F470719
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 629 | 275 | 1258 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100720356|Ga0068855_1007203562 |
| Length | 293 |
| Sequence | VSNARRSHASLRTPATTSRCPCTTPPPCRPRNAALKILFVADVFGTPGRAAVEERLAGLKEELGAGFCVVNGENVADGSGITPRLAERLLAAGADVLTLGNHVWRRREINDYLEGAERVVRPANLGASAPGRGLVVVPAADGTPVAVVNLQGSLFMQTPVGPFELVDDLVEQARSQAKVIVVDFHAEATSEKIALARVLDGRVTAVIGTHTHVQTSDARVQAGGTAAITDAGMTGPHDSVIGVKAELAIRRMRTGMPVRFEPASGGVRIEGALIECGAEGRALSCEAVRVPVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 157 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 158 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 169 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 170 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 171 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 172 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 173 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 174 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 175 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 176 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 177 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 178 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 179 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 180 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 181 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 182 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 220 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 221 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 266 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 269 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 270 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 271 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 272 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 273 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 274 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 275 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.57 |
| Metatranscriptomes | 0.32 |
| Isolates | 1.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0 |
| Rhizoplane | 10.33 |
| Rhizosphere | 89.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068855_100720356 | 3300005563 | Bacteria | 1066 |
| 2 | JGI24034J26672_10007966 | 3300002239 | Bacteria | 1544 |
| 3 | JGI25151J46595_10000012 | 3300003187 | Bacteria | 254028 |
| 4 | Ga0070658_10056716 | 3300005327 | Bacteria | 3184 |
| 5 | Ga0070683_100004784 | 3300005329 | Bacteria | 11205 |
| 6 | Ga0070683_100244671 | 3300005329 | Bacteria | 1706 |
| 7 | Ga0070683_100556369 | 3300005329 | Bacteria | 1097 |
| 8 | Ga0070690_100161380 | 3300005330 | Bacteria | 1536 |
| 9 | Ga0070670_100129364 | 3300005331 | Bacteria | 2179 |
| 10 | Ga0068869_100013356 | 3300005334 | Bacteria | 5461 |
| 11 | Ga0070682_100062469 | 3300005337 | Bacteria | 2359 |
| 12 | Ga0070682_100390513 | 3300005337 | Bacteria | 1049 |
| 13 | Ga0068868_100007590 | 3300005338 | Bacteria | 7729 |
| 14 | Ga0068868_100023336 | 3300005338 | Bacteria | 4681 |
| 15 | Ga0068868_100107651 | 3300005338 | Bacteria | 2262 |
| 16 | Ga0070660_100077720 | 3300005339 | Bacteria | 2601 |
| 17 | Ga0070689_100034243 | 3300005340 | Bacteria | 3875 |
| 18 | Ga0070687_100079096 | 3300005343 | Bacteria | 1789 |
| 19 | Ga0070692_10094144 | 3300005345 | Bacteria | 1633 |
| 20 | Ga0070674_100049656 | 3300005356 | Bacteria | 2885 |
| 21 | Ga0070673_100018896 | 3300005364 | Bacteria | 4939 |
| 22 | Ga0070673_100073949 | 3300005364 | Bacteria | 2745 |
| 23 | Ga0070688_100031212 | 3300005365 | Bacteria | 3204 |
| 24 | Ga0070659_100036918 | 3300005366 | Bacteria | 3809 |
| 25 | Ga0070703_10077203 | 3300005406 | Bacteria | 1126 |
| 26 | Ga0070709_10041102 | 3300005434 | Bacteria | 2847 |
| 27 | Ga0070709_10214889 | 3300005434 | Bacteria | 1368 |
| 28 | Ga0070714_100010921 | 3300005435 | Bacteria | 7191 |
| 29 | Ga0070714_100016463 | 3300005435 | Bacteria | 5972 |
| 30 | Ga0070713_100047874 | 3300005436 | Bacteria | 3517 |
| 31 | Ga0070713_100277484 | 3300005436 | Bacteria | 1536 |
| 32 | Ga0070710_10019818 | 3300005437 | Bacteria | 3482 |
| 33 | Ga0070701_10008202 | 3300005438 | Bacteria | 4504 |
| 34 | Ga0070711_100009946 | 3300005439 | Bacteria | 5868 |
| 35 | Ga0070705_100051238 | 3300005440 | Bacteria | 2406 |
| 36 | Ga0070705_100075635 | 3300005440 | Bacteria | 2051 |
| 37 | Ga0070700_100013062 | 3300005441 | Bacteria | 4657 |
| 38 | Ga0070700_100019221 | 3300005441 | Bacteria | 3941 |
| 39 | Ga0070700_100078091 | 3300005441 | Bacteria | 2130 |
| 40 | Ga0070708_100077536 | 3300005445 | Bacteria | 3003 |
| 41 | Ga0070708_100721171 | 3300005445 | Bacteria | 938 |
| 42 | Ga0070663_100056121 | 3300005455 | Bacteria | 2821 |
| 43 | Ga0070663_100058068 | 3300005455 | Bacteria | 2777 |
| 44 | Ga0070678_100303465 | 3300005456 | Bacteria | 1357 |
| 45 | Ga0068867_100073483 | 3300005459 | Unclassified | 2560 |
| 46 | Ga0068867_100211594 | 3300005459 | Bacteria | 1557 |
| 47 | Ga0070685_10007946 | 3300005466 | Bacteria | 5436 |
| 48 | Ga0070706_100017069 | 3300005467 | Bacteria | 6706 |
| 49 | Ga0070707_100089202 | 3300005468 | Bacteria | 2983 |
| 50 | Ga0070698_100007770 | 3300005471 | Bacteria | 11605 |
| 51 | Ga0070679_100168939 | 3300005530 | Bacteria | 2160 |
| 52 | Ga0070684_100000173 | 3300005535 | Bacteria | 44303 |
| 53 | Ga0070684_100008885 | 3300005535 | Bacteria | 7882 |
| 54 | Ga0070684_100129986 | 3300005535 | Bacteria | 2271 |
| 55 | Ga0070684_100162632 | 3300005535 | Bacteria | 2026 |
| 56 | Ga0070686_100033891 | 3300005544 | Bacteria | 3141 |
| 57 | Ga0070686_100069440 | 3300005544 | Bacteria | 2301 |
| 58 | Ga0070696_100023638 | 3300005546 | Bacteria | 4177 |
| 59 | Ga0070696_100038923 | 3300005546 | Bacteria | 3283 |
| 60 | Ga0070693_100020970 | 3300005547 | Bacteria | 3454 |
| 61 | Ga0070693_100123512 | 3300005547 | Bacteria | 1609 |
| 62 | Ga0070693_100201285 | 3300005547 | Bacteria | 1293 |
| 63 | Ga0070665_100029228 | 3300005548 | Bacteria | 5548 |
| 64 | Ga0070665_100074660 | 3300005548 | Bacteria | 3396 |
| 65 | Ga0070665_100158677 | 3300005548 | Bacteria | 2263 |
| 66 | Ga0070704_100056853 | 3300005549 | Bacteria | 2779 |
| 67 | Ga0068855_100048076 | 3300005563 | Bacteria | 5036 |
| 68 | Ga0068855_100050477 | 3300005563 | Bacteria | 4902 |
| 69 | Ga0070664_100036868 | 3300005564 | Bacteria | 4109 |
| 70 | Ga0070664_100260889 | 3300005564 | Bacteria | 1559 |
| 71 | Ga0068857_100002531 | 3300005577 | Bacteria | 14961 |
| 72 | Ga0068857_100018211 | 3300005577 | Bacteria | 6159 |
| 73 | Ga0068857_100027441 | 3300005577 | Bacteria | 5023 |
| 74 | Ga0068854_100024464 | 3300005578 | Bacteria | 4135 |
| 75 | Ga0068854_100094802 | 3300005578 | Bacteria | 2227 |
| 76 | Ga0068854_100103175 | 3300005578 | Bacteria | 2140 |
| 77 | Ga0068856_100003956 | 3300005614 | Bacteria | 14838 |
| 78 | Ga0068856_100019704 | 3300005614 | Bacteria | 6547 |
| 79 | Ga0068856_100088352 | 3300005614 | Bacteria | 3081 |
| 80 | Ga0070702_100202717 | 3300005615 | Bacteria | 1314 |
| 81 | Ga0068859_100235922 | 3300005617 | Bacteria | 1918 |
| 82 | Ga0068864_100063634 | 3300005618 | Bacteria | 3197 |
| 83 | Ga0068864_100281818 | 3300005618 | Bacteria | 1551 |
| 84 | Ga0068866_10018985 | 3300005718 | Bacteria | 3120 |
| 85 | Ga0068866_10106875 | 3300005718 | Bacteria | 1554 |
| 86 | Ga0068861_100054622 | 3300005719 | Bacteria | 3043 |
| 87 | Ga0068870_10024034 | 3300005840 | Bacteria | 3012 |
| 88 | Ga0068870_10026274 | 3300005840 | Bacteria | 2901 |
| 89 | Ga0068870_10179919 | 3300005840 | Bacteria | 1268 |
| 90 | Ga0068863_100041279 | 3300005841 | Bacteria | 4386 |
| 91 | Ga0068858_100046190 | 3300005842 | Bacteria | 4037 |
| 92 | Ga0068858_100180869 | 3300005842 | Bacteria | 1991 |
| 93 | Ga0068858_100231376 | 3300005842 | Bacteria | 1752 |
| 94 | Ga0068860_100336901 | 3300005843 | Bacteria | 1483 |
| 95 | Ga0068862_100814495 | 3300005844 | Bacteria | 913 |
| 96 | Ga0081455_10026032 | 3300005937 | Bacteria | 5389 |
| 97 | Ga0081455_10044612 | 3300005937 | Bacteria | 3865 |
| 98 | Ga0081455_10189662 | 3300005937 | Bacteria | 1549 |
| 99 | Ga0081538_10000052 | 3300005981 | Bacteria | 109642 |
| 100 | Ga0081538_10001074 | 3300005981 | Bacteria | 29047 |
| 101 | Ga0081540_1026716 | 3300005983 | Unclassified | 3287 |
| 102 | Ga0081539_10000397 | 3300005985 | Bacteria | 93458 |
| 103 | Ga0070717_10024720 | 3300006028 | Bacteria | 4772 |
| 104 | Ga0075432_10013682 | 3300006058 | Bacteria | 2758 |
| 105 | Ga0070716_100012223 | 3300006173 | Bacteria | 4346 |
| 106 | Ga0070716_100031731 | 3300006173 | Bacteria | 2876 |
| 107 | Ga0070712_100001474 | 3300006175 | Bacteria | 14338 |
| 108 | Ga0097621_100055332 | 3300006237 | Bacteria | 3239 |
| 109 | Ga0097621_100377587 | 3300006237 | Bacteria | 1265 |
| 110 | Ga0068871_100114229 | 3300006358 | Bacteria | 2275 |
| 111 | Ga0068871_100144027 | 3300006358 | Bacteria | 2028 |
| 112 | Ga0075428_100249422 | 3300006844 | Bacteria | 1914 |
| 113 | Ga0075428_100576918 | 3300006844 | Bacteria | 1202 |
| 114 | Ga0075434_100004757 | 3300006871 | Bacteria | 12289 |
| 115 | Ga0068865_100144499 | 3300006881 | Bacteria | 1797 |
| 116 | Ga0068865_100229773 | 3300006881 | Bacteria | 1455 |
| 117 | Ga0097620_100235912 | 3300006931 | Bacteria | 1918 |
| 118 | Ga0075435_100014613 | 3300007076 | Bacteria | 5876 |
| 119 | Ga0075435_100017065 | 3300007076 | Bacteria | 5485 |
| 120 | Ga0105240_10010457 | 3300009093 | Bacteria | 13040 |
| 121 | Ga0111539_10333336 | 3300009094 | Bacteria | 1766 |
| 122 | Ga0105245_10057989 | 3300009098 | Bacteria | 3485 |
| 123 | Ga0105245_10061431 | 3300009098 | Bacteria | 3387 |
| 124 | Ga0105245_10064894 | 3300009098 | Bacteria | 3300 |
| 125 | Ga0105245_10094826 | 3300009098 | Bacteria | 2751 |
| 126 | Ga0105245_10414297 | 3300009098 | Unclassified | 1349 |
| 127 | Ga0105247_10069500 | 3300009101 | Bacteria | 2198 |
| 128 | Ga0114129_10037285 | 3300009147 | Bacteria | 6864 |
| 129 | Ga0105243_10115504 | 3300009148 | Bacteria | 2254 |
| 130 | Ga0105243_10149459 | 3300009148 | Unclassified | 2002 |
| 131 | Ga0105243_10753429 | 3300009148 | Bacteria | 955 |
| 132 | Ga0105241_10112693 | 3300009174 | Bacteria | 2179 |
| 133 | Ga0105241_10137224 | 3300009174 | Bacteria | 1987 |
| 134 | Ga0105241_10375632 | 3300009174 | Bacteria | 1241 |
| 135 | Ga0105242_10057548 | 3300009176 | Bacteria | 3185 |
| 136 | Ga0105242_10087479 | 3300009176 | Bacteria | 2616 |
| 137 | Ga0105242_10113193 | 3300009176 | Bacteria | 2317 |
| 138 | Ga0105242_10510056 | 3300009176 | Bacteria | 1145 |
| 139 | Ga0105242_10824025 | 3300009176 | Bacteria | 921 |
| 140 | Ga0105248_10064367 | 3300009177 | Bacteria | 4117 |
| 141 | Ga0105248_10214402 | 3300009177 | Bacteria | 2169 |
| 142 | Ga0105237_10043829 | 3300009545 | Bacteria | 4505 |
| 143 | Ga0105237_10215261 | 3300009545 | Bacteria | 1921 |
| 144 | Ga0105238_10031825 | 3300009551 | Bacteria | 5368 |
| 145 | Ga0105238_10247593 | 3300009551 | Bacteria | 1760 |
| 146 | Ga0105238_10319076 | 3300009551 | Bacteria | 1539 |
| 147 | Ga0105239_10080041 | 3300010375 | Bacteria | 3595 |
| 148 | Ga0105239_10170664 | 3300010375 | Bacteria | 2432 |
| 149 | Ga0105246_10197945 | 3300011119 | Bacteria | 1560 |
| 150 | Ga0105246_10296358 | 3300011119 | Bacteria | 1304 |
| 151 | Ga0157369_10014592 | 3300013105 | Bacteria | 8864 |
| 152 | Ga0157374_10047924 | 3300013296 | Bacteria | 3963 |
| 153 | Ga0157374_10066481 | 3300013296 | Bacteria | 3388 |
| 154 | Ga0163162_10235566 | 3300013306 | Bacteria | 1961 |
| 155 | Ga0163162_10293022 | 3300013306 | Bacteria | 1759 |
| 156 | Ga0163162_11233299 | 3300013306 | Bacteria | 849 |
| 157 | Ga0157372_10028616 | 3300013307 | Bacteria | 6084 |
| 158 | Ga0157372_10050621 | 3300013307 | Bacteria | 4620 |
| 159 | Ga0157372_10057353 | 3300013307 | Bacteria | 4353 |
| 160 | Ga0157372_10900361 | 3300013307 | Bacteria | 1027 |
| 161 | Ga0157375_10538103 | 3300013308 | Bacteria | 1331 |
| 162 | Ga0157377_10071981 | 3300014745 | Bacteria | 2000 |
| 163 | Ga0157377_10097720 | 3300014745 | Bacteria | 1744 |
| 164 | Ga0157379_10040606 | 3300014968 | Bacteria | 4153 |
| 165 | Ga0157379_10046509 | 3300014968 | Bacteria | 3870 |
| 166 | Ga0157376_10007354 | 3300014969 | Bacteria | 7852 |
| 167 | Ga0157376_10121627 | 3300014969 | Bacteria | 2315 |
| 168 | Ga0157376_10199731 | 3300014969 | Bacteria | 1839 |
| 169 | Ga0163161_10231739 | 3300017792 | Unclassified | 1433 |
| 170 | Ga0206356_10026517 | 3300020070 | Bacteria | 2091 |
| 171 | Ga0206353_11918524 | 3300020082 | Bacteria | 6515 |
| 172 | Ga0207692_10002734 | 3300025898 | Bacteria | 6806 |
| 173 | Ga0207692_10065101 | 3300025898 | Bacteria | 1900 |
| 174 | Ga0207642_10020300 | 3300025899 | Bacteria | 2591 |
| 175 | Ga0207688_10009605 | 3300025901 | Bacteria | 5267 |
| 176 | Ga0207688_10076495 | 3300025901 | Bacteria | 1906 |
| 177 | Ga0207680_10301105 | 3300025903 | Bacteria | 1118 |
| 178 | Ga0207685_10028563 | 3300025905 | Bacteria | 1966 |
| 179 | Ga0207699_10233101 | 3300025906 | Bacteria | 1261 |
| 180 | Ga0207643_10062433 | 3300025908 | Bacteria | 2129 |
| 181 | Ga0207643_10125501 | 3300025908 | Bacteria | 1523 |
| 182 | Ga0207684_10014049 | 3300025910 | Bacteria | 6915 |
| 183 | Ga0207654_10077032 | 3300025911 | Bacteria | 1998 |
| 184 | Ga0207707_10012796 | 3300025912 | Bacteria | 7298 |
| 185 | Ga0207707_10020140 | 3300025912 | Bacteria | 5822 |
| 186 | Ga0207707_10070187 | 3300025912 | Bacteria | 3053 |
| 187 | Ga0207707_10142350 | 3300025912 | Bacteria | 2096 |
| 188 | Ga0207695_10004861 | 3300025913 | Bacteria | 18136 |
| 189 | Ga0207671_10065444 | 3300025914 | Bacteria | 2704 |
| 190 | Ga0207671_10120512 | 3300025914 | Unclassified | 2005 |
| 191 | Ga0207671_10149176 | 3300025914 | Bacteria | 1806 |
| 192 | Ga0207693_10009154 | 3300025915 | Bacteria | 8083 |
| 193 | Ga0207693_10015753 | 3300025915 | Bacteria | 6058 |
| 194 | Ga0207663_10009163 | 3300025916 | Bacteria | 5222 |
| 195 | Ga0207663_10077630 | 3300025916 | Bacteria | 2162 |
| 196 | Ga0207660_10005388 | 3300025917 | Bacteria | 8305 |
| 197 | Ga0207660_10139530 | 3300025917 | Bacteria | 1852 |
| 198 | Ga0207662_10021101 | 3300025918 | Bacteria | 3719 |
| 199 | Ga0207657_10004471 | 3300025919 | Bacteria | 14787 |
| 200 | Ga0207657_10020865 | 3300025919 | Bacteria | 6183 |
| 201 | Ga0207657_10377437 | 3300025919 | Bacteria | 1117 |
| 202 | Ga0207649_10054832 | 3300025920 | Bacteria | 2483 |
| 203 | Ga0207652_10013273 | 3300025921 | Bacteria | 6669 |
| 204 | Ga0207652_10019257 | 3300025921 | Bacteria | 5611 |
| 205 | Ga0207694_10041416 | 3300025924 | Bacteria | 3549 |
| 206 | Ga0207650_10445298 | 3300025925 | Bacteria | 1077 |
| 207 | Ga0207659_10014048 | 3300025926 | Bacteria | 5154 |
| 208 | Ga0207687_10000216 | 3300025927 | Bacteria | 39182 |
| 209 | Ga0207687_10029028 | 3300025927 | Bacteria | 3718 |
| 210 | Ga0207687_10131553 | 3300025927 | Bacteria | 1887 |
| 211 | Ga0207687_10148747 | 3300025927 | Bacteria | 1785 |
| 212 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 213 | Ga0207700_10069525 | 3300025928 | Bacteria | 2703 |
| 214 | Ga0207700_10353030 | 3300025928 | Bacteria | 1281 |
| 215 | Ga0207664_10001804 | 3300025929 | Bacteria | 14100 |
| 216 | Ga0207664_10198439 | 3300025929 | Bacteria | 1731 |
| 217 | Ga0207644_10086465 | 3300025931 | Bacteria | 2328 |
| 218 | Ga0207644_10649127 | 3300025931 | Bacteria | 878 |
| 219 | Ga0207690_10143482 | 3300025932 | Bacteria | 1762 |
| 220 | Ga0207690_10408042 | 3300025932 | Bacteria | 1084 |
| 221 | Ga0207706_10154642 | 3300025933 | Bacteria | 2017 |
| 222 | Ga0207706_10179954 | 3300025933 | Bacteria | 1857 |
| 223 | Ga0207706_10501466 | 3300025933 | Unclassified | 1048 |
| 224 | Ga0207686_10102659 | 3300025934 | Bacteria | 1912 |
| 225 | Ga0207686_10275081 | 3300025934 | Bacteria | 1240 |
| 226 | Ga0207709_10016013 | 3300025935 | Bacteria | 4162 |
| 227 | Ga0207709_10020283 | 3300025935 | Bacteria | 3748 |
| 228 | Ga0207709_10494712 | 3300025935 | Bacteria | 953 |
| 229 | Ga0207704_10086531 | 3300025938 | Unclassified | 2044 |
| 230 | Ga0207704_10273115 | 3300025938 | Bacteria | 1281 |
| 231 | Ga0207665_10005420 | 3300025939 | Bacteria | 8518 |
| 232 | Ga0207665_10034610 | 3300025939 | Bacteria | 3351 |
| 233 | Ga0207711_10026708 | 3300025941 | Bacteria | 4847 |
| 234 | Ga0207689_10042942 | 3300025942 | Bacteria | 3738 |
| 235 | Ga0207689_10083675 | 3300025942 | Bacteria | 2623 |
| 236 | Ga0207689_10103538 | 3300025942 | Unclassified | 2339 |
| 237 | Ga0207689_10213684 | 3300025942 | Unclassified | 1594 |
| 238 | Ga0207661_10005866 | 3300025944 | Bacteria | 8669 |
| 239 | Ga0207661_10013252 | 3300025944 | Bacteria | 6019 |
| 240 | Ga0207661_10239960 | 3300025944 | Bacteria | 1608 |
| 241 | Ga0207679_10021459 | 3300025945 | Bacteria | 4379 |
| 242 | Ga0207679_10135572 | 3300025945 | Bacteria | 1982 |
| 243 | Ga0207667_10402075 | 3300025949 | Bacteria | 1394 |
| 244 | Ga0207712_10072993 | 3300025961 | Bacteria | 2473 |
| 245 | Ga0207668_10154070 | 3300025972 | Bacteria | 1783 |
| 246 | Ga0207640_10049034 | 3300025981 | Bacteria | 2733 |
| 247 | Ga0207640_10061111 | 3300025981 | Bacteria | 2494 |
| 248 | Ga0207640_10061931 | 3300025981 | Bacteria | 2480 |
| 249 | Ga0207640_10391909 | 3300025981 | Bacteria | 1128 |
| 250 | Ga0207677_10005449 | 3300026023 | Bacteria | 6909 |
| 251 | Ga0207677_10035544 | 3300026023 | Bacteria | 3238 |
| 252 | Ga0207677_10343180 | 3300026023 | Bacteria | 1248 |
| 253 | Ga0207703_10013795 | 3300026035 | Bacteria | 6298 |
| 254 | Ga0207703_10255307 | 3300026035 | Bacteria | 1582 |
| 255 | Ga0207639_10059562 | 3300026041 | Bacteria | 2942 |
| 256 | Ga0207678_10050875 | 3300026067 | Bacteria | 3578 |
| 257 | Ga0207708_10031941 | 3300026075 | Bacteria | 3998 |
| 258 | Ga0207702_10003318 | 3300026078 | Bacteria | 14802 |
| 259 | Ga0207702_10020122 | 3300026078 | Bacteria | 5529 |
| 260 | Ga0207702_10027927 | 3300026078 | Bacteria | 4688 |
| 261 | Ga0207702_10172337 | 3300026078 | Unclassified | 1985 |
| 262 | Ga0207648_10021343 | 3300026089 | Bacteria | 5821 |
| 263 | Ga0207648_10029227 | 3300026089 | Bacteria | 4888 |
| 264 | Ga0207648_10059515 | 3300026089 | Bacteria | 3331 |
| 265 | Ga0207676_10031850 | 3300026095 | Bacteria | 3968 |
| 266 | Ga0207676_10130394 | 3300026095 | Bacteria | 2136 |
| 267 | Ga0207676_10338644 | 3300026095 | Unclassified | 1387 |
| 268 | Ga0207674_10016117 | 3300026116 | Bacteria | 8187 |
| 269 | Ga0207674_10017004 | 3300026116 | Bacteria | 7941 |
| 270 | Ga0207674_10038047 | 3300026116 | Bacteria | 4999 |
| 271 | Ga0207674_10071319 | 3300026116 | Bacteria | 3491 |
| 272 | Ga0207675_100018724 | 3300026118 | Bacteria | 6464 |
| 273 | Ga0207683_10003250 | 3300026121 | Bacteria | 14179 |
| 274 | Ga0207683_10023319 | 3300026121 | Bacteria | 5323 |
| 275 | Ga0207683_10132025 | 3300026121 | Bacteria | 2246 |
| 276 | Ga0207698_10020867 | 3300026142 | Bacteria | 4519 |
| 277 | Ga0207698_10041237 | 3300026142 | Bacteria | 3438 |
| 278 | Ga0207698_10166971 | 3300026142 | Bacteria | 1933 |
| 279 | Ga0207698_10397479 | 3300026142 | Bacteria | 1316 |
| 280 | Ga0207428_10033371 | 3300027907 | Bacteria | 4228 |
| 281 | Ga0268266_10036441 | 3300028379 | Bacteria | 4187 |
| 282 | Ga0268264_10100998 | 3300028381 | Bacteria | 2507 |
| 283 | Ga0265327_10012011 | 3300031251 | Bacteria | 5892 |
| 284 | Ga0307413_10447930 | 3300031824 | Bacteria | 1024 |
| 285 | Ga0307406_10018394 | 3300031901 | Bacteria | 4083 |
| 286 | Ga0307409_100037026 | 3300031995 | Bacteria | 3593 |
| 287 | Ga0307409_100245274 | 3300031995 | Bacteria | 1634 |
| 288 | Ga0307409_100377613 | 3300031995 | Bacteria | 1346 |
| 289 | Ga0307416_100110380 | 3300032002 | Bacteria | 2422 |
| 290 | Ga0307415_100000791 | 3300032126 | Bacteria | 14361 |
| 291 | Ga0307415_100211055 | 3300032126 | Bacteria | 1549 |
| 292 | Ga0373930_0037577 | 3300034816 | Bacteria | 1020 |
| 293 | Ga0373941_0009095 | 3300035115 | Bacteria | 2492 |
| 294 | Ga0373941_0031963 | 3300035115 | Bacteria | 1572 |
| 295 | Ga0373955_0284217 | 3300035172 | Bacteria | 996 |
| 296 | Ga0373942_0004083 | 3300035207 | Bacteria | 3404 |
| 297 | Ga0373935_0243798 | 3300035692 | Bacteria | 1256 |
| 298 | Ga0373935_0348029 | 3300035692 | Bacteria | 1056 |
| 299 | Ga0316584_0097985 | 3300036712 | Bacteria | 2195 |
| 300 | Ga0395899_0017624 | 3300037312 | Bacteria | 5438 |
| 301 | Ga0395899_0032843 | 3300037312 | Bacteria | 3900 |
| 302 | Ga0395900_0011746 | 3300037418 | Bacteria | 8953 |
| 303 | Ga0395900_0015227 | 3300037418 | Bacteria | 7842 |
| 304 | Ga0395900_0020327 | 3300037418 | Bacteria | 6777 |
| 305 | Ga0395900_0166081 | 3300037418 | Bacteria | 2249 |
| 306 | Ga0395900_0457066 | 3300037418 | Bacteria | 1232 |
| 307 | Ga0395898_0003973 | 3300037466 | Bacteria | 16276 |
| 308 | Ga0395898_0009419 | 3300037466 | Bacteria | 10256 |
| 309 | Ga0395898_0012105 | 3300037466 | Bacteria | 8933 |
| 310 | Ga0395898_0031760 | 3300037466 | Bacteria | 5274 |
| 311 | Ga0395898_0064459 | 3300037466 | Bacteria | 3554 |
| 312 | Ga0395898_0193501 | 3300037466 | Bacteria | 1943 |
| 313 | Ga0395898_0293531 | 3300037466 | Bacteria | 1551 |
| 314 | Ga0395905_0001332 | 3300037471 | Bacteria | 30138 |
| 315 | Ga0395905_0002140 | 3300037471 | Bacteria | 22398 |
| 316 | Ga0395905_0006033 | 3300037471 | Bacteria | 12270 |
| 317 | Ga0395905_0062753 | 3300037471 | Bacteria | 3475 |
| 318 | Ga0395905_0205428 | 3300037471 | Bacteria | 1846 |
| 319 | Ga0395901_0003092 | 3300038443 | Bacteria | 16740 |
| 320 | Ga0395901_0018423 | 3300038443 | Bacteria | 7127 |
| 321 | Ga0395901_0020135 | 3300038443 | Bacteria | 6827 |
| 322 | Ga0395901_0029188 | 3300038443 | Bacteria | 5676 |
| 323 | Ga0395901_0035614 | 3300038443 | Bacteria | 5143 |
| 324 | Ga0395901_0231387 | 3300038443 | Bacteria | 1929 |
| 325 | Ga0439461_0016348 | 3300041410 | Bacteria | 1431 |
| 326 | Ga0439433_0001782 | 3300041999 | Bacteria | 4473 |
| 327 | Ga0439448_0076319 | 3300042005 | Bacteria | 1121 |
| 328 | Ga0439452_038130 | 3300042010 | Bacteria | 1142 |
| 329 | Ga0450898_004517 | 3300042134 | Bacteria | 2062 |
| 330 | Ga0439446_0003136 | 3300042156 | Bacteria | 4066 |
| 331 | Ga0439446_0017496 | 3300042156 | Bacteria | 2004 |
| 332 | Ga0439434_0007482 | 3300042435 | Bacteria | 3199 |
| 333 | Ga0439434_0047405 | 3300042435 | Bacteria | 1327 |
| 334 | Ga0466963_0001587 | 3300044694 | Bacteria | 12347 |
| 335 | Ga0466963_0020629 | 3300044694 | Bacteria | 4144 |
| 336 | Ga0466963_0023895 | 3300044694 | Bacteria | 3886 |
| 337 | Ga0466963_0088491 | 3300044694 | Bacteria | 2107 |
| 338 | Ga0466964_0219865 | 3300044706 | Bacteria | 922 |
| 339 | Ga0453684_0559802 | 3300044712 | Unclassified | 1258 |
| 340 | Ga0466957_0009613 | 3300044842 | Bacteria | 5523 |
| 341 | Ga0466960_0002081 | 3300044901 | Bacteria | 7446 |
| 342 | Ga0466958_0005666 | 3300045836 | Bacteria | 6744 |
| 343 | Ga0466958_0024239 | 3300045836 | Bacteria | 3570 |
| 344 | Ga0466967_0000555 | 3300045976 | Bacteria | 18210 |
| 345 | Ga0466967_0014314 | 3300045976 | Bacteria | 6173 |
| 346 | Ga0466967_0022767 | 3300045976 | Bacteria | 5122 |
| 347 | Ga0466967_0027717 | 3300045976 | Bacteria | 4716 |
| 348 | Ga0466967_0299787 | 3300045976 | Bacteria | 1546 |
| 349 | Ga0495629_0287657 | 3300046459 | Bacteria | 1127 |
| 350 | Ga0495582_0022614 | 3300046473 | Bacteria | 3441 |
| 351 | Ga0495582_0086865 | 3300046473 | Bacteria | 1741 |
| 352 | Ga0495662_0111597 | 3300046476 | Bacteria | 1340 |
| 353 | Ga0495584_0100028 | 3300046491 | Bacteria | 1465 |
| 354 | Ga0495584_0143892 | 3300046491 | Bacteria | 1211 |
| 355 | Ga0495596_0038320 | 3300046500 | Bacteria | 1895 |
| 356 | Ga0495630_0354328 | 3300046517 | Bacteria | 1123 |
| 357 | Ga0495663_0007023 | 3300046525 | Bacteria | 3107 |
| 358 | Ga0495609_0075319 | 3300046538 | Unclassified | 1479 |
| 359 | Ga0495656_0028893 | 3300046615 | Bacteria | 2228 |
| 360 | Ga0495611_0116239 | 3300046648 | Bacteria | 1247 |
| 361 | Ga0495588_0237156 | 3300046674 | Bacteria | 962 |
| 362 | Ga0495647_0034315 | 3300046681 | Bacteria | 1900 |
| 363 | Ga0495658_0077221 | 3300046683 | Bacteria | 1947 |
| 364 | Ga0495658_0111647 | 3300046683 | Bacteria | 1644 |
| 365 | Ga0495658_0135399 | 3300046683 | Bacteria | 1503 |
| 366 | Ga0495613_0122811 | 3300046689 | Bacteria | 1864 |
| 367 | Ga0495624_0072630 | 3300046690 | Bacteria | 2140 |
| 368 | Ga0495671_0089847 | 3300046692 | Bacteria | 1504 |
| 369 | Ga0495660_0119257 | 3300046810 | Unclassified | 1337 |
| 370 | Ga0495581_0007101 | 3300047315 | Bacteria | 6485 |
| 371 | Ga0495581_0049433 | 3300047315 | Bacteria | 2428 |
| 372 | Ga0495636_0089250 | 3300047318 | Bacteria | 1337 |
| 373 | Ga0495676_0073125 | 3300047321 | Bacteria | 2630 |
| 374 | Ga0495677_0023733 | 3300047445 | Bacteria | 2226 |
| 375 | Ga0495679_045111 | 3300047446 | Bacteria | 1348 |
| 376 | Ga0495614_0104878 | 3300048089 | Bacteria | 1238 |
| 377 | Ga0495614_0111129 | 3300048089 | Bacteria | 1203 |
| 378 | Ga0496100_0000562 | 3300048903 | Bacteria | 17649 |
| 379 | Ga0496100_0009228 | 3300048903 | Bacteria | 5537 |
| 380 | Ga0496100_0014649 | 3300048903 | Bacteria | 4558 |
| 381 | Ga0496100_0028760 | 3300048903 | Bacteria | 3431 |
| 382 | Ga0496101_0019065 | 3300048904 | Bacteria | 4675 |
| 383 | Ga0496101_0036097 | 3300048904 | Bacteria | 3500 |
| 384 | Ga0496101_0240118 | 3300048904 | Bacteria | 1410 |
| 385 | Ga0496101_0343497 | 3300048904 | Bacteria | 1172 |
| 386 | Ga0496102_0012885 | 3300048905 | Bacteria | 7238 |
| 387 | Ga0496102_0021890 | 3300048905 | Bacteria | 5659 |
| 388 | Ga0496102_0047476 | 3300048905 | Bacteria | 3902 |
| 389 | Ga0496102_0223257 | 3300048905 | Bacteria | 1776 |
| 390 | Ga0496102_0887246 | 3300048905 | Bacteria | 813 |
| 391 | Ga0496103_0008185 | 3300048906 | Bacteria | 6206 |
| 392 | Ga0496103_0016560 | 3300048906 | Bacteria | 4398 |
| 393 | Ga0496104_0008718 | 3300048907 | Bacteria | 9015 |
| 394 | Ga0496104_0064659 | 3300048907 | Bacteria | 3470 |
| 395 | Ga0496104_0109017 | 3300048907 | Bacteria | 2654 |
| 396 | Ga0496104_0112435 | 3300048907 | Bacteria | 2612 |
| 397 | Ga0496104_0161402 | 3300048907 | Bacteria | 2150 |
| 398 | Ga0496105_0035273 | 3300048908 | Bacteria | 4116 |
| 399 | Ga0496105_0035586 | 3300048908 | Bacteria | 4098 |
| 400 | Ga0496105_0089868 | 3300048908 | Bacteria | 2537 |
| 401 | Ga0496105_0151614 | 3300048908 | Bacteria | 1905 |
| 402 | Ga0496106_0000947 | 3300048909 | Bacteria | 21165 |
| 403 | Ga0496106_0008736 | 3300048909 | Bacteria | 7491 |
| 404 | Ga0496106_0023453 | 3300048909 | Bacteria | 4584 |
| 405 | Ga0496106_0150168 | 3300048909 | Bacteria | 1837 |
| 406 | Ga0496107_0005049 | 3300048910 | Bacteria | 8996 |
| 407 | Ga0496107_0005428 | 3300048910 | Bacteria | 8729 |
| 408 | Ga0496107_0028999 | 3300048910 | Bacteria | 3935 |
| 409 | Ga0496107_0041296 | 3300048910 | Bacteria | 3312 |
| 410 | Ga0496107_0149791 | 3300048910 | Bacteria | 1725 |
| 411 | Ga0496107_0195616 | 3300048910 | Bacteria | 1503 |
| 412 | Ga0496108_0000624 | 3300048911 | Bacteria | 27681 |
| 413 | Ga0496108_0002781 | 3300048911 | Bacteria | 14023 |
| 414 | Ga0496108_0017252 | 3300048911 | Bacteria | 5904 |
| 415 | Ga0496108_0267338 | 3300048911 | Bacteria | 1488 |
| 416 | Ga0496109_0003289 | 3300048912 | Bacteria | 13492 |
| 417 | Ga0496109_0003615 | 3300048912 | Bacteria | 12925 |
| 418 | Ga0496109_0021879 | 3300048912 | Bacteria | 5660 |
| 419 | Ga0496109_0069085 | 3300048912 | Bacteria | 3239 |
| 420 | Ga0496109_0275143 | 3300048912 | Bacteria | 1586 |
| 421 | Ga0496110_0005543 | 3300048913 | Bacteria | 9910 |
| 422 | Ga0496110_0012925 | 3300048913 | Bacteria | 6884 |
| 423 | Ga0496110_0032605 | 3300048913 | Bacteria | 4501 |
| 424 | Ga0496110_0060984 | 3300048913 | Bacteria | 3328 |
| 425 | Ga0496110_0100082 | 3300048913 | Bacteria | 2598 |
| 426 | Ga0496110_0109704 | 3300048913 | Bacteria | 2479 |
| 427 | Ga0496110_0628696 | 3300048913 | Bacteria | 973 |
| 428 | Ga0496111_0007351 | 3300048914 | Bacteria | 7211 |
| 429 | Ga0496111_0038339 | 3300048914 | Bacteria | 3434 |
| 430 | Ga0496111_0105742 | 3300048914 | Bacteria | 2071 |
| 431 | Ga0496112_0272621 | 3300048915 | Bacteria | 1640 |
| 432 | Ga0496112_0427592 | 3300048915 | Bacteria | 1263 |
| 433 | Ga0496113_0039573 | 3300048916 | Bacteria | 3470 |
| 434 | Ga0496114_0001024 | 3300048917 | Bacteria | 21001 |
| 435 | Ga0496114_0002096 | 3300048917 | Bacteria | 15161 |
| 436 | Ga0496114_0146723 | 3300048917 | Bacteria | 2045 |
| 437 | Ga0496114_0295140 | 3300048917 | Bacteria | 1430 |
| 438 | Ga0496114_0379599 | 3300048917 | Bacteria | 1251 |
| 439 | Ga0496115_0000582 | 3300048918 | Bacteria | 28154 |
| 440 | Ga0496115_0003405 | 3300048918 | Bacteria | 11418 |
| 441 | Ga0496115_0164252 | 3300048918 | Bacteria | 1836 |
| 442 | Ga0496115_0188829 | 3300048918 | Bacteria | 1702 |
| 443 | Ga0501031_0006904 | 3300049568 | Bacteria | 7409 |
| 444 | Ga0501031_0007910 | 3300049568 | Bacteria | 6920 |
| 445 | Ga0501031_0094763 | 3300049568 | Bacteria | 1947 |
| 446 | Ga0501031_0164767 | 3300049568 | Bacteria | 1449 |
| 447 | Ga0501032_0035338 | 3300049569 | Bacteria | 3417 |
| 448 | Ga0501032_0056603 | 3300049569 | Bacteria | 2636 |
| 449 | Ga0501033_0115598 | 3300049570 | Bacteria | 1949 |
| 450 | Ga0501033_0341696 | 3300049570 | Bacteria | 1049 |
| 451 | Ga0501034_0019302 | 3300049571 | Bacteria | 6976 |
| 452 | Ga0501034_0440312 | 3300049571 | Bacteria | 1222 |
| 453 | Ga0501036_0000560 | 3300049572 | Bacteria | 26720 |
| 454 | Ga0501036_0046499 | 3300049572 | Bacteria | 3676 |
| 455 | Ga0501036_0054977 | 3300049572 | Bacteria | 3372 |
| 456 | Ga0501036_0224565 | 3300049572 | Bacteria | 1576 |
| 457 | Ga0501036_0353237 | 3300049572 | Bacteria | 1227 |
| 458 | Ga0501037_0036854 | 3300049573 | Bacteria | 3604 |
| 459 | Ga0501037_0080300 | 3300049573 | Bacteria | 2367 |
| 460 | Ga0501037_0085677 | 3300049573 | Bacteria | 2281 |
| 461 | Ga0501037_0176613 | 3300049573 | Bacteria | 1516 |
| 462 | Ga0501038_0018289 | 3300049574 | Bacteria | 6326 |
| 463 | Ga0501038_0030973 | 3300049574 | Bacteria | 4730 |
| 464 | Ga0501038_0087300 | 3300049574 | Bacteria | 2619 |
| 465 | Ga0501038_0109552 | 3300049574 | Bacteria | 2288 |
| 466 | Ga0501038_0197010 | 3300049574 | Bacteria | 1619 |
| 467 | Ga0501039_0006006 | 3300049575 | Bacteria | 9209 |
| 468 | Ga0501039_0011843 | 3300049575 | Bacteria | 6643 |
| 469 | Ga0501039_0022712 | 3300049575 | Bacteria | 4813 |
| 470 | Ga0501039_0065258 | 3300049575 | Bacteria | 2824 |
| 471 | Ga0501039_0129455 | 3300049575 | Bacteria | 1980 |
| 472 | Ga0501039_0264931 | 3300049575 | Bacteria | 1351 |
| 473 | Ga0501039_0310388 | 3300049575 | Bacteria | 1240 |
| 474 | Ga0501040_0002692 | 3300049576 | Bacteria | 11458 |
| 475 | Ga0501040_0002922 | 3300049576 | Bacteria | 11052 |
| 476 | Ga0501040_0003900 | 3300049576 | Bacteria | 9679 |
| 477 | Ga0501040_0004718 | 3300049576 | Bacteria | 8850 |
| 478 | Ga0501040_0009095 | 3300049576 | Bacteria | 6465 |
| 479 | Ga0501040_0022242 | 3300049576 | Bacteria | 4242 |
| 480 | Ga0501041_0009869 | 3300049577 | Bacteria | 5621 |
| 481 | Ga0501041_0011683 | 3300049577 | Bacteria | 5196 |
| 482 | Ga0501041_0018911 | 3300049577 | Bacteria | 4104 |
| 483 | Ga0501041_0020648 | 3300049577 | Bacteria | 3939 |
| 484 | Ga0501041_0224984 | 3300049577 | Bacteria | 1177 |
| 485 | Ga0501042_0003011 | 3300049578 | Bacteria | 10481 |
| 486 | Ga0501042_0008693 | 3300049578 | Bacteria | 6732 |
| 487 | Ga0501042_0010246 | 3300049578 | Bacteria | 6274 |
| 488 | Ga0501042_0071530 | 3300049578 | Bacteria | 2481 |
| 489 | Ga0501042_0081449 | 3300049578 | Bacteria | 2320 |
| 490 | Ga0501042_0109313 | 3300049578 | Bacteria | 1991 |
| 491 | Ga0501042_0222583 | 3300049578 | Bacteria | 1361 |
| 492 | Ga0501043_0012731 | 3300049579 | Bacteria | 6574 |
| 493 | Ga0501043_0093179 | 3300049579 | Bacteria | 2368 |
| 494 | Ga0501046_0013898 | 3300049580 | Bacteria | 6800 |
| 495 | Ga0501046_0017956 | 3300049580 | Bacteria | 5896 |
| 496 | Ga0501046_0062729 | 3300049580 | Bacteria | 2903 |
| 497 | Ga0501047_0031214 | 3300049581 | Bacteria | 5139 |
| 498 | Ga0501047_0132810 | 3300049581 | Bacteria | 2369 |
| 499 | Ga0501048_0010391 | 3300049582 | Bacteria | 6951 |
| 500 | Ga0501048_0020302 | 3300049582 | Bacteria | 4869 |
| 501 | Ga0501048_0022268 | 3300049582 | Bacteria | 4637 |
| 502 | Ga0501048_0056116 | 3300049582 | Bacteria | 2794 |
| 503 | Ga0501048_0230255 | 3300049582 | Bacteria | 1315 |
| 504 | Ga0501048_0350873 | 3300049582 | Bacteria | 1052 |
| 505 | Ga0501067_0004665 | 3300049583 | Bacteria | 7583 |
| 506 | Ga0501067_0042738 | 3300049583 | Bacteria | 2516 |
| 507 | Ga0501068_0010778 | 3300049584 | Bacteria | 5140 |
| 508 | Ga0501069_0004225 | 3300049585 | Bacteria | 7420 |
| 509 | Ga0501069_0009787 | 3300049585 | Bacteria | 5067 |
| 510 | Ga0501070_0080452 | 3300049586 | Bacteria | 2696 |
| 511 | Ga0501070_0128909 | 3300049586 | Bacteria | 2090 |
| 512 | Ga0501070_0182256 | 3300049586 | Bacteria | 1728 |
| 513 | Ga0501071_0005907 | 3300049587 | Bacteria | 7918 |
| 514 | Ga0501071_0007483 | 3300049587 | Bacteria | 7176 |
| 515 | Ga0501071_0013806 | 3300049587 | Bacteria | 5512 |
| 516 | Ga0501071_0061354 | 3300049587 | Bacteria | 2723 |
| 517 | Ga0501071_0116427 | 3300049587 | Bacteria | 1978 |
| 518 | Ga0501071_0183271 | 3300049587 | Bacteria | 1569 |
| 519 | Ga0501072_0002551 | 3300049588 | Bacteria | 13647 |
| 520 | Ga0501072_0003113 | 3300049588 | Bacteria | 12475 |
| 521 | Ga0501072_0003655 | 3300049588 | Bacteria | 11588 |
| 522 | Ga0501072_0011825 | 3300049588 | Bacteria | 6668 |
| 523 | Ga0501072_0027290 | 3300049588 | Bacteria | 4455 |
| 524 | Ga0501072_0030561 | 3300049588 | Bacteria | 4213 |
| 525 | Ga0501072_0393690 | 3300049588 | Bacteria | 1099 |
| 526 | Ga0501074_0007233 | 3300049590 | Bacteria | 8020 |
| 527 | Ga0501074_0019108 | 3300049590 | Bacteria | 4975 |
| 528 | Ga0501074_0022246 | 3300049590 | Bacteria | 4607 |
| 529 | Ga0501074_0125560 | 3300049590 | Bacteria | 1835 |
| 530 | Ga0501074_0373543 | 3300049590 | Bacteria | 1011 |
| 531 | Ga0501075_0012816 | 3300049591 | Bacteria | 5968 |
| 532 | Ga0501075_0027110 | 3300049591 | Bacteria | 4221 |
| 533 | Ga0501075_0044425 | 3300049591 | Bacteria | 3334 |
| 534 | Ga0501075_0048758 | 3300049591 | Bacteria | 3182 |
| 535 | Ga0501075_0053128 | 3300049591 | Bacteria | 3047 |
| 536 | Ga0501075_0057331 | 3300049591 | Bacteria | 2932 |
| 537 | Ga0501075_0107252 | 3300049591 | Bacteria | 2123 |
| 538 | Ga0501076_0008773 | 3300049592 | Bacteria | 7429 |
| 539 | Ga0501076_0038371 | 3300049592 | Bacteria | 3760 |
| 540 | Ga0501076_0049778 | 3300049592 | Bacteria | 3314 |
| 541 | Ga0501076_0053813 | 3300049592 | Bacteria | 3190 |
| 542 | Ga0501076_0065383 | 3300049592 | Bacteria | 2900 |
| 543 | Ga0501076_0067490 | 3300049592 | Bacteria | 2856 |
| 544 | Ga0501076_0179454 | 3300049592 | Bacteria | 1726 |
| 545 | Ga0501077_0002026 | 3300049593 | Bacteria | 12224 |
| 546 | Ga0501077_0003107 | 3300049593 | Bacteria | 9984 |
| 547 | Ga0501077_0014120 | 3300049593 | Bacteria | 5011 |
| 548 | Ga0501077_0034923 | 3300049593 | Bacteria | 3200 |
| 549 | Ga0501077_0057722 | 3300049593 | Bacteria | 2464 |
| 550 | Ga0501077_0081602 | 3300049593 | Bacteria | 2049 |
| 551 | Ga0501077_0244383 | 3300049593 | Bacteria | 1141 |
| 552 | Ga0501079_0011778 | 3300049741 | Bacteria | 6678 |
| 553 | Ga0501079_0014740 | 3300049741 | Bacteria | 5958 |
| 554 | Ga0501079_0031741 | 3300049741 | Bacteria | 4059 |
| 555 | Ga0501079_0035590 | 3300049741 | Bacteria | 3833 |
| 556 | Ga0501079_0055283 | 3300049741 | Bacteria | 3063 |
| 557 | Ga0501079_0066269 | 3300049741 | Bacteria | 2786 |
| 558 | Ga0501079_0208933 | 3300049741 | Bacteria | 1525 |
| 559 | Ga0501079_0419222 | 3300049741 | Bacteria | 1051 |
| 560 | Ga0501079_0557297 | 3300049741 | Bacteria | 901 |
| 561 | Ga0501080_0004079 | 3300049742 | Bacteria | 12940 |
| 562 | Ga0501080_0046822 | 3300049742 | Bacteria | 4025 |
| 563 | Ga0501080_0113623 | 3300049742 | Bacteria | 2510 |
| 564 | Ga0501080_0273707 | 3300049742 | Bacteria | 1536 |
| 565 | Ga0501080_0363350 | 3300049742 | Bacteria | 1306 |
| 566 | Ga0501081_0007919 | 3300049743 | Bacteria | 6891 |
| 567 | Ga0501081_0010102 | 3300049743 | Bacteria | 6158 |
| 568 | Ga0501081_0021825 | 3300049743 | Bacteria | 4277 |
| 569 | Ga0501081_0022924 | 3300049743 | Bacteria | 4180 |
| 570 | Ga0501083_0151820 | 3300049744 | Bacteria | 1516 |
| 571 | Ga0501035_0006184 | 3300049822 | Bacteria | 11266 |
| 572 | Ga0501035_0049384 | 3300049822 | Bacteria | 3770 |
| 573 | Ga0501035_0070128 | 3300049822 | Bacteria | 3105 |
| 574 | Ga0501044_0037497 | 3300049823 | Bacteria | 5066 |
| 575 | Ga0501045_0000887 | 3300049824 | Bacteria | 19464 |
| 576 | Ga0501045_0004417 | 3300049824 | Bacteria | 9706 |
| 577 | Ga0501045_0014517 | 3300049824 | Bacteria | 5583 |
| 578 | Ga0501045_0023380 | 3300049824 | Bacteria | 4429 |
| 579 | Ga0501045_0130655 | 3300049824 | Bacteria | 1867 |
| 580 | Ga0501045_0147629 | 3300049824 | Bacteria | 1750 |
| 581 | Ga0501045_0293872 | 3300049824 | Bacteria | 1209 |
| 582 | nmdc:mga05p37_777663_c1 | 3300050507 | Bacteria | 1051 |
| 583 | nmdc:mga09592_194993_c1 | 3300050508 | Bacteria | 1753 |
| 584 | nmdc:mga08y16_61340_c1 | 3300050511 | Bacteria | 3926 |
| 585 | nmdc:mga0n895_257217_c1 | 3300050512 | Bacteria | 1772 |
| 586 | nmdc:mga0n895_38969_c1 | 3300050512 | Bacteria | 4608 |
| 587 | nmdc:mga0rr50_24039_c1 | 3300050513 | Bacteria | 4215 |
| 588 | nmdc:mga0rr50_72879_c1 | 3300050513 | Bacteria | 2624 |
| 589 | nmdc:mga08x19_70552_c1 | 3300050514 | Bacteria | 2277 |
| 590 | nmdc:mga0a205_251023_c1 | 3300050515 | Bacteria | 1648 |
| 591 | Ga0495601_0032258 | 3300053077 | Bacteria | 3260 |
| 592 | Ga0495612_0085281 | 3300053078 | Bacteria | 1331 |
| 593 | Ga0495655_0030024 | 3300053083 | Unclassified | 1312 |
| 594 | Ga0495595_0095711 | 3300053084 | Bacteria | 1429 |
| 595 | Ga0501084_0000453 | 3300054114 | Bacteria | 31556 |
| 596 | Ga0501084_0003128 | 3300054114 | Bacteria | 13402 |
| 597 | Ga0501084_0013220 | 3300054114 | Bacteria | 6830 |
| 598 | Ga0501084_0015732 | 3300054114 | Bacteria | 6273 |
| 599 | Ga0501084_0036541 | 3300054114 | Bacteria | 4102 |
| 600 | Ga0501084_0041840 | 3300054114 | Bacteria | 3833 |
| 601 | Ga0501084_0085755 | 3300054114 | Bacteria | 2644 |
| 602 | Ga0501084_0115424 | 3300054114 | Bacteria | 2257 |
| 603 | Ga0501084_0151549 | 3300054114 | Bacteria | 1954 |
| 604 | Ga0590075_026339 | 3300059424 | Bacteria | 1464 |
| 605 | Ga0590075_044470 | 3300059424 | Bacteria | 1137 |
| 606 | Ga0590077_047936 | 3300059426 | Bacteria | 956 |
| 607 | Ga0501082_0003088 | 3300060353 | Bacteria | 14522 |
| 608 | Ga0501082_0028393 | 3300060353 | Bacteria | 4821 |
| 609 | Ga0501082_0053735 | 3300060353 | Bacteria | 3471 |
| 610 | Ga0501082_0085154 | 3300060353 | Bacteria | 2726 |
| 611 | Ga0501082_0166128 | 3300060353 | Bacteria | 1918 |
| 612 | Ga0501082_0241918 | 3300060353 | Bacteria | 1570 |
| 613 | Ga0501082_0279221 | 3300060353 | Bacteria | 1454 |
| 614 | Ga0501082_0346844 | 3300060353 | Bacteria | 1294 |
| 615 | Ga0530510_0000145 | 3300061734 | Bacteria | 41886 |
| 616 | Ga0530510_0000922 | 3300061734 | Bacteria | 19406 |
| 617 | Ga0530510_0003321 | 3300061734 | Bacteria | 11065 |
| 618 | Ga0530510_0015875 | 3300061734 | Bacteria | 5325 |
| 619 | Ga0530510_0032997 | 3300061734 | Bacteria | 3727 |
| 620 | Ga0530510_0034835 | 3300061734 | Bacteria | 3627 |
| 621 | Ga0530510_0264637 | 3300061734 | Bacteria | 1283 |
| 622 | Ga0530510_0457373 | 3300061734 | Bacteria | 965 |
| 623 | 2555469028 | 2554235283 | Bacteria | 3683090 |
| 624 | 2644739998 | 2643221735 | Bacteria | 3676263 |
| 625 | 2819724811 | 2818991468 | Bacteria | 3723169 |
| 626 | 2908665693 | 2908665501 | Bacteria | 3678115 |
| 627 | 2919094134 | 2919093281 | Bacteria | 3660974 |
| 628 | 2919728995 | 2919726948 | Bacteria | 3696050 |
| 629 | 2954774467 | 2954773129 | Bacteria | 3741715 |
| 630 | Ga0068855_100720356 | |||
| 631 | JGI24034J26672_10007966 | |||
| 632 | JGI25151J46595_10000012 | |||
| 633 | Ga0070658_10056716 | |||
| 634 | Ga0070683_100004784 | |||
| 635 | Ga0070683_100244671 | |||
| 636 | Ga0070683_100556369 | |||
| 637 | Ga0070690_100161380 | |||
| 638 | Ga0070670_100129364 | |||
| 639 | Ga0068869_100013356 | |||
| 640 | Ga0070682_100062469 | |||
| 641 | Ga0070682_100390513 | |||
| 642 | Ga0068868_100007590 | |||
| 643 | Ga0068868_100023336 | |||
| 644 | Ga0068868_100107651 | |||
| 645 | Ga0070660_100077720 | |||
| 646 | Ga0070689_100034243 | |||
| 647 | Ga0070687_100079096 | |||
| 648 | Ga0070692_10094144 | |||
| 649 | Ga0070674_100049656 | |||
| 650 | Ga0070673_100018896 | |||
| 651 | Ga0070673_100073949 | |||
| 652 | Ga0070688_100031212 | |||
| 653 | Ga0070659_100036918 | |||
| 654 | Ga0070703_10077203 | |||
| 655 | Ga0070709_10041102 | |||
| 656 | Ga0070709_10214889 | |||
| 657 | Ga0070714_100010921 | |||
| 658 | Ga0070714_100016463 | |||
| 659 | Ga0070713_100047874 | |||
| 660 | Ga0070713_100277484 | |||
| 661 | Ga0070710_10019818 | |||
| 662 | Ga0070701_10008202 | |||
| 663 | Ga0070711_100009946 | |||
| 664 | Ga0070705_100051238 | |||
| 665 | Ga0070705_100075635 | |||
| 666 | Ga0070700_100013062 | |||
| 667 | Ga0070700_100019221 | |||
| 668 | Ga0070700_100078091 | |||
| 669 | Ga0070708_100077536 | |||
| 670 | Ga0070708_100721171 | |||
| 671 | Ga0070663_100056121 | |||
| 672 | Ga0070663_100058068 | |||
| 673 | Ga0070678_100303465 | |||
| 674 | Ga0068867_100073483 | |||
| 675 | Ga0068867_100211594 | |||
| 676 | Ga0070685_10007946 | |||
| 677 | Ga0070706_100017069 | |||
| 678 | Ga0070707_100089202 | |||
| 679 | Ga0070698_100007770 | |||
| 680 | Ga0070679_100168939 | |||
| 681 | Ga0070684_100000173 | |||
| 682 | Ga0070684_100008885 | |||
| 683 | Ga0070684_100129986 | |||
| 684 | Ga0070684_100162632 | |||
| 685 | Ga0070686_100033891 | |||
| 686 | Ga0070686_100069440 | |||
| 687 | Ga0070696_100023638 | |||
| 688 | Ga0070696_100038923 | |||
| 689 | Ga0070693_100020970 | |||
| 690 | Ga0070693_100123512 | |||
| 691 | Ga0070693_100201285 | |||
| 692 | Ga0070665_100029228 | |||
| 693 | Ga0070665_100074660 | |||
| 694 | Ga0070665_100158677 | |||
| 695 | Ga0070704_100056853 | |||
| 696 | Ga0068855_100048076 | |||
| 697 | Ga0068855_100050477 | |||
| 698 | Ga0070664_100036868 | |||
| 699 | Ga0070664_100260889 | |||
| 700 | Ga0068857_100002531 | |||
| 701 | Ga0068857_100018211 | |||
| 702 | Ga0068857_100027441 | |||
| 703 | Ga0068854_100024464 | |||
| 704 | Ga0068854_100094802 | |||
| 705 | Ga0068854_100103175 | |||
| 706 | Ga0068856_100003956 | |||
| 707 | Ga0068856_100019704 | |||
| 708 | Ga0068856_100088352 | |||
| 709 | Ga0070702_100202717 | |||
| 710 | Ga0068859_100235922 | |||
| 711 | Ga0068864_100063634 | |||
| 712 | Ga0068864_100281818 | |||
| 713 | Ga0068866_10018985 | |||
| 714 | Ga0068866_10106875 | |||
| 715 | Ga0068861_100054622 | |||
| 716 | Ga0068870_10024034 | |||
| 717 | Ga0068870_10026274 | |||
| 718 | Ga0068870_10179919 | |||
| 719 | Ga0068863_100041279 | |||
| 720 | Ga0068858_100046190 | |||
| 721 | Ga0068858_100180869 | |||
| 722 | Ga0068858_100231376 | |||
| 723 | Ga0068860_100336901 | |||
| 724 | Ga0068862_100814495 | |||
| 725 | Ga0081455_10026032 | |||
| 726 | Ga0081455_10044612 | |||
| 727 | Ga0081455_10189662 | |||
| 728 | Ga0081538_10000052 | |||
| 729 | Ga0081538_10001074 | |||
| 730 | Ga0081540_1026716 | |||
| 731 | Ga0081539_10000397 | |||
| 732 | Ga0070717_10024720 | |||
| 733 | Ga0075432_10013682 | |||
| 734 | Ga0070716_100012223 | |||
| 735 | Ga0070716_100031731 | |||
| 736 | Ga0070712_100001474 | |||
| 737 | Ga0097621_100055332 | |||
| 738 | Ga0097621_100377587 | |||
| 739 | Ga0068871_100114229 | |||
| 740 | Ga0068871_100144027 | |||
| 741 | Ga0075428_100249422 | |||
| 742 | Ga0075428_100576918 | |||
| 743 | Ga0075434_100004757 | |||
| 744 | Ga0068865_100144499 | |||
| 745 | Ga0068865_100229773 | |||
| 746 | Ga0097620_100235912 | |||
| 747 | Ga0075435_100014613 | |||
| 748 | Ga0075435_100017065 | |||
| 749 | Ga0105240_10010457 | |||
| 750 | Ga0111539_10333336 | |||
| 751 | Ga0105245_10057989 | |||
| 752 | Ga0105245_10061431 | |||
| 753 | Ga0105245_10064894 | |||
| 754 | Ga0105245_10094826 | |||
| 755 | Ga0105245_10414297 | |||
| 756 | Ga0105247_10069500 | |||
| 757 | Ga0114129_10037285 | |||
| 758 | Ga0105243_10115504 | |||
| 759 | Ga0105243_10149459 | |||
| 760 | Ga0105243_10753429 | |||
| 761 | Ga0105241_10112693 | |||
| 762 | Ga0105241_10137224 | |||
| 763 | Ga0105241_10375632 | |||
| 764 | Ga0105242_10057548 | |||
| 765 | Ga0105242_10087479 | |||
| 766 | Ga0105242_10113193 | |||
| 767 | Ga0105242_10510056 | |||
| 768 | Ga0105242_10824025 | |||
| 769 | Ga0105248_10064367 | |||
| 770 | Ga0105248_10214402 | |||
| 771 | Ga0105237_10043829 | |||
| 772 | Ga0105237_10215261 | |||
| 773 | Ga0105238_10031825 | |||
| 774 | Ga0105238_10247593 | |||
| 775 | Ga0105238_10319076 | |||
| 776 | Ga0105239_10080041 | |||
| 777 | Ga0105239_10170664 | |||
| 778 | Ga0105246_10197945 | |||
| 779 | Ga0105246_10296358 | |||
| 780 | Ga0157369_10014592 | |||
| 781 | Ga0157374_10047924 | |||
| 782 | Ga0157374_10066481 | |||
| 783 | Ga0163162_10235566 | |||
| 784 | Ga0163162_10293022 | |||
| 785 | Ga0163162_11233299 | |||
| 786 | Ga0157372_10028616 | |||
| 787 | Ga0157372_10050621 | |||
| 788 | Ga0157372_10057353 | |||
| 789 | Ga0157372_10900361 | |||
| 790 | Ga0157375_10538103 | |||
| 791 | Ga0157377_10071981 | |||
| 792 | Ga0157377_10097720 | |||
| 793 | Ga0157379_10040606 | |||
| 794 | Ga0157379_10046509 | |||
| 795 | Ga0157376_10007354 | |||
| 796 | Ga0157376_10121627 | |||
| 797 | Ga0157376_10199731 | |||
| 798 | Ga0163161_10231739 | |||
| 799 | Ga0206356_10026517 | |||
| 800 | Ga0206353_11918524 | |||
| 801 | Ga0207692_10002734 | |||
| 802 | Ga0207692_10065101 | |||
| 803 | Ga0207642_10020300 | |||
| 804 | Ga0207688_10009605 | |||
| 805 | Ga0207688_10076495 | |||
| 806 | Ga0207680_10301105 | |||
| 807 | Ga0207685_10028563 | |||
| 808 | Ga0207699_10233101 | |||
| 809 | Ga0207643_10062433 | |||
| 810 | Ga0207643_10125501 | |||
| 811 | Ga0207684_10014049 | |||
| 812 | Ga0207654_10077032 | |||
| 813 | Ga0207707_10012796 | |||
| 814 | Ga0207707_10020140 | |||
| 815 | Ga0207707_10070187 | |||
| 816 | Ga0207707_10142350 | |||
| 817 | Ga0207695_10004861 | |||
| 818 | Ga0207671_10065444 | |||
| 819 | Ga0207671_10120512 | |||
| 820 | Ga0207671_10149176 | |||
| 821 | Ga0207693_10009154 | |||
| 822 | Ga0207693_10015753 | |||
| 823 | Ga0207663_10009163 | |||
| 824 | Ga0207663_10077630 | |||
| 825 | Ga0207660_10005388 | |||
| 826 | Ga0207660_10139530 | |||
| 827 | Ga0207662_10021101 | |||
| 828 | Ga0207657_10004471 | |||
| 829 | Ga0207657_10020865 | |||
| 830 | Ga0207657_10377437 | |||
| 831 | Ga0207649_10054832 | |||
| 832 | Ga0207652_10013273 | |||
| 833 | Ga0207652_10019257 | |||
| 834 | Ga0207694_10041416 | |||
| 835 | Ga0207650_10445298 | |||
| 836 | Ga0207659_10014048 | |||
| 837 | Ga0207687_10000216 | |||
| 838 | Ga0207687_10029028 | |||
| 839 | Ga0207687_10131553 | |||
| 840 | Ga0207687_10148747 | |||
| 841 | Ga0207700_10000001 | |||
| 842 | Ga0207700_10069525 | |||
| 843 | Ga0207700_10353030 | |||
| 844 | Ga0207664_10001804 | |||
| 845 | Ga0207664_10198439 | |||
| 846 | Ga0207644_10086465 | |||
| 847 | Ga0207644_10649127 | |||
| 848 | Ga0207690_10143482 | |||
| 849 | Ga0207690_10408042 | |||
| 850 | Ga0207706_10154642 | |||
| 851 | Ga0207706_10179954 | |||
| 852 | Ga0207706_10501466 | |||
| 853 | Ga0207686_10102659 | |||
| 854 | Ga0207686_10275081 | |||
| 855 | Ga0207709_10016013 | |||
| 856 | Ga0207709_10020283 | |||
| 857 | Ga0207709_10494712 | |||
| 858 | Ga0207704_10086531 | |||
| 859 | Ga0207704_10273115 | |||
| 860 | Ga0207665_10005420 | |||
| 861 | Ga0207665_10034610 | |||
| 862 | Ga0207711_10026708 | |||
| 863 | Ga0207689_10042942 | |||
| 864 | Ga0207689_10083675 | |||
| 865 | Ga0207689_10103538 | |||
| 866 | Ga0207689_10213684 | |||
| 867 | Ga0207661_10005866 | |||
| 868 | Ga0207661_10013252 | |||
| 869 | Ga0207661_10239960 | |||
| 870 | Ga0207679_10021459 | |||
| 871 | Ga0207679_10135572 | |||
| 872 | Ga0207667_10402075 | |||
| 873 | Ga0207712_10072993 | |||
| 874 | Ga0207668_10154070 | |||
| 875 | Ga0207640_10049034 | |||
| 876 | Ga0207640_10061111 | |||
| 877 | Ga0207640_10061931 | |||
| 878 | Ga0207640_10391909 | |||
| 879 | Ga0207677_10005449 | |||
| 880 | Ga0207677_10035544 | |||
| 881 | Ga0207677_10343180 | |||
| 882 | Ga0207703_10013795 | |||
| 883 | Ga0207703_10255307 | |||
| 884 | Ga0207639_10059562 | |||
| 885 | Ga0207678_10050875 | |||
| 886 | Ga0207708_10031941 | |||
| 887 | Ga0207702_10003318 | |||
| 888 | Ga0207702_10020122 | |||
| 889 | Ga0207702_10027927 | |||
| 890 | Ga0207702_10172337 | |||
| 891 | Ga0207648_10021343 | |||
| 892 | Ga0207648_10029227 | |||
| 893 | Ga0207648_10059515 | |||
| 894 | Ga0207676_10031850 | |||
| 895 | Ga0207676_10130394 | |||
| 896 | Ga0207676_10338644 | |||
| 897 | Ga0207674_10016117 | |||
| 898 | Ga0207674_10017004 | |||
| 899 | Ga0207674_10038047 | |||
| 900 | Ga0207674_10071319 | |||
| 901 | Ga0207675_100018724 | |||
| 902 | Ga0207683_10003250 | |||
| 903 | Ga0207683_10023319 | |||
| 904 | Ga0207683_10132025 | |||
| 905 | Ga0207698_10020867 | |||
| 906 | Ga0207698_10041237 | |||
| 907 | Ga0207698_10166971 | |||
| 908 | Ga0207698_10397479 | |||
| 909 | Ga0207428_10033371 | |||
| 910 | Ga0268266_10036441 | |||
| 911 | Ga0268264_10100998 | |||
| 912 | Ga0265327_10012011 | |||
| 913 | Ga0307413_10447930 | |||
| 914 | Ga0307406_10018394 | |||
| 915 | Ga0307409_100037026 | |||
| 916 | Ga0307409_100245274 | |||
| 917 | Ga0307409_100377613 | |||
| 918 | Ga0307416_100110380 | |||
| 919 | Ga0307415_100000791 | |||
| 920 | Ga0307415_100211055 | |||
| 921 | Ga0373930_0037577 | |||
| 922 | Ga0373941_0009095 | |||
| 923 | Ga0373941_0031963 | |||
| 924 | Ga0373955_0284217 | |||
| 925 | Ga0373942_0004083 | |||
| 926 | Ga0373935_0243798 | |||
| 927 | Ga0373935_0348029 | |||
| 928 | Ga0316584_0097985 | |||
| 929 | Ga0395899_0017624 | |||
| 930 | Ga0395899_0032843 | |||
| 931 | Ga0395900_0011746 | |||
| 932 | Ga0395900_0015227 | |||
| 933 | Ga0395900_0020327 | |||
| 934 | Ga0395900_0166081 | |||
| 935 | Ga0395900_0457066 | |||
| 936 | Ga0395898_0003973 | |||
| 937 | Ga0395898_0009419 | |||
| 938 | Ga0395898_0012105 | |||
| 939 | Ga0395898_0031760 | |||
| 940 | Ga0395898_0064459 | |||
| 941 | Ga0395898_0193501 | |||
| 942 | Ga0395898_0293531 | |||
| 943 | Ga0395905_0001332 | |||
| 944 | Ga0395905_0002140 | |||
| 945 | Ga0395905_0006033 | |||
| 946 | Ga0395905_0062753 | |||
| 947 | Ga0395905_0205428 | |||
| 948 | Ga0395901_0003092 | |||
| 949 | Ga0395901_0018423 | |||
| 950 | Ga0395901_0020135 | |||
| 951 | Ga0395901_0029188 | |||
| 952 | Ga0395901_0035614 | |||
| 953 | Ga0395901_0231387 | |||
| 954 | Ga0439461_0016348 | |||
| 955 | Ga0439433_0001782 | |||
| 956 | Ga0439448_0076319 | |||
| 957 | Ga0439452_038130 | |||
| 958 | Ga0450898_004517 | |||
| 959 | Ga0439446_0003136 | |||
| 960 | Ga0439446_0017496 | |||
| 961 | Ga0439434_0007482 | |||
| 962 | Ga0439434_0047405 | |||
| 963 | Ga0466963_0001587 | |||
| 964 | Ga0466963_0020629 | |||
| 965 | Ga0466963_0023895 | |||
| 966 | Ga0466963_0088491 | |||
| 967 | Ga0466964_0219865 | |||
| 968 | Ga0453684_0559802 | |||
| 969 | Ga0466957_0009613 | |||
| 970 | Ga0466960_0002081 | |||
| 971 | Ga0466958_0005666 | |||
| 972 | Ga0466958_0024239 | |||
| 973 | Ga0466967_0000555 | |||
| 974 | Ga0466967_0014314 | |||
| 975 | Ga0466967_0022767 | |||
| 976 | Ga0466967_0027717 | |||
| 977 | Ga0466967_0299787 | |||
| 978 | Ga0495629_0287657 | |||
| 979 | Ga0495582_0022614 | |||
| 980 | Ga0495582_0086865 | |||
| 981 | Ga0495662_0111597 | |||
| 982 | Ga0495584_0100028 | |||
| 983 | Ga0495584_0143892 | |||
| 984 | Ga0495596_0038320 | |||
| 985 | Ga0495630_0354328 | |||
| 986 | Ga0495663_0007023 | |||
| 987 | Ga0495609_0075319 | |||
| 988 | Ga0495656_0028893 | |||
| 989 | Ga0495611_0116239 | |||
| 990 | Ga0495588_0237156 | |||
| 991 | Ga0495647_0034315 | |||
| 992 | Ga0495658_0077221 | |||
| 993 | Ga0495658_0111647 | |||
| 994 | Ga0495658_0135399 | |||
| 995 | Ga0495613_0122811 | |||
| 996 | Ga0495624_0072630 | |||
| 997 | Ga0495671_0089847 | |||
| 998 | Ga0495660_0119257 | |||
| 999 | Ga0495581_0007101 | |||
| 1000 | Ga0495581_0049433 | |||
| 1001 | Ga0495636_0089250 | |||
| 1002 | Ga0495676_0073125 | |||
| 1003 | Ga0495677_0023733 | |||
| 1004 | Ga0495679_045111 | |||
| 1005 | Ga0495614_0104878 | |||
| 1006 | Ga0495614_0111129 | |||
| 1007 | Ga0496100_0000562 | |||
| 1008 | Ga0496100_0009228 | |||
| 1009 | Ga0496100_0014649 | |||
| 1010 | Ga0496100_0028760 | |||
| 1011 | Ga0496101_0019065 | |||
| 1012 | Ga0496101_0036097 | |||
| 1013 | Ga0496101_0240118 | |||
| 1014 | Ga0496101_0343497 | |||
| 1015 | Ga0496102_0012885 | |||
| 1016 | Ga0496102_0021890 | |||
| 1017 | Ga0496102_0047476 | |||
| 1018 | Ga0496102_0223257 | |||
| 1019 | Ga0496102_0887246 | |||
| 1020 | Ga0496103_0008185 | |||
| 1021 | Ga0496103_0016560 | |||
| 1022 | Ga0496104_0008718 | |||
| 1023 | Ga0496104_0064659 | |||
| 1024 | Ga0496104_0109017 | |||
| 1025 | Ga0496104_0112435 | |||
| 1026 | Ga0496104_0161402 | |||
| 1027 | Ga0496105_0035273 | |||
| 1028 | Ga0496105_0035586 | |||
| 1029 | Ga0496105_0089868 | |||
| 1030 | Ga0496105_0151614 | |||
| 1031 | Ga0496106_0000947 | |||
| 1032 | Ga0496106_0008736 | |||
| 1033 | Ga0496106_0023453 | |||
| 1034 | Ga0496106_0150168 | |||
| 1035 | Ga0496107_0005049 | |||
| 1036 | Ga0496107_0005428 | |||
| 1037 | Ga0496107_0028999 | |||
| 1038 | Ga0496107_0041296 | |||
| 1039 | Ga0496107_0149791 | |||
| 1040 | Ga0496107_0195616 | |||
| 1041 | Ga0496108_0000624 | |||
| 1042 | Ga0496108_0002781 | |||
| 1043 | Ga0496108_0017252 | |||
| 1044 | Ga0496108_0267338 | |||
| 1045 | Ga0496109_0003289 | |||
| 1046 | Ga0496109_0003615 | |||
| 1047 | Ga0496109_0021879 | |||
| 1048 | Ga0496109_0069085 | |||
| 1049 | Ga0496109_0275143 | |||
| 1050 | Ga0496110_0005543 | |||
| 1051 | Ga0496110_0012925 | |||
| 1052 | Ga0496110_0032605 | |||
| 1053 | Ga0496110_0060984 | |||
| 1054 | Ga0496110_0100082 | |||
| 1055 | Ga0496110_0109704 | |||
| 1056 | Ga0496110_0628696 | |||
| 1057 | Ga0496111_0007351 | |||
| 1058 | Ga0496111_0038339 | |||
| 1059 | Ga0496111_0105742 | |||
| 1060 | Ga0496112_0272621 | |||
| 1061 | Ga0496112_0427592 | |||
| 1062 | Ga0496113_0039573 | |||
| 1063 | Ga0496114_0001024 | |||
| 1064 | Ga0496114_0002096 | |||
| 1065 | Ga0496114_0146723 | |||
| 1066 | Ga0496114_0295140 | |||
| 1067 | Ga0496114_0379599 | |||
| 1068 | Ga0496115_0000582 | |||
| 1069 | Ga0496115_0003405 | |||
| 1070 | Ga0496115_0164252 | |||
| 1071 | Ga0496115_0188829 | |||
| 1072 | Ga0501031_0006904 | |||
| 1073 | Ga0501031_0007910 | |||
| 1074 | Ga0501031_0094763 | |||
| 1075 | Ga0501031_0164767 | |||
| 1076 | Ga0501032_0035338 | |||
| 1077 | Ga0501032_0056603 | |||
| 1078 | Ga0501033_0115598 | |||
| 1079 | Ga0501033_0341696 | |||
| 1080 | Ga0501034_0019302 | |||
| 1081 | Ga0501034_0440312 | |||
| 1082 | Ga0501036_0000560 | |||
| 1083 | Ga0501036_0046499 | |||
| 1084 | Ga0501036_0054977 | |||
| 1085 | Ga0501036_0224565 | |||
| 1086 | Ga0501036_0353237 | |||
| 1087 | Ga0501037_0036854 | |||
| 1088 | Ga0501037_0080300 | |||
| 1089 | Ga0501037_0085677 | |||
| 1090 | Ga0501037_0176613 | |||
| 1091 | Ga0501038_0018289 | |||
| 1092 | Ga0501038_0030973 | |||
| 1093 | Ga0501038_0087300 | |||
| 1094 | Ga0501038_0109552 | |||
| 1095 | Ga0501038_0197010 | |||
| 1096 | Ga0501039_0006006 | |||
| 1097 | Ga0501039_0011843 | |||
| 1098 | Ga0501039_0022712 | |||
| 1099 | Ga0501039_0065258 | |||
| 1100 | Ga0501039_0129455 | |||
| 1101 | Ga0501039_0264931 | |||
| 1102 | Ga0501039_0310388 | |||
| 1103 | Ga0501040_0002692 | |||
| 1104 | Ga0501040_0002922 | |||
| 1105 | Ga0501040_0003900 | |||
| 1106 | Ga0501040_0004718 | |||
| 1107 | Ga0501040_0009095 | |||
| 1108 | Ga0501040_0022242 | |||
| 1109 | Ga0501041_0009869 | |||
| 1110 | Ga0501041_0011683 | |||
| 1111 | Ga0501041_0018911 | |||
| 1112 | Ga0501041_0020648 | |||
| 1113 | Ga0501041_0224984 | |||
| 1114 | Ga0501042_0003011 | |||
| 1115 | Ga0501042_0008693 | |||
| 1116 | Ga0501042_0010246 | |||
| 1117 | Ga0501042_0071530 | |||
| 1118 | Ga0501042_0081449 | |||
| 1119 | Ga0501042_0109313 | |||
| 1120 | Ga0501042_0222583 | |||
| 1121 | Ga0501043_0012731 | |||
| 1122 | Ga0501043_0093179 | |||
| 1123 | Ga0501046_0013898 | |||
| 1124 | Ga0501046_0017956 | |||
| 1125 | Ga0501046_0062729 | |||
| 1126 | Ga0501047_0031214 | |||
| 1127 | Ga0501047_0132810 | |||
| 1128 | Ga0501048_0010391 | |||
| 1129 | Ga0501048_0020302 | |||
| 1130 | Ga0501048_0022268 | |||
| 1131 | Ga0501048_0056116 | |||
| 1132 | Ga0501048_0230255 | |||
| 1133 | Ga0501048_0350873 | |||
| 1134 | Ga0501067_0004665 | |||
| 1135 | Ga0501067_0042738 | |||
| 1136 | Ga0501068_0010778 | |||
| 1137 | Ga0501069_0004225 | |||
| 1138 | Ga0501069_0009787 | |||
| 1139 | Ga0501070_0080452 | |||
| 1140 | Ga0501070_0128909 | |||
| 1141 | Ga0501070_0182256 | |||
| 1142 | Ga0501071_0005907 | |||
| 1143 | Ga0501071_0007483 | |||
| 1144 | Ga0501071_0013806 | |||
| 1145 | Ga0501071_0061354 | |||
| 1146 | Ga0501071_0116427 | |||
| 1147 | Ga0501071_0183271 | |||
| 1148 | Ga0501072_0002551 | |||
| 1149 | Ga0501072_0003113 | |||
| 1150 | Ga0501072_0003655 | |||
| 1151 | Ga0501072_0011825 | |||
| 1152 | Ga0501072_0027290 | |||
| 1153 | Ga0501072_0030561 | |||
| 1154 | Ga0501072_0393690 | |||
| 1155 | Ga0501074_0007233 | |||
| 1156 | Ga0501074_0019108 | |||
| 1157 | Ga0501074_0022246 | |||
| 1158 | Ga0501074_0125560 | |||
| 1159 | Ga0501074_0373543 | |||
| 1160 | Ga0501075_0012816 | |||
| 1161 | Ga0501075_0027110 | |||
| 1162 | Ga0501075_0044425 | |||
| 1163 | Ga0501075_0048758 | |||
| 1164 | Ga0501075_0053128 | |||
| 1165 | Ga0501075_0057331 | |||
| 1166 | Ga0501075_0107252 | |||
| 1167 | Ga0501076_0008773 | |||
| 1168 | Ga0501076_0038371 | |||
| 1169 | Ga0501076_0049778 | |||
| 1170 | Ga0501076_0053813 | |||
| 1171 | Ga0501076_0065383 | |||
| 1172 | Ga0501076_0067490 | |||
| 1173 | Ga0501076_0179454 | |||
| 1174 | Ga0501077_0002026 | |||
| 1175 | Ga0501077_0003107 | |||
| 1176 | Ga0501077_0014120 | |||
| 1177 | Ga0501077_0034923 | |||
| 1178 | Ga0501077_0057722 | |||
| 1179 | Ga0501077_0081602 | |||
| 1180 | Ga0501077_0244383 | |||
| 1181 | Ga0501079_0011778 | |||
| 1182 | Ga0501079_0014740 | |||
| 1183 | Ga0501079_0031741 | |||
| 1184 | Ga0501079_0035590 | |||
| 1185 | Ga0501079_0055283 | |||
| 1186 | Ga0501079_0066269 | |||
| 1187 | Ga0501079_0208933 | |||
| 1188 | Ga0501079_0419222 | |||
| 1189 | Ga0501079_0557297 | |||
| 1190 | Ga0501080_0004079 | |||
| 1191 | Ga0501080_0046822 | |||
| 1192 | Ga0501080_0113623 | |||
| 1193 | Ga0501080_0273707 | |||
| 1194 | Ga0501080_0363350 | |||
| 1195 | Ga0501081_0007919 | |||
| 1196 | Ga0501081_0010102 | |||
| 1197 | Ga0501081_0021825 | |||
| 1198 | Ga0501081_0022924 | |||
| 1199 | Ga0501083_0151820 | |||
| 1200 | Ga0501035_0006184 | |||
| 1201 | Ga0501035_0049384 | |||
| 1202 | Ga0501035_0070128 | |||
| 1203 | Ga0501044_0037497 | |||
| 1204 | Ga0501045_0000887 | |||
| 1205 | Ga0501045_0004417 | |||
| 1206 | Ga0501045_0014517 | |||
| 1207 | Ga0501045_0023380 | |||
| 1208 | Ga0501045_0130655 | |||
| 1209 | Ga0501045_0147629 | |||
| 1210 | Ga0501045_0293872 | |||
| 1211 | nmdc:mga05p37_777663_c1 | |||
| 1212 | nmdc:mga09592_194993_c1 | |||
| 1213 | nmdc:mga08y16_61340_c1 | |||
| 1214 | nmdc:mga0n895_257217_c1 | |||
| 1215 | nmdc:mga0n895_38969_c1 | |||
| 1216 | nmdc:mga0rr50_24039_c1 | |||
| 1217 | nmdc:mga0rr50_72879_c1 | |||
| 1218 | nmdc:mga08x19_70552_c1 | |||
| 1219 | nmdc:mga0a205_251023_c1 | |||
| 1220 | Ga0495601_0032258 | |||
| 1221 | Ga0495612_0085281 | |||
| 1222 | Ga0495655_0030024 | |||
| 1223 | Ga0495595_0095711 | |||
| 1224 | Ga0501084_0000453 | |||
| 1225 | Ga0501084_0003128 | |||
| 1226 | Ga0501084_0013220 | |||
| 1227 | Ga0501084_0015732 | |||
| 1228 | Ga0501084_0036541 | |||
| 1229 | Ga0501084_0041840 | |||
| 1230 | Ga0501084_0085755 | |||
| 1231 | Ga0501084_0115424 | |||
| 1232 | Ga0501084_0151549 | |||
| 1233 | Ga0590075_026339 | |||
| 1234 | Ga0590075_044470 | |||
| 1235 | Ga0590077_047936 | |||
| 1236 | Ga0501082_0003088 | |||
| 1237 | Ga0501082_0028393 | |||
| 1238 | Ga0501082_0053735 | |||
| 1239 | Ga0501082_0085154 | |||
| 1240 | Ga0501082_0166128 | |||
| 1241 | Ga0501082_0241918 | |||
| 1242 | Ga0501082_0279221 | |||
| 1243 | Ga0501082_0346844 | |||
| 1244 | Ga0530510_0000145 | |||
| 1245 | Ga0530510_0000922 | |||
| 1246 | Ga0530510_0003321 | |||
| 1247 | Ga0530510_0015875 | |||
| 1248 | Ga0530510_0032997 | |||
| 1249 | Ga0530510_0034835 | |||
| 1250 | Ga0530510_0264637 | |||
| 1251 | Ga0530510_0457373 | |||
| 1252 | 2555469028 | |||
| 1253 | 2644739998 | |||
| 1254 | 2819724811 | |||
| 1255 | 2908665693 | |||
| 1256 | 2919094134 | |||
| 1257 | 2919728995 | |||
| 1258 | 2954774467 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b2o-assembly1.cif.gz_D | crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. | 0.9505 | 1 | 245 |
| 4b2o-assembly1.cif.gz_D | crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. | 0.9356 | 1 | 245 |
| 1t70-assembly3.cif.gz_E | crystal structure of a novel phosphatase from deinococcus radiodurans | 0.9259 | 1 | 244 |
| 2cv9-assembly1.cif.gz_A | crystal structure of a hypothetical protein from thermus thermophilus hb8 | 0.9158 | 1 | 246 |
| 1t71-assembly1.cif.gz_A | crystal structure of a novel phosphatase mycoplasma pneumoniaefrom | 0.9094 | 1 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b2oD00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9505 | 1 | 245 | 3.60.21.10 |
| 4b2oD00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9356 | 1 | 245 | 3.60.21.10 |
| 2z06B00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9196 | 1 | 246 | 3.60.21.10 |
| 1t71A00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9094 | 1 | 244 | 3.60.21.10 |
| 2z06B00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9089 | 1 | 246 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535CKE3-F1-model_v4 | YmdB family metallophosphoesterase | 0.9904 | 1 | 72 |
GO:0004113
|
| AF-A0A7V9JJ74-F1-model_v4 | YmdB family metallophosphoesterase | 0.9893 | 10 | 123 |
GO:0004113
|
| AF-A0A435NMD2-F1-model_v4 | deleted | 0.9887 | 1 | 90 |
|
| AF-A0A529M3P3-F1-model_v4 | Metallophosphoesterase | 0.9871 | 1 | 74 |
GO:0004113
|
| AF-A0A3B0TKD1-F1-model_v4 | Metallophosphoesterase | 0.9863 | 1 | 70 |
GO:0004113
|