga0157372_10057353
789 Ga0157372_10900361
790 Ga0157375_10538103
791 Ga0157377_10071981
792 Ga0157377_10097720
793 Ga0157379_10040606
794 Ga0157379_10046509
795 Ga0157376_10007354
796 Ga0157376_10121627
797 Ga0157376_10199731
798 Ga0163161_10231739
799 Ga0206356_10026517
800 Ga0206353_11918524
801 Ga0207692_10002734
802 Ga0207692_10065101
803 Ga0207642_10020300
804 Ga0207688_10009605
805 Ga0207688_10076495
806 Ga0207680_10301105
807 Ga0207685_10028563
808 Ga0207699_10233101
809 Ga0207643_10062433
810 Ga0207643_10125501
811 Ga0207684_10014049
812 Ga0207654_10077032
813 Ga0207707_10012796
814 Ga0207707_10020140
815 Ga0207707_10070187
816 Ga0207707_10142350
817 Ga0207695_10004861
818 Ga0207671_10065444
819 Ga0207671_10120512
820 Ga0207671_10149176
821 Ga0207693_10009154
822 Ga0207693_10015753
823 Ga0207663_10009163
824 Ga0207663_10077630
825 Ga0207660_10005388
826 Ga0207660_10139530
827 Ga0207662_10021101
828 Ga0207657_10004471
829 Ga0207657_10020865
830 Ga0207657_10377437
831 Ga0207649_10054832
832 Ga0207652_10013273
833 Ga0207652_10019257
834 Ga0207694_10041416
835 Ga0207650_10445298
836 Ga0207659_10014048
837 Ga0207687_10000216
838 Ga0207687_10029028
839 Ga0207687_10131553
840 Ga0207687_10148747
841 Ga0207700_10000001
842 Ga0207700_10069525
843 Ga0207700_10353030
844 Ga0207664_10001804
845 Ga0207664_10198439
846 Ga0207644_10086465
847 Ga0207644_10649127
848 Ga0207690_10143482
849 Ga0207690_10408042
850 Ga0207706_10154642
851 Ga0207706_10179954
852 Ga0207706_10501466
853 Ga0207686_10102659
854 Ga0207686_10275081
855 Ga0207709_10016013
856 Ga0207709_10020283
857 Ga0207709_10494712
858 Ga0207704_10086531
859 Ga0207704_10273115
860 Ga0207665_10005420
861 Ga0207665_10034610
862 Ga0207711_10026708
863 Ga0207689_10042942
864 Ga0207689_10083675
865 Ga0207689_10103538
866 Ga0207689_10213684
867 Ga0207661_10005866
868 Ga0207661_10013252
869 Ga0207661_10239960
870 Ga0207679_10021459
871 Ga0207679_10135572
872 Ga0207667_10402075
873 Ga0207712_10072993
874 Ga0207668_10154070
875 Ga0207640_10049034
876 Ga0207640_10061111
877 Ga0207640_10061931
878 Ga0207640_10391909
879 Ga0207677_10005449
880 Ga0207677_10035544
881 Ga0207677_10343180
882 Ga0207703_10013795
883 Ga0207703_10255307
884 Ga0207639_10059562
885 Ga0207678_10050875
886 Ga0207708_10031941
887 Ga0207702_10003318
888 Ga0207702_10020122
889 Ga0207702_10027927
890 Ga0207702_10172337
891 Ga0207648_10021343
892 Ga0207648_10029227
893 Ga0207648_10059515
894 Ga0207676_10031850
895 Ga0207676_10130394
896 Ga0207676_10338644
897 Ga0207674_10016117
898 Ga0207674_10017004
899 Ga0207674_10038047
900 Ga0207674_10071319
901 Ga0207675_100018724
902 Ga0207683_10003250
903 Ga0207683_10023319
904 Ga0207683_10132025
905 Ga0207698_10020867
906 Ga0207698_10041237
907 Ga0207698_10166971
908 Ga0207698_10397479
909 Ga0207428_10033371
910 Ga0268266_10036441
911 Ga0268264_10100998
912 Ga0265327_10012011
913 Ga0307413_10447930
914 Ga0307406_10018394
915 Ga0307409_100037026
916 Ga0307409_100245274
917 Ga0307409_100377613
918 Ga0307416_100110380
919 Ga0307415_100000791
920 Ga0307415_100211055
921 Ga0373930_0037577
922 Ga0373941_0009095
923 Ga0373941_0031963
924 Ga0373955_0284217
925 Ga0373942_0004083
926 Ga0373935_0243798
927 Ga0373935_0348029
928 Ga0316584_0097985
929 Ga0395899_0017624
930 Ga0395899_0032843
931 Ga0395900_0011746
932 Ga0395900_0015227
933 Ga0395900_0020327
934 Ga0395900_0166081
935 Ga0395900_0457066
936 Ga0395898_0003973
937 Ga0395898_0009419
938 Ga0395898_0012105
939 Ga0395898_0031760
940 Ga0395898_0064459
941 Ga0395898_0193501
942 Ga0395898_0293531
943 Ga0395905_0001332
944 Ga0395905_0002140
945 Ga0395905_0006033
946 Ga0395905_0062753
947 Ga0395905_0205428
948 Ga0395901_0003092
949 Ga0395901_0018423
950 Ga0395901_0020135
951 Ga0395901_0029188
952 Ga0395901_0035614
953 Ga0395901_0231387
954 Ga0439461_0016348
955 Ga0439433_0001782
956 Ga0439448_0076319
957 Ga0439452_038130
958 Ga0450898_004517
959 Ga0439446_0003136
960 Ga0439446_0017496
961 Ga0439434_0007482
962 Ga0439434_0047405
963 Ga0466963_0001587
964 Ga0466963_0020629
965 Ga0466963_0023895
966 Ga0466963_0088491
967 Ga0466964_0219865
968 Ga0453684_0559802
969 Ga0466957_0009613
970 Ga0466960_0002081
971 Ga0466958_0005666
972 Ga0466958_0024239
973 Ga0466967_0000555
974 Ga0466967_0014314
975 Ga0466967_0022767
976 Ga0466967_0027717
977 Ga0466967_0299787
978 Ga0495629_0287657
979 Ga0495582_0022614
980 Ga0495582_0086865
981 Ga0495662_0111597
982 Ga0495584_0100028
983 Ga0495584_0143892
984 Ga0495596_0038320
985 Ga0495630_0354328
986 Ga0495663_0007023
987 Ga0495609_0075319
988 Ga0495656_0028893
989 Ga0495611_0116239
990 Ga0495588_0237156
991 Ga0495647_0034315
992 Ga0495658_0077221
993 Ga0495658_0111647
994 Ga0495658_0135399
995 Ga0495613_0122811
996 Ga0495624_0072630
997 Ga0495671_0089847
998 Ga0495660_0119257
999 Ga0495581_0007101
1000 Ga0495581_0049433
1001 Ga0495636_0089250
1002 Ga0495676_0073125
1003 Ga0495677_0023733
1004 Ga0495679_045111
1005 Ga0495614_0104878
1006 Ga0495614_0111129
1007 Ga0496100_0000562
1008 Ga0496100_0009228
1009 Ga0496100_0014649
1010 Ga0496100_0028760
1011 Ga0496101_0019065
1012 Ga0496101_0036097
1013 Ga0496101_0240118
1014 Ga0496101_0343497
1015 Ga0496102_0012885
1016 Ga0496102_0021890
1017 Ga0496102_0047476
1018 Ga0496102_0223257
1019 Ga0496102_0887246
1020 Ga0496103_0008185
1021 Ga0496103_0016560
1022 Ga0496104_0008718
1023 Ga0496104_0064659
1024 Ga0496104_0109017
1025 Ga0496104_0112435
1026 Ga0496104_0161402
1027 Ga0496105_0035273
1028 Ga0496105_0035586
1029 Ga0496105_0089868
1030 Ga0496105_0151614
1031 Ga0496106_0000947
1032 Ga0496106_0008736
1033 Ga0496106_0023453
1034 Ga0496106_0150168
1035 Ga0496107_0005049
1036 Ga0496107_0005428
1037 Ga0496107_0028999
1038 Ga0496107_0041296
1039 Ga0496107_0149791
1040 Ga0496107_0195616
1041 Ga0496108_0000624
1042 Ga0496108_0002781
1043 Ga0496108_0017252
1044 Ga0496108_0267338
1045 Ga0496109_0003289
1046 Ga0496109_0003615
1047 Ga0496109_0021879
1048 Ga0496109_0069085
1049 Ga0496109_0275143
1050 Ga0496110_0005543
1051 Ga0496110_0012925
1052 Ga0496110_0032605
1053 Ga0496110_0060984
1054 Ga0496110_0100082
1055 Ga0496110_0109704
1056 Ga0496110_0628696
1057 Ga0496111_0007351
1058 Ga0496111_0038339
1059 Ga0496111_0105742
1060 Ga0496112_0272621
1061 Ga0496112_0427592
1062 Ga0496113_0039573
1063 Ga0496114_0001024
1064 Ga0496114_0002096
1065 Ga0496114_0146723
1066 Ga0496114_0295140
1067 Ga0496114_0379599
1068 Ga0496115_0000582
1069 Ga0496115_0003405
1070 Ga0496115_0164252
1071 Ga0496115_0188829
1072 Ga0501031_0006904
1073 Ga0501031_0007910
1074 Ga0501031_0094763
1075 Ga0501031_0164767
1076 Ga0501032_0035338
1077 Ga0501032_0056603
1078 Ga0501033_0115598
1079 Ga0501033_0341696
1080 Ga0501034_0019302
1081 Ga0501034_0440312
1082 Ga0501036_0000560
1083 Ga0501036_0046499
1084 Ga0501036_0054977
1085 Ga0501036_0224565
1086 Ga0501036_0353237
1087 Ga0501037_0036854
1088 Ga0501037_0080300
1089 Ga0501037_0085677
1090 Ga0501037_0176613
1091 Ga0501038_0018289
1092 Ga0501038_0030973
1093 Ga0501038_0087300
1094 Ga0501038_0109552
1095 Ga0501038_0197010
1096 Ga0501039_0006006
1097 Ga0501039_0011843
1098 Ga0501039_0022712
1099 Ga0501039_0065258
1100 Ga0501039_0129455
1101 Ga0501039_0264931
1102 Ga0501039_0310388
1103 Ga0501040_0002692
1104 Ga0501040_0002922
1105 Ga0501040_0003900
1106 Ga0501040_0004718
1107 Ga0501040_0009095
1108 Ga0501040_0022242
1109 Ga0501041_0009869
1110 Ga0501041_0011683
1111 Ga0501041_0018911
1112 Ga0501041_0020648
1113 Ga0501041_0224984
1114 Ga0501042_0003011
1115 Ga0501042_0008693
1116 Ga0501042_0010246
1117 Ga0501042_0071530
1118 Ga0501042_0081449
1119 Ga0501042_0109313
1120 Ga0501042_0222583
1121 Ga0501043_0012731
1122 Ga0501043_0093179
1123 Ga0501046_0013898
1124 Ga0501046_0017956
1125 Ga0501046_0062729
1126 Ga0501047_0031214
1127 Ga0501047_0132810
1128 Ga0501048_0010391
1129 Ga0501048_0020302
1130 Ga0501048_0022268
1131 Ga0501048_0056116
1132 Ga0501048_0230255
1133 Ga0501048_0350873
1134 Ga0501067_0004665
1135 Ga0501067_0042738
1136 Ga0501068_0010778
1137 Ga0501069_0004225
1138 Ga0501069_0009787
1139 Ga0501070_0080452
1140 Ga0501070_0128909
1141 Ga0501070_0182256
1142 Ga0501071_0005907
1143 Ga0501071_0007483
1144 Ga0501071_0013806
1145 Ga0501071_0061354
1146 Ga0501071_0116427
1147 Ga0501071_0183271
1148 Ga0501072_0002551
1149 Ga0501072_0003113
1150 Ga0501072_0003655
1151 Ga0501072_0011825
1152 Ga0501072_0027290
1153 Ga0501072_0030561
1154 Ga0501072_0393690
1155 Ga0501074_0007233
1156 Ga0501074_0019108
1157 Ga0501074_0022246
1158 Ga0501074_0125560
1159 Ga0501074_0373543
1160 Ga0501075_0012816
1161 Ga0501075_0027110
1162 Ga0501075_0044425
1163 Ga0501075_0048758
1164 Ga0501075_0053128
1165 Ga0501075_0057331
1166 Ga0501075_0107252
1167 Ga0501076_0008773
1168 Ga0501076_0038371
1169 Ga0501076_0049778
1170 Ga0501076_0053813
1171 Ga0501076_0065383
1172 Ga0501076_0067490
1173 Ga0501076_0179454
1174 Ga0501077_0002026
1175 Ga0501077_0003107
1176 Ga0501077_0014120
1177 Ga0501077_0034923
1178 Ga0501077_0057722
1179 Ga0501077_0081602
1180 Ga0501077_0244383
1181 Ga0501079_0011778
1182 Ga0501079_0014740
1183 Ga0501079_0031741
1184 Ga0501079_0035590
1185 Ga0501079_0055283
1186 Ga0501079_0066269
1187 Ga0501079_0208933
1188 Ga0501079_0419222
1189 Ga0501079_0557297
1190 Ga0501080_0004079
1191 Ga0501080_0046822
1192 Ga0501080_0113623
1193 Ga0501080_0273707
1194 Ga0501080_0363350
1195 Ga0501081_0007919
1196 Ga0501081_0010102
1197 Ga0501081_0021825
1198 Ga0501081_0022924
1199 Ga0501083_0151820
1200 Ga0501035_0006184
1201 Ga0501035_0049384
1202 Ga0501035_0070128
1203 Ga0501044_0037497
1204 Ga0501045_0000887
1205 Ga0501045_0004417
1206 Ga0501045_0014517
1207 Ga0501045_0023380
1208 Ga0501045_0130655
1209 Ga0501045_0147629
1210 Ga0501045_0293872
1211 nmdc:mga05p37_777663_c1
1212 nmdc:mga09592_194993_c1
1213 nmdc:mga08y16_61340_c1
1214 nmdc:mga0n895_257217_c1
1215 nmdc:mga0n895_38969_c1
1216 nmdc:mga0rr50_24039_c1
1217 nmdc:mga0rr50_72879_c1
1218 nmdc:mga08x19_70552_c1
1219 nmdc:mga0a205_251023_c1
1220 Ga0495601_0032258
1221 Ga0495612_0085281
1222 Ga0495655_0030024
1223 Ga0495595_0095711
1224 Ga0501084_0000453
1225 Ga0501084_0003128
1226 Ga0501084_0013220
1227 Ga0501084_0015732
1228 Ga0501084_0036541
1229 Ga0501084_0041840
1230 Ga0501084_0085755
1231 Ga0501084_0115424
1232 Ga0501084_0151549
1233 Ga0590075_026339
1234 Ga0590075_044470
1235 Ga0590077_047936
1236 Ga0501082_0003088
1237 Ga0501082_0028393
1238 Ga0501082_0053735
1239 Ga0501082_0085154
1240 Ga0501082_0166128
1241 Ga0501082_0241918
1242 Ga0501082_0279221
1243 Ga0501082_0346844
1244 Ga0530510_0000145
1245 Ga0530510_0000922
1246 Ga0530510_0003321
1247 Ga0530510_0015875
1248 Ga0530510_0032997
1249 Ga0530510_0034835
1250 Ga0530510_0264637
1251 Ga0530510_0457373
1252 2555469028
1253 2644739998
1254 2819724811
1255 2908665693
1256 2919094134
1257 2919728995
1258 2954774467

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13277

YmdB

YmdB-like protein

38

288

0.98

PF00149

Metallophos

Calcineurin-like phosphoesterase

35

214

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9505 1 245
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9356 1 245
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.9259 1 244
2cv9-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9158 1 246
1t71-assembly1.cif.gz_A crystal structure of a novel phosphatase mycoplasma pneumoniaefrom 0.9094 1 244
ID Description Score Start End Superfamily
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9505 1 245 3.60.21.10
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9356 1 245 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9196 1 246 3.60.21.10
1t71A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9094 1 244 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9089 1 246 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A535CKE3-F1-model_v4 YmdB family metallophosphoesterase 0.9904 1 72 GO:0004113
AF-A0A7V9JJ74-F1-model_v4 YmdB family metallophosphoesterase 0.9893 10 123 GO:0004113
AF-A0A435NMD2-F1-model_v4 deleted 0.9887 1 90
AF-A0A529M3P3-F1-model_v4 Metallophosphoesterase 0.9871 1 74 GO:0004113
AF-A0A3B0TKD1-F1-model_v4 Metallophosphoesterase 0.9863 1 70 GO:0004113

Map