F470709
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 629 | 277 | 629 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300005354|Ga0070675_100004466|Ga0070675_10000446611 |
| Length | 144 |
| Sequence | MQILYQSGAARPQWPRTAWYMLPAMSTQTVRLHRWDEIALEKVTEMISRKVVTGEREMIAQIYLKRGCVVPMHSHESEQMTYILQGALKFLINGEDITVREGEVLHIPSWVKHQAEALEDTFELDVFSPIRQDWLDHTDDYFHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 170 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 179 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 184 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 191 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 192 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 193 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 196 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 272 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 274 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 275 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 276 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 277 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.84 |
| Metatranscriptomes | 0.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.48 |
| Nodule | 0 |
| Rhizoplane | 5.88 |
| Rhizosphere | 92.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058861_11649032 | 3300004800 | Unclassified | 614 |
| 2 | Ga0065704_10328300 | 3300005289 | Unclassified | 770 |
| 3 | Ga0065704_10395349 | 3300005289 | Unclassified | 758 |
| 4 | Ga0065712_10658778 | 3300005290 | Unclassified | 564 |
| 5 | Ga0065712_10695200 | 3300005290 | Unclassified | 549 |
| 6 | Ga0065715_10235948 | 3300005293 | Unclassified | 1217 |
| 7 | Ga0065707_10229407 | 3300005295 | Bacteria | 1194 |
| 8 | Ga0065707_10466030 | 3300005295 | Bacteria | 786 |
| 9 | Ga0065707_10494391 | 3300005295 | Bacteria | 753 |
| 10 | Ga0065707_10841531 | 3300005295 | Unclassified | 585 |
| 11 | Ga0070683_100307220 | 3300005329 | Bacteria | 1509 |
| 12 | Ga0070690_100004756 | 3300005330 | Bacteria | 7578 |
| 13 | Ga0068869_100110925 | 3300005334 | Bacteria | 2087 |
| 14 | Ga0068869_100683740 | 3300005334 | Bacteria | 874 |
| 15 | Ga0070666_10004274 | 3300005335 | Bacteria | 8686 |
| 16 | Ga0070666_10048991 | 3300005335 | Bacteria | 2839 |
| 17 | Ga0070666_10105043 | 3300005335 | Bacteria | 1950 |
| 18 | Ga0070666_10991708 | 3300005335 | Bacteria | 623 |
| 19 | Ga0070680_100118471 | 3300005336 | Bacteria | 2209 |
| 20 | Ga0070682_101117536 | 3300005337 | Bacteria | 661 |
| 21 | Ga0070682_102014643 | 3300005337 | Bacteria | 508 |
| 22 | Ga0068868_100094450 | 3300005338 | Bacteria | 2413 |
| 23 | Ga0068868_100183193 | 3300005338 | Bacteria | 1738 |
| 24 | Ga0068868_100495622 | 3300005338 | Bacteria | 1069 |
| 25 | Ga0068868_100738452 | 3300005338 | Bacteria | 884 |
| 26 | Ga0070660_100001966 | 3300005339 | Bacteria | 14175 |
| 27 | Ga0070687_100060442 | 3300005343 | Bacteria | 1999 |
| 28 | Ga0070661_100481554 | 3300005344 | Bacteria | 991 |
| 29 | Ga0070692_10681153 | 3300005345 | Bacteria | 690 |
| 30 | Ga0070668_102079994 | 3300005347 | Unclassified | 524 |
| 31 | Ga0070669_100709900 | 3300005353 | Bacteria | 850 |
| 32 | Ga0070675_100004466 | 3300005354 | Bacteria | 10667 |
| 33 | Ga0070675_100250238 | 3300005354 | Bacteria | 1551 |
| 34 | Ga0070675_100887743 | 3300005354 | Bacteria | 817 |
| 35 | Ga0070675_101697430 | 3300005354 | Unclassified | 583 |
| 36 | Ga0070671_100166308 | 3300005355 | Bacteria | 1865 |
| 37 | Ga0070674_100108602 | 3300005356 | Bacteria | 2033 |
| 38 | Ga0070674_100938395 | 3300005356 | Bacteria | 756 |
| 39 | Ga0070674_101002357 | 3300005356 | Bacteria | 733 |
| 40 | Ga0070688_100006201 | 3300005365 | Bacteria | 6367 |
| 41 | Ga0070659_100268227 | 3300005366 | Bacteria | 1418 |
| 42 | Ga0070659_100899169 | 3300005366 | Bacteria | 774 |
| 43 | Ga0070709_10020183 | 3300005434 | Bacteria | 3863 |
| 44 | Ga0070709_10673838 | 3300005434 | Unclassified | 803 |
| 45 | Ga0070714_100019930 | 3300005435 | Bacteria | 5472 |
| 46 | Ga0070714_101783007 | 3300005435 | Unclassified | 601 |
| 47 | Ga0070713_100033773 | 3300005436 | Unclassified | 4102 |
| 48 | Ga0070713_100343239 | 3300005436 | Bacteria | 1384 |
| 49 | Ga0070713_101089000 | 3300005436 | Unclassified | 772 |
| 50 | Ga0070711_100044962 | 3300005439 | Unclassified | 3000 |
| 51 | Ga0070694_100049881 | 3300005444 | Bacteria | 2820 |
| 52 | Ga0070708_100026937 | 3300005445 | Bacteria | 4926 |
| 53 | Ga0070678_102081469 | 3300005456 | Bacteria | 537 |
| 54 | Ga0070681_10144591 | 3300005458 | Bacteria | 2307 |
| 55 | Ga0070681_11097231 | 3300005458 | Bacteria | 717 |
| 56 | Ga0068867_100017018 | 3300005459 | Bacteria | 5166 |
| 57 | Ga0068867_100028224 | 3300005459 | Bacteria | 4040 |
| 58 | Ga0068867_100043691 | 3300005459 | Bacteria | 3281 |
| 59 | Ga0068867_101669451 | 3300005459 | Unclassified | 597 |
| 60 | Ga0070706_101532776 | 3300005467 | Unclassified | 609 |
| 61 | Ga0070707_100023046 | 3300005468 | Bacteria | 5890 |
| 62 | Ga0070707_100259994 | 3300005468 | Bacteria | 1689 |
| 63 | Ga0070698_100621810 | 3300005471 | Bacteria | 1021 |
| 64 | Ga0070698_100970267 | 3300005471 | Bacteria | 797 |
| 65 | Ga0070698_101409392 | 3300005471 | Bacteria | 648 |
| 66 | Ga0070679_100033161 | 3300005530 | Bacteria | 5113 |
| 67 | Ga0068853_100260879 | 3300005539 | Bacteria | 1593 |
| 68 | Ga0070686_100000963 | 3300005544 | Bacteria | 16588 |
| 69 | Ga0070686_100100421 | 3300005544 | Bacteria | 1954 |
| 70 | Ga0070686_101097380 | 3300005544 | Bacteria | 657 |
| 71 | Ga0070695_100001340 | 3300005545 | Bacteria | 13632 |
| 72 | Ga0070695_100592642 | 3300005545 | Unclassified | 869 |
| 73 | Ga0070696_101338727 | 3300005546 | Unclassified | 609 |
| 74 | Ga0070693_100251819 | 3300005547 | Bacteria | 1171 |
| 75 | Ga0070693_100491826 | 3300005547 | Unclassified | 869 |
| 76 | Ga0070665_100015811 | 3300005548 | Bacteria | 7579 |
| 77 | Ga0070665_100040249 | 3300005548 | Bacteria | 4698 |
| 78 | Ga0070665_101038174 | 3300005548 | Bacteria | 832 |
| 79 | Ga0070704_100008143 | 3300005549 | Bacteria | 6267 |
| 80 | Ga0070704_101593994 | 3300005549 | Unclassified | 602 |
| 81 | Ga0068855_100050305 | 3300005563 | Bacteria | 4912 |
| 82 | Ga0070664_100735849 | 3300005564 | Unclassified | 920 |
| 83 | Ga0068852_100884282 | 3300005616 | Bacteria | 910 |
| 84 | Ga0068859_100086643 | 3300005617 | Bacteria | 3179 |
| 85 | Ga0068859_100094330 | 3300005617 | Bacteria | 3044 |
| 86 | Ga0068859_100172071 | 3300005617 | Bacteria | 2247 |
| 87 | Ga0068859_100181838 | 3300005617 | Bacteria | 2186 |
| 88 | Ga0068859_101156897 | 3300005617 | Bacteria | 852 |
| 89 | Ga0068864_100047469 | 3300005618 | Bacteria | 3688 |
| 90 | Ga0068864_100171947 | 3300005618 | Bacteria | 1976 |
| 91 | Ga0068864_100178013 | 3300005618 | Bacteria | 1942 |
| 92 | Ga0068864_100426667 | 3300005618 | Bacteria | 1264 |
| 93 | Ga0068866_10522585 | 3300005718 | Bacteria | 789 |
| 94 | Ga0068861_100674299 | 3300005719 | Bacteria | 958 |
| 95 | Ga0068861_100888633 | 3300005719 | Bacteria | 843 |
| 96 | Ga0068851_10918967 | 3300005834 | Bacteria | 549 |
| 97 | Ga0068870_10289554 | 3300005840 | Bacteria | 1030 |
| 98 | Ga0068870_10353257 | 3300005840 | Bacteria | 944 |
| 99 | Ga0068870_10994360 | 3300005840 | Bacteria | 598 |
| 100 | Ga0068863_100196799 | 3300005841 | Bacteria | 1937 |
| 101 | Ga0068863_100471890 | 3300005841 | Bacteria | 1233 |
| 102 | Ga0068863_101710232 | 3300005841 | Unclassified | 639 |
| 103 | Ga0068858_100074465 | 3300005842 | Bacteria | 3152 |
| 104 | Ga0068858_100239411 | 3300005842 | Bacteria | 1722 |
| 105 | Ga0068858_100301885 | 3300005842 | Bacteria | 1528 |
| 106 | Ga0068858_100564256 | 3300005842 | Bacteria | 1102 |
| 107 | Ga0068858_101275742 | 3300005842 | Bacteria | 723 |
| 108 | Ga0068860_100070798 | 3300005843 | Bacteria | 3316 |
| 109 | Ga0068860_100083516 | 3300005843 | Bacteria | 3038 |
| 110 | Ga0068860_100086969 | 3300005843 | Bacteria | 2975 |
| 111 | Ga0068860_100254505 | 3300005843 | Bacteria | 1711 |
| 112 | Ga0068860_100432237 | 3300005843 | Bacteria | 1306 |
| 113 | Ga0068860_101142541 | 3300005843 | Bacteria | 799 |
| 114 | Ga0068860_101539996 | 3300005843 | Bacteria | 687 |
| 115 | Ga0068862_100932834 | 3300005844 | Unclassified | 855 |
| 116 | Ga0081455_10027171 | 3300005937 | Bacteria | 5246 |
| 117 | Ga0081455_10050866 | 3300005937 | Bacteria | 3558 |
| 118 | Ga0081539_10005884 | 3300005985 | Bacteria | 12142 |
| 119 | Ga0081539_10203790 | 3300005985 | Bacteria | 911 |
| 120 | Ga0081539_10255204 | 3300005985 | Unclassified | 777 |
| 121 | Ga0070717_10379540 | 3300006028 | Unclassified | 1267 |
| 122 | Ga0075366_10080458 | 3300006195 | Bacteria | 1946 |
| 123 | Ga0097621_100024756 | 3300006237 | Bacteria | 4691 |
| 124 | Ga0097621_100029071 | 3300006237 | Bacteria | 4363 |
| 125 | Ga0097621_100037069 | 3300006237 | Unclassified | 3903 |
| 126 | Ga0097621_100065556 | 3300006237 | Bacteria | 2989 |
| 127 | Ga0097621_100288417 | 3300006237 | Unclassified | 1446 |
| 128 | Ga0068871_100005117 | 3300006358 | Bacteria | 9159 |
| 129 | Ga0068871_100016282 | 3300006358 | Bacteria | 5594 |
| 130 | Ga0068871_100020872 | 3300006358 | Bacteria | 5025 |
| 131 | Ga0068871_100023236 | 3300006358 | Bacteria | 4792 |
| 132 | Ga0068871_100489376 | 3300006358 | Bacteria | 1107 |
| 133 | Ga0075428_100155906 | 3300006844 | Bacteria | 2481 |
| 134 | Ga0075431_102072731 | 3300006847 | Unclassified | 524 |
| 135 | Ga0075433_10016223 | 3300006852 | Bacteria | 6128 |
| 136 | Ga0075433_10047304 | 3300006852 | Bacteria | 3742 |
| 137 | Ga0075433_10153870 | 3300006852 | Bacteria | 2046 |
| 138 | Ga0075433_10295778 | 3300006852 | Unclassified | 1434 |
| 139 | Ga0075433_10691655 | 3300006852 | Bacteria | 893 |
| 140 | Ga0075433_11264287 | 3300006852 | Unclassified | 640 |
| 141 | Ga0075434_100000465 | 3300006871 | Bacteria | 30350 |
| 142 | Ga0075434_100000731 | 3300006871 | Bacteria | 25794 |
| 143 | Ga0075434_100042170 | 3300006871 | Bacteria | 4523 |
| 144 | Ga0075434_100477466 | 3300006871 | Bacteria | 1268 |
| 145 | Ga0075434_100543261 | 3300006871 | Unclassified | 1182 |
| 146 | Ga0075434_100918225 | 3300006871 | Bacteria | 890 |
| 147 | Ga0075434_101121466 | 3300006871 | Bacteria | 800 |
| 148 | Ga0075434_101136582 | 3300006871 | Unclassified | 794 |
| 149 | Ga0075429_100206107 | 3300006880 | Bacteria | 1723 |
| 150 | Ga0075429_100295406 | 3300006880 | Bacteria | 1418 |
| 151 | Ga0068865_100046494 | 3300006881 | Bacteria | 2978 |
| 152 | Ga0068865_100499957 | 3300006881 | Bacteria | 1013 |
| 153 | Ga0075436_100004025 | 3300006914 | Bacteria | 10084 |
| 154 | Ga0075436_100005802 | 3300006914 | Bacteria | 8479 |
| 155 | Ga0075436_100040865 | 3300006914 | Bacteria | 3200 |
| 156 | Ga0075436_100149756 | 3300006914 | Bacteria | 1642 |
| 157 | Ga0097620_100086637 | 3300006931 | Bacteria | 3179 |
| 158 | Ga0097620_100094330 | 3300006931 | Bacteria | 3044 |
| 159 | Ga0097620_100172064 | 3300006931 | Bacteria | 2247 |
| 160 | Ga0097620_100181832 | 3300006931 | Bacteria | 2186 |
| 161 | Ga0097620_101156948 | 3300006931 | Bacteria | 852 |
| 162 | Ga0075435_100000052 | 3300007076 | Bacteria | 58955 |
| 163 | Ga0075435_100013121 | 3300007076 | Bacteria | 6155 |
| 164 | Ga0075435_100015063 | 3300007076 | Bacteria | 5803 |
| 165 | Ga0075435_100082108 | 3300007076 | Bacteria | 2649 |
| 166 | Ga0075435_100208908 | 3300007076 | Bacteria | 1655 |
| 167 | Ga0075435_100970603 | 3300007076 | Bacteria | 742 |
| 168 | Ga0099795_10171720 | 3300007788 | Unclassified | 901 |
| 169 | Ga0105251_10146622 | 3300009011 | Bacteria | 1067 |
| 170 | Ga0105240_10018398 | 3300009093 | Bacteria | 9381 |
| 171 | Ga0105240_10035708 | 3300009093 | Bacteria | 6403 |
| 172 | Ga0105240_10171280 | 3300009093 | Bacteria | 2571 |
| 173 | Ga0105240_10241064 | 3300009093 | Bacteria | 2096 |
| 174 | Ga0105240_10755916 | 3300009093 | Bacteria | 1056 |
| 175 | Ga0105240_12201075 | 3300009093 | Unclassified | 572 |
| 176 | Ga0105240_12205863 | 3300009093 | Unclassified | 571 |
| 177 | Ga0111539_12102096 | 3300009094 | Unclassified | 655 |
| 178 | Ga0105245_10005875 | 3300009098 | Bacteria | 10780 |
| 179 | Ga0105245_10187510 | 3300009098 | Bacteria | 1979 |
| 180 | Ga0105245_10307596 | 3300009098 | Bacteria | 1557 |
| 181 | Ga0105245_10717186 | 3300009098 | Unclassified | 1034 |
| 182 | Ga0105245_10726059 | 3300009098 | Bacteria | 1028 |
| 183 | Ga0105247_10012110 | 3300009101 | Bacteria | 5185 |
| 184 | Ga0105247_10026511 | 3300009101 | Bacteria | 3500 |
| 185 | Ga0105247_10080714 | 3300009101 | Bacteria | 2049 |
| 186 | Ga0114129_10000307 | 3300009147 | Bacteria | 57086 |
| 187 | Ga0114129_10017851 | 3300009147 | Bacteria | 10104 |
| 188 | Ga0114129_10032741 | 3300009147 | Bacteria | 7345 |
| 189 | Ga0114129_10098585 | 3300009147 | Bacteria | 4045 |
| 190 | Ga0114129_10195912 | 3300009147 | Bacteria | 2740 |
| 191 | Ga0114129_10288190 | 3300009147 | Bacteria | 2192 |
| 192 | Ga0114129_10418381 | 3300009147 | Unclassified | 1763 |
| 193 | Ga0105243_11562486 | 3300009148 | Unclassified | 685 |
| 194 | Ga0105243_12391753 | 3300009148 | Unclassified | 566 |
| 195 | Ga0105241_10146136 | 3300009174 | Bacteria | 1929 |
| 196 | Ga0105241_12185013 | 3300009174 | Bacteria | 549 |
| 197 | Ga0105242_10009949 | 3300009176 | Bacteria | 7283 |
| 198 | Ga0105242_10056866 | 3300009176 | Bacteria | 3202 |
| 199 | Ga0105248_10000664 | 3300009177 | Bacteria | 39095 |
| 200 | Ga0105248_10173442 | 3300009177 | Bacteria | 2431 |
| 201 | Ga0105248_10325558 | 3300009177 | Unclassified | 1731 |
| 202 | Ga0105248_10846000 | 3300009177 | Bacteria | 1033 |
| 203 | Ga0105248_10873281 | 3300009177 | Bacteria | 1015 |
| 204 | Ga0105248_10958174 | 3300009177 | Unclassified | 966 |
| 205 | Ga0105248_11272525 | 3300009177 | Bacteria | 832 |
| 206 | Ga0105248_13122015 | 3300009177 | Unclassified | 527 |
| 207 | Ga0105237_10712622 | 3300009545 | Bacteria | 1010 |
| 208 | Ga0105238_10213283 | 3300009551 | Bacteria | 1907 |
| 209 | Ga0105238_10317501 | 3300009551 | Bacteria | 1543 |
| 210 | Ga0105238_10450712 | 3300009551 | Unclassified | 1284 |
| 211 | Ga0105238_10906446 | 3300009551 | Bacteria | 900 |
| 212 | Ga0105238_11388531 | 3300009551 | Bacteria | 729 |
| 213 | Ga0105238_11887019 | 3300009551 | Bacteria | 630 |
| 214 | Ga0105238_12150919 | 3300009551 | Bacteria | 592 |
| 215 | Ga0105238_12204173 | 3300009551 | Bacteria | 586 |
| 216 | Ga0105249_10781604 | 3300009553 | Unclassified | 1018 |
| 217 | Ga0105249_12164565 | 3300009553 | Bacteria | 629 |
| 218 | Ga0099796_10477380 | 3300010159 | Bacteria | 557 |
| 219 | Ga0105239_11984086 | 3300010375 | Unclassified | 675 |
| 220 | Ga0105246_10740957 | 3300011119 | Unclassified | 866 |
| 221 | Ga0157370_10269569 | 3300013104 | Unclassified | 1573 |
| 222 | Ga0157370_10865933 | 3300013104 | Bacteria | 821 |
| 223 | Ga0157369_10942880 | 3300013105 | Bacteria | 885 |
| 224 | Ga0157374_10042917 | 3300013296 | Bacteria | 4175 |
| 225 | Ga0157374_10349483 | 3300013296 | Bacteria | 1469 |
| 226 | Ga0157374_10446677 | 3300013296 | Bacteria | 1294 |
| 227 | Ga0157378_10032763 | 3300013297 | Bacteria | 4593 |
| 228 | Ga0157378_10711969 | 3300013297 | Bacteria | 1024 |
| 229 | Ga0157378_11837605 | 3300013297 | Unclassified | 654 |
| 230 | Ga0163162_12136000 | 3300013306 | Unclassified | 642 |
| 231 | Ga0157372_10444709 | 3300013307 | Unclassified | 1511 |
| 232 | Ga0157375_10481794 | 3300013308 | Bacteria | 1406 |
| 233 | Ga0157375_10627147 | 3300013308 | Unclassified | 1233 |
| 234 | Ga0157375_10840218 | 3300013308 | Bacteria | 1065 |
| 235 | Ga0157375_10920154 | 3300013308 | Unclassified | 1018 |
| 236 | Ga0157375_11390617 | 3300013308 | Bacteria | 827 |
| 237 | Ga0157375_12339288 | 3300013308 | Bacteria | 637 |
| 238 | Ga0157375_13291409 | 3300013308 | Unclassified | 539 |
| 239 | Ga0163163_10059736 | 3300014325 | Bacteria | 3773 |
| 240 | Ga0163163_10097589 | 3300014325 | Bacteria | 2959 |
| 241 | Ga0163163_10177830 | 3300014325 | Bacteria | 2175 |
| 242 | Ga0163163_10270754 | 3300014325 | Unclassified | 1750 |
| 243 | Ga0163163_11556175 | 3300014325 | Bacteria | 722 |
| 244 | Ga0163163_11959106 | 3300014325 | Unclassified | 646 |
| 245 | Ga0157380_10186270 | 3300014326 | Unclassified | 1828 |
| 246 | Ga0157380_11094899 | 3300014326 | Unclassified | 835 |
| 247 | Ga0157377_10027736 | 3300014745 | Bacteria | 3043 |
| 248 | Ga0157377_10046866 | 3300014745 | Bacteria | 2420 |
| 249 | Ga0157379_10076657 | 3300014968 | Bacteria | 2994 |
| 250 | Ga0157379_10298700 | 3300014968 | Bacteria | 1467 |
| 251 | Ga0157379_10585140 | 3300014968 | Bacteria | 1041 |
| 252 | Ga0157379_12472712 | 3300014968 | Bacteria | 519 |
| 253 | Ga0157376_10030645 | 3300014969 | Bacteria | 4298 |
| 254 | Ga0157376_10102220 | 3300014969 | Unclassified | 2507 |
| 255 | Ga0157376_10136327 | 3300014969 | Bacteria | 2197 |
| 256 | Ga0157376_10466157 | 3300014969 | Bacteria | 1235 |
| 257 | Ga0157376_10502484 | 3300014969 | Bacteria | 1192 |
| 258 | Ga0163161_10678193 | 3300017792 | Bacteria | 856 |
| 259 | Ga0213876_10266514 | 3300021384 | Unclassified | 910 |
| 260 | Ga0207692_10218378 | 3300025898 | Bacteria | 1129 |
| 261 | Ga0207642_10294954 | 3300025899 | Bacteria | 938 |
| 262 | Ga0207642_10486661 | 3300025899 | Bacteria | 753 |
| 263 | Ga0207710_10057099 | 3300025900 | Bacteria | 1763 |
| 264 | Ga0207710_10516206 | 3300025900 | Unclassified | 621 |
| 265 | Ga0207688_10189823 | 3300025901 | Unclassified | 1228 |
| 266 | Ga0207688_10394127 | 3300025901 | Bacteria | 858 |
| 267 | Ga0207680_10005662 | 3300025903 | Bacteria | 5979 |
| 268 | Ga0207680_10381011 | 3300025903 | Unclassified | 994 |
| 269 | Ga0207680_10673572 | 3300025903 | Bacteria | 741 |
| 270 | Ga0207685_10492460 | 3300025905 | Unclassified | 644 |
| 271 | Ga0207699_10063158 | 3300025906 | Unclassified | 2236 |
| 272 | Ga0207699_10622881 | 3300025906 | Unclassified | 787 |
| 273 | Ga0207699_10647623 | 3300025906 | Bacteria | 771 |
| 274 | Ga0207643_10036108 | 3300025908 | Bacteria | 2771 |
| 275 | Ga0207684_11515052 | 3300025910 | Bacteria | 545 |
| 276 | Ga0207654_10843416 | 3300025911 | Bacteria | 663 |
| 277 | Ga0207695_10037979 | 3300025913 | Bacteria | 5191 |
| 278 | Ga0207695_10069607 | 3300025913 | Bacteria | 3600 |
| 279 | Ga0207695_10386824 | 3300025913 | Bacteria | 1284 |
| 280 | Ga0207695_10720729 | 3300025913 | Bacteria | 878 |
| 281 | Ga0207663_10293064 | 3300025916 | Bacteria | 1213 |
| 282 | Ga0207663_10593727 | 3300025916 | Unclassified | 869 |
| 283 | Ga0207660_10098191 | 3300025917 | Bacteria | 2184 |
| 284 | Ga0207660_10708224 | 3300025917 | Bacteria | 821 |
| 285 | Ga0207660_11557915 | 3300025917 | Unclassified | 533 |
| 286 | Ga0207662_10029144 | 3300025918 | Bacteria | 3196 |
| 287 | Ga0207657_10006060 | 3300025919 | Bacteria | 12572 |
| 288 | Ga0207646_10025638 | 3300025922 | Bacteria | 5392 |
| 289 | Ga0207646_10036451 | 3300025922 | Bacteria | 4440 |
| 290 | Ga0207681_10243895 | 3300025923 | Bacteria | 1400 |
| 291 | Ga0207694_10701703 | 3300025924 | Unclassified | 853 |
| 292 | Ga0207694_10947711 | 3300025924 | Bacteria | 728 |
| 293 | Ga0207650_10049437 | 3300025925 | Bacteria | 3105 |
| 294 | Ga0207659_10000076 | 3300025926 | Bacteria | 62373 |
| 295 | Ga0207659_10036702 | 3300025926 | Bacteria | 3397 |
| 296 | Ga0207659_10143105 | 3300025926 | Bacteria | 1858 |
| 297 | Ga0207659_10670628 | 3300025926 | Bacteria | 887 |
| 298 | Ga0207659_11257471 | 3300025926 | Unclassified | 636 |
| 299 | Ga0207687_10014551 | 3300025927 | Bacteria | 5151 |
| 300 | Ga0207687_10296212 | 3300025927 | Bacteria | 1302 |
| 301 | Ga0207700_10365812 | 3300025928 | Unclassified | 1258 |
| 302 | Ga0207700_10462617 | 3300025928 | Bacteria | 1119 |
| 303 | Ga0207664_10329407 | 3300025929 | Bacteria | 1348 |
| 304 | Ga0207644_10250904 | 3300025931 | Bacteria | 1412 |
| 305 | Ga0207686_10041427 | 3300025934 | Bacteria | 2808 |
| 306 | Ga0207686_11389063 | 3300025934 | Bacteria | 578 |
| 307 | Ga0207670_10143021 | 3300025936 | Bacteria | 1766 |
| 308 | Ga0207669_10168297 | 3300025937 | Bacteria | 1557 |
| 309 | Ga0207704_10007732 | 3300025938 | Bacteria | 5099 |
| 310 | Ga0207704_10081580 | 3300025938 | Bacteria | 2092 |
| 311 | Ga0207704_10310713 | 3300025938 | Unclassified | 1212 |
| 312 | Ga0207691_10214543 | 3300025940 | Bacteria | 1671 |
| 313 | Ga0207691_11671270 | 3300025940 | Bacteria | 516 |
| 314 | Ga0207711_10040961 | 3300025941 | Bacteria | 3942 |
| 315 | Ga0207711_10159348 | 3300025941 | Bacteria | 2041 |
| 316 | Ga0207711_10374663 | 3300025941 | Bacteria | 1320 |
| 317 | Ga0207689_10098427 | 3300025942 | Bacteria | 2403 |
| 318 | Ga0207689_11060734 | 3300025942 | Bacteria | 683 |
| 319 | Ga0207661_10089205 | 3300025944 | Bacteria | 2565 |
| 320 | Ga0207679_10194034 | 3300025945 | Archaea | 1691 |
| 321 | Ga0207667_10268444 | 3300025949 | Bacteria | 1744 |
| 322 | Ga0207667_10885614 | 3300025949 | Bacteria | 885 |
| 323 | Ga0207712_10989956 | 3300025961 | Bacteria | 746 |
| 324 | Ga0207640_10432542 | 3300025981 | Bacteria | 1080 |
| 325 | Ga0207658_10064302 | 3300025986 | Bacteria | 2752 |
| 326 | Ga0207658_10411429 | 3300025986 | Bacteria | 1191 |
| 327 | Ga0207677_10377699 | 3300026023 | Bacteria | 1195 |
| 328 | Ga0207703_10004285 | 3300026035 | Bacteria | 11732 |
| 329 | Ga0207703_10122717 | 3300026035 | Bacteria | 2232 |
| 330 | Ga0207703_10158273 | 3300026035 | Bacteria | 1982 |
| 331 | Ga0207703_10754259 | 3300026035 | Bacteria | 927 |
| 332 | Ga0207703_11866391 | 3300026035 | Bacteria | 577 |
| 333 | Ga0207639_10083971 | 3300026041 | Bacteria | 2529 |
| 334 | Ga0207708_11763004 | 3300026075 | Bacteria | 543 |
| 335 | Ga0207641_10380237 | 3300026088 | Bacteria | 1352 |
| 336 | Ga0207641_10707790 | 3300026088 | Bacteria | 992 |
| 337 | Ga0207648_10012695 | 3300026089 | Bacteria | 7873 |
| 338 | Ga0207648_10054166 | 3300026089 | Bacteria | 3504 |
| 339 | Ga0207648_10065690 | 3300026089 | Bacteria | 3163 |
| 340 | Ga0207676_10054987 | 3300026095 | Bacteria | 3122 |
| 341 | Ga0207676_10630959 | 3300026095 | Bacteria | 1032 |
| 342 | Ga0207675_100346781 | 3300026118 | Bacteria | 1454 |
| 343 | Ga0207675_102747059 | 3300026118 | Unclassified | 500 |
| 344 | Ga0207683_10141097 | 3300026121 | Bacteria | 2171 |
| 345 | Ga0207683_10154586 | 3300026121 | Bacteria | 2072 |
| 346 | Ga0207683_10337631 | 3300026121 | Bacteria | 1381 |
| 347 | Ga0207683_11456658 | 3300026121 | Bacteria | 633 |
| 348 | Ga0207698_10790683 | 3300026142 | Bacteria | 950 |
| 349 | Ga0209970_1024966 | 3300027614 | Bacteria | 1023 |
| 350 | Ga0207428_10063031 | 3300027907 | Bacteria | 2930 |
| 351 | Ga0207428_10187496 | 3300027907 | Bacteria | 1560 |
| 352 | Ga0268266_10289770 | 3300028379 | Bacteria | 1524 |
| 353 | Ga0268266_10363307 | 3300028379 | Bacteria | 1362 |
| 354 | Ga0268265_11173954 | 3300028380 | Bacteria | 764 |
| 355 | Ga0268265_11315812 | 3300028380 | Bacteria | 723 |
| 356 | Ga0268264_10018278 | 3300028381 | Bacteria | 5733 |
| 357 | Ga0268264_10043052 | 3300028381 | Bacteria | 3740 |
| 358 | Ga0268264_10279296 | 3300028381 | Bacteria | 1563 |
| 359 | Ga0268264_10543639 | 3300028381 | Bacteria | 1138 |
| 360 | Ga0268264_10553742 | 3300028381 | Bacteria | 1128 |
| 361 | Ga0268264_10830879 | 3300028381 | Bacteria | 924 |
| 362 | Ga0265318_10052387 | 3300028577 | Unclassified | 1532 |
| 363 | Ga0265332_10058893 | 3300031238 | Bacteria | 1644 |
| 364 | Ga0265328_10040050 | 3300031239 | Bacteria | 1728 |
| 365 | Ga0265331_10103158 | 3300031250 | Bacteria | 1311 |
| 366 | Ga0307408_101111270 | 3300031548 | Bacteria | 734 |
| 367 | Ga0307408_101567194 | 3300031548 | Unclassified | 625 |
| 368 | Ga0265314_10032861 | 3300031711 | Bacteria | 3812 |
| 369 | Ga0265314_10068592 | 3300031711 | Bacteria | 2383 |
| 370 | Ga0307410_10849581 | 3300031852 | Bacteria | 779 |
| 371 | Ga0307416_100871527 | 3300032002 | Bacteria | 999 |
| 372 | Ga0373926_0319512 | 3300035083 | Unclassified | 607 |
| 373 | Ga0373926_0434521 | 3300035083 | Bacteria | 520 |
| 374 | Ga0373934_0104806 | 3300035086 | Bacteria | 1144 |
| 375 | Ga0373944_0075842 | 3300035089 | Bacteria | 1103 |
| 376 | Ga0373949_0123742 | 3300035090 | Unclassified | 728 |
| 377 | Ga0373923_0049670 | 3300035111 | Bacteria | 1755 |
| 378 | Ga0373923_0585372 | 3300035111 | Bacteria | 549 |
| 379 | Ga0373936_0024719 | 3300035113 | Bacteria | 2347 |
| 380 | Ga0373936_0290056 | 3300035113 | Bacteria | 737 |
| 381 | Ga0373939_0358109 | 3300035114 | Unclassified | 595 |
| 382 | Ga0373941_0010605 | 3300035115 | Bacteria | 2359 |
| 383 | Ga0373953_0338135 | 3300035117 | Bacteria | 659 |
| 384 | Ga0373954_0196748 | 3300035118 | Unclassified | 990 |
| 385 | Ga0373956_0037425 | 3300035119 | Bacteria | 2145 |
| 386 | Ga0373956_0080661 | 3300035119 | Bacteria | 1493 |
| 387 | Ga0373956_0193749 | 3300035119 | Bacteria | 963 |
| 388 | Ga0373957_0188163 | 3300035120 | Unclassified | 857 |
| 389 | Ga0373957_0362922 | 3300035120 | Bacteria | 620 |
| 390 | Ga0373957_0524369 | 3300035120 | Unclassified | 517 |
| 391 | Ga0373943_0045468 | 3300035170 | Bacteria | 2140 |
| 392 | Ga0373943_0145689 | 3300035170 | Bacteria | 1279 |
| 393 | Ga0373943_0278047 | 3300035170 | Bacteria | 946 |
| 394 | Ga0373946_0290311 | 3300035171 | Unclassified | 806 |
| 395 | Ga0373946_0331851 | 3300035171 | Bacteria | 757 |
| 396 | Ga0373955_0120510 | 3300035172 | Bacteria | 1525 |
| 397 | Ga0373955_0198675 | 3300035172 | Bacteria | 1193 |
| 398 | Ga0373955_1046582 | 3300035172 | Unclassified | 503 |
| 399 | Ga0373962_0204772 | 3300035242 | Unclassified | 669 |
| 400 | Ga0373924_0018573 | 3300035410 | Bacteria | 2681 |
| 401 | Ga0373924_0425610 | 3300035410 | Bacteria | 594 |
| 402 | Ga0373931_0532974 | 3300035691 | Bacteria | 761 |
| 403 | Ga0373931_1167015 | 3300035691 | Unclassified | 526 |
| 404 | Ga0373935_0002120 | 3300035692 | Bacteria | 11251 |
| 405 | Ga0373935_0599482 | 3300035692 | Unclassified | 805 |
| 406 | Ga0373935_0979983 | 3300035692 | Bacteria | 628 |
| 407 | Ga0373927_0137642 | 3300035695 | Bacteria | 1596 |
| 408 | Ga0373927_0223478 | 3300035695 | Bacteria | 1237 |
| 409 | Ga0373927_0383435 | 3300035695 | Bacteria | 927 |
| 410 | Ga0373933_0158599 | 3300035724 | Bacteria | 1436 |
| 411 | Ga0373933_0253833 | 3300035724 | Bacteria | 1133 |
| 412 | Ga0373933_0659114 | 3300035724 | Bacteria | 688 |
| 413 | Ga0373947_0010402 | 3300035725 | Bacteria | 5338 |
| 414 | Ga0373947_0100540 | 3300035725 | Bacteria | 1817 |
| 415 | Ga0373947_0174108 | 3300035725 | Bacteria | 1398 |
| 416 | Ga0373937_0118403 | 3300036401 | Bacteria | 2467 |
| 417 | Ga0373937_0289541 | 3300036401 | Bacteria | 1547 |
| 418 | Ga0373937_0361132 | 3300036401 | Bacteria | 1376 |
| 419 | Ga0373925_0000666 | 3300037068 | Bacteria | 32236 |
| 420 | Ga0373925_0044704 | 3300037068 | Bacteria | 3289 |
| 421 | Ga0373925_0178785 | 3300037068 | Bacteria | 1678 |
| 422 | Ga0373925_0387939 | 3300037068 | Bacteria | 1138 |
| 423 | Ga0373925_0409993 | 3300037068 | Bacteria | 1106 |
| 424 | Ga0373925_0826990 | 3300037068 | Bacteria | 763 |
| 425 | Ga0373925_1049565 | 3300037068 | Bacteria | 671 |
| 426 | Ga0395905_1390457 | 3300037471 | Bacteria | 606 |
| 427 | Ga0436365_0339417 | 3300039437 | Unclassified | 1660 |
| 428 | Ga0436365_1264879 | 3300039437 | Unclassified | 560 |
| 429 | Ga0436363_0101575 | 3300039450 | Bacteria | 765 |
| 430 | Ga0436363_1065876 | 3300039450 | Bacteria | 827 |
| 431 | Ga0450914_001439 | 3300042118 | Bacteria | 1494 |
| 432 | Ga0439434_0075346 | 3300042435 | Bacteria | 1066 |
| 433 | Ga0439434_0368879 | 3300042435 | Unclassified | 503 |
| 434 | Ga0439435_0117461 | 3300042436 | Bacteria | 830 |
| 435 | Ga0439444_0052281 | 3300042437 | Bacteria | 833 |
| 436 | Ga0451577_1128659 | 3300042876 | Bacteria | 701 |
| 437 | Ga0439440_0110606 | 3300042993 | Bacteria | 756 |
| 438 | Ga0466963_0005646 | 3300044694 | Bacteria | 7346 |
| 439 | Ga0466963_0193269 | 3300044694 | Bacteria | 1422 |
| 440 | Ga0451576_0259704 | 3300045051 | Bacteria | 1815 |
| 441 | Ga0451576_1530717 | 3300045051 | Bacteria | 693 |
| 442 | Ga0466958_0405566 | 3300045836 | Bacteria | 880 |
| 443 | Ga0466967_1853515 | 3300045976 | Bacteria | 600 |
| 444 | Ga0495592_0491643 | 3300046454 | Bacteria | 763 |
| 445 | Ga0495592_0730086 | 3300046454 | Bacteria | 594 |
| 446 | Ga0495590_0218433 | 3300046457 | Bacteria | 704 |
| 447 | Ga0495629_0151595 | 3300046459 | Bacteria | 1611 |
| 448 | Ga0495629_0911994 | 3300046459 | Unclassified | 575 |
| 449 | Ga0495651_0246386 | 3300046462 | Bacteria | 1223 |
| 450 | Ga0495653_0187500 | 3300046463 | Unclassified | 1414 |
| 451 | Ga0495653_0305177 | 3300046463 | Bacteria | 1037 |
| 452 | Ga0495580_0453694 | 3300046472 | Bacteria | 860 |
| 453 | Ga0495580_0521995 | 3300046472 | Unclassified | 791 |
| 454 | Ga0495582_0027014 | 3300046473 | Bacteria | 3146 |
| 455 | Ga0495582_0279381 | 3300046473 | Bacteria | 959 |
| 456 | Ga0495582_0300638 | 3300046473 | Bacteria | 922 |
| 457 | Ga0495639_0233651 | 3300046475 | Bacteria | 906 |
| 458 | Ga0495662_0129442 | 3300046476 | Bacteria | 1241 |
| 459 | Ga0495662_0195613 | 3300046476 | Bacteria | 997 |
| 460 | Ga0495662_0288200 | 3300046476 | Bacteria | 808 |
| 461 | Ga0495584_0378858 | 3300046491 | Bacteria | 719 |
| 462 | Ga0495618_0200308 | 3300046514 | Bacteria | 1264 |
| 463 | Ga0495628_0023497 | 3300046516 | Bacteria | 5059 |
| 464 | Ga0495628_0609843 | 3300046516 | Bacteria | 779 |
| 465 | Ga0495630_0037113 | 3300046517 | Bacteria | 3643 |
| 466 | Ga0495630_0038450 | 3300046517 | Unclassified | 3579 |
| 467 | Ga0495630_0474884 | 3300046517 | Bacteria | 959 |
| 468 | Ga0495630_1013747 | 3300046517 | Bacteria | 631 |
| 469 | Ga0495666_0463440 | 3300046526 | Bacteria | 567 |
| 470 | Ga0495652_0168834 | 3300046529 | Bacteria | 1691 |
| 471 | Ga0495665_0233554 | 3300046531 | Bacteria | 949 |
| 472 | Ga0495665_0637733 | 3300046531 | Unclassified | 531 |
| 473 | Ga0495640_0175705 | 3300046533 | Bacteria | 1367 |
| 474 | Ga0495640_0248295 | 3300046533 | Bacteria | 1115 |
| 475 | Ga0495640_0929975 | 3300046533 | Unclassified | 514 |
| 476 | Ga0495586_0050044 | 3300046535 | Bacteria | 2260 |
| 477 | Ga0495586_0154001 | 3300046535 | Bacteria | 1294 |
| 478 | Ga0495586_0319195 | 3300046535 | Bacteria | 891 |
| 479 | Ga0495587_0064036 | 3300046536 | Bacteria | 2149 |
| 480 | Ga0495587_0138998 | 3300046536 | Bacteria | 1387 |
| 481 | Ga0495621_0249567 | 3300046539 | Bacteria | 725 |
| 482 | Ga0495645_0000493 | 3300046543 | Bacteria | 27347 |
| 483 | Ga0495645_0063124 | 3300046543 | Bacteria | 2682 |
| 484 | Ga0495645_0933066 | 3300046543 | Unclassified | 514 |
| 485 | Ga0495633_0160913 | 3300046558 | Bacteria | 1036 |
| 486 | Ga0495633_0194498 | 3300046558 | Bacteria | 932 |
| 487 | Ga0495633_0589421 | 3300046558 | Bacteria | 500 |
| 488 | Ga0495667_0190383 | 3300046559 | Bacteria | 1315 |
| 489 | Ga0495667_0367011 | 3300046559 | Bacteria | 909 |
| 490 | Ga0495634_0113784 | 3300046642 | Bacteria | 1738 |
| 491 | Ga0495634_0167559 | 3300046642 | Bacteria | 1382 |
| 492 | Ga0495634_0237252 | 3300046642 | Bacteria | 1120 |
| 493 | Ga0495634_0371073 | 3300046642 | Bacteria | 854 |
| 494 | Ga0495635_0953257 | 3300046663 | Bacteria | 548 |
| 495 | Ga0495659_0081917 | 3300046664 | Unclassified | 1226 |
| 496 | Ga0495659_0239510 | 3300046664 | Bacteria | 754 |
| 497 | Ga0495659_0440473 | 3300046664 | Unclassified | 566 |
| 498 | Ga0495657_0560655 | 3300046675 | Bacteria | 663 |
| 499 | Ga0495599_0028045 | 3300046678 | Bacteria | 3528 |
| 500 | Ga0495623_0091596 | 3300046679 | Bacteria | 1865 |
| 501 | Ga0495646_0536960 | 3300046680 | Unclassified | 598 |
| 502 | Ga0495647_0081654 | 3300046681 | Bacteria | 1312 |
| 503 | Ga0495647_0127702 | 3300046681 | Bacteria | 1075 |
| 504 | Ga0495647_0303317 | 3300046681 | Bacteria | 720 |
| 505 | Ga0495658_0033050 | 3300046683 | Bacteria | 2830 |
| 506 | Ga0495658_0161678 | 3300046683 | Bacteria | 1381 |
| 507 | Ga0495658_0174394 | 3300046683 | Bacteria | 1332 |
| 508 | Ga0495658_0340359 | 3300046683 | Unclassified | 953 |
| 509 | Ga0495658_0377457 | 3300046683 | Bacteria | 902 |
| 510 | Ga0495669_0004735 | 3300046684 | Bacteria | 5645 |
| 511 | Ga0495669_0016913 | 3300046684 | Bacteria | 3128 |
| 512 | Ga0495613_0001719 | 3300046689 | Bacteria | 16660 |
| 513 | Ga0495613_0388712 | 3300046689 | Bacteria | 953 |
| 514 | Ga0495613_0457580 | 3300046689 | Bacteria | 864 |
| 515 | Ga0495613_0624141 | 3300046689 | Bacteria | 715 |
| 516 | Ga0495624_0666624 | 3300046690 | Bacteria | 618 |
| 517 | Ga0495670_0216473 | 3300046691 | Unclassified | 1017 |
| 518 | Ga0495600_0021713 | 3300046809 | Bacteria | 4116 |
| 519 | Ga0495600_0100542 | 3300046809 | Bacteria | 1885 |
| 520 | Ga0495604_0037955 | 3300047317 | Bacteria | 3791 |
| 521 | Ga0495604_0305644 | 3300047317 | Bacteria | 1067 |
| 522 | Ga0495604_0982907 | 3300047317 | Bacteria | 523 |
| 523 | Ga0495674_0268586 | 3300047319 | Bacteria | 1400 |
| 524 | Ga0495674_0902644 | 3300047319 | Unclassified | 682 |
| 525 | Ga0495674_0937798 | 3300047319 | Unclassified | 666 |
| 526 | Ga0495676_0168169 | 3300047321 | Bacteria | 1545 |
| 527 | Ga0495676_0599018 | 3300047321 | Unclassified | 718 |
| 528 | Ga0495680_0166691 | 3300047322 | Bacteria | 1597 |
| 529 | Ga0495680_0628749 | 3300047322 | Bacteria | 716 |
| 530 | Ga0495675_0715304 | 3300047444 | Bacteria | 560 |
| 531 | Ga0495684_0002104 | 3300047471 | Bacteria | 15970 |
| 532 | Ga0496100_0002378 | 3300048903 | Bacteria | 9518 |
| 533 | Ga0496100_1342712 | 3300048903 | Unclassified | 564 |
| 534 | Ga0496101_0002831 | 3300048904 | Bacteria | 10657 |
| 535 | Ga0496102_0027881 | 3300048905 | Bacteria | 5045 |
| 536 | Ga0496102_0105822 | 3300048905 | Bacteria | 2617 |
| 537 | Ga0496103_0832047 | 3300048906 | Bacteria | 581 |
| 538 | Ga0496103_0965930 | 3300048906 | Unclassified | 532 |
| 539 | Ga0496103_0983213 | 3300048906 | Unclassified | 526 |
| 540 | Ga0496104_0001613 | 3300048907 | Bacteria | 19451 |
| 541 | Ga0496104_0062944 | 3300048907 | Bacteria | 3518 |
| 542 | Ga0496104_0905168 | 3300048907 | Unclassified | 787 |
| 543 | Ga0496104_1134616 | 3300048907 | Bacteria | 685 |
| 544 | Ga0496104_1796485 | 3300048907 | Unclassified | 515 |
| 545 | Ga0496105_0035337 | 3300048908 | Bacteria | 4113 |
| 546 | Ga0496105_0322977 | 3300048908 | Bacteria | 1237 |
| 547 | Ga0496106_0070873 | 3300048909 | Bacteria | 2663 |
| 548 | Ga0496106_0083036 | 3300048909 | Unclassified | 2464 |
| 549 | Ga0496106_0193359 | 3300048909 | Bacteria | 1618 |
| 550 | Ga0496106_1579622 | 3300048909 | Unclassified | 503 |
| 551 | Ga0496108_0012522 | 3300048911 | Bacteria | 6907 |
| 552 | Ga0496109_0170381 | 3300048912 | Bacteria | 2042 |
| 553 | Ga0496109_0221537 | 3300048912 | Bacteria | 1779 |
| 554 | Ga0496111_0079422 | 3300048914 | Bacteria | 2393 |
| 555 | Ga0496112_0091866 | 3300048915 | Bacteria | 3004 |
| 556 | Ga0496112_0156768 | 3300048915 | Bacteria | 2244 |
| 557 | Ga0496112_0713764 | 3300048915 | Bacteria | 930 |
| 558 | Ga0496112_1002025 | 3300048915 | Bacteria | 755 |
| 559 | Ga0496112_1847479 | 3300048915 | Unclassified | 516 |
| 560 | Ga0496114_0002181 | 3300048917 | Bacteria | 14900 |
| 561 | Ga0496114_0097030 | 3300048917 | Bacteria | 2510 |
| 562 | Ga0496114_0110368 | 3300048917 | Bacteria | 2356 |
| 563 | Ga0496114_0366796 | 3300048917 | Bacteria | 1274 |
| 564 | Ga0496114_0385263 | 3300048917 | Bacteria | 1241 |
| 565 | Ga0496114_0417936 | 3300048917 | Bacteria | 1188 |
| 566 | Ga0496114_0773843 | 3300048917 | Unclassified | 838 |
| 567 | Ga0496114_0919991 | 3300048917 | Unclassified | 756 |
| 568 | Ga0496114_1778988 | 3300048917 | Bacteria | 504 |
| 569 | Ga0501075_0225635 | 3300049591 | Bacteria | 1429 |
| 570 | Ga0501076_0154693 | 3300049592 | Bacteria | 1866 |
| 571 | Ga0501076_0383983 | 3300049592 | Bacteria | 1154 |
| 572 | Ga0501045_0118396 | 3300049824 | Bacteria | 1966 |
| 573 | nmdc:mga0k408_77305_c1 | 3300050493 | Bacteria | 1946 |
| 574 | nmdc:mga05p37_194416_c1 | 3300050507 | Bacteria | 2461 |
| 575 | nmdc:mga05p37_233602_c1 | 3300050507 | Bacteria | 2214 |
| 576 | nmdc:mga05p37_36152_c1 | 3300050507 | Bacteria | 6060 |
| 577 | nmdc:mga05p37_394321_c1 | 3300050507 | Bacteria | 1618 |
| 578 | nmdc:mga05p37_6700_c1 | 3300050507 | Bacteria | 13572 |
| 579 | nmdc:mga05p37_736914_c1 | 3300050507 | Bacteria | 1089 |
| 580 | nmdc:mga09592_289520_c1 | 3300050508 | Unclassified | 1420 |
| 581 | nmdc:mga09592_84843_c1 | 3300050508 | Bacteria | 2701 |
| 582 | nmdc:mga0qj67_1422857_c1 | 3300050509 | Bacteria | 535 |
| 583 | nmdc:mga06r32_1140530_c1 | 3300050510 | Unclassified | 727 |
| 584 | nmdc:mga08y16_52740_c1 | 3300050511 | Bacteria | 4255 |
| 585 | nmdc:mga0n895_16356_c1 | 3300050512 | Bacteria | 6803 |
| 586 | nmdc:mga0n895_380594_c1 | 3300050512 | Bacteria | 1428 |
| 587 | nmdc:mga0n895_4910_c1 | 3300050512 | Bacteria | 11084 |
| 588 | nmdc:mga0n895_613748_c1 | 3300050512 | Bacteria | 1089 |
| 589 | nmdc:mga0n895_844_c1 | 3300050512 | Bacteria | 21996 |
| 590 | nmdc:mga0n895_967538_c1 | 3300050512 | Bacteria | 834 |
| 591 | nmdc:mga0rr50_1058059_c1 | 3300050513 | Bacteria | 691 |
| 592 | nmdc:mga0rr50_156161_c1 | 3300050513 | Bacteria | 1848 |
| 593 | nmdc:mga0rr50_23_c1 | 3300050513 | Bacteria | 116800 |
| 594 | nmdc:mga0rr50_521877_c1 | 3300050513 | Bacteria | 1011 |
| 595 | nmdc:mga0rr50_5303_c1 | 3300050513 | Bacteria | 7669 |
| 596 | nmdc:mga0rr50_711351_c1 | 3300050513 | Bacteria | 857 |
| 597 | nmdc:mga0rr50_994191_c1 | 3300050513 | Unclassified | 715 |
| 598 | nmdc:mga08x19_11103_c1 | 3300050514 | Bacteria | 5422 |
| 599 | nmdc:mga08x19_165_c1 | 3300050514 | Bacteria | 54991 |
| 600 | nmdc:mga08x19_433968_c1 | 3300050514 | Bacteria | 923 |
| 601 | nmdc:mga08x19_58847_c1 | 3300050514 | Bacteria | 2487 |
| 602 | nmdc:mga08x19_646_c1 | 3300050514 | Bacteria | 22496 |
| 603 | nmdc:mga0a205_100953_c1 | 3300050515 | Unclassified | 2784 |
| 604 | nmdc:mga0a205_1041612_c1 | 3300050515 | Unclassified | 665 |
| 605 | nmdc:mga0a205_1320360_c1 | 3300050515 | Unclassified | 569 |
| 606 | nmdc:mga0a205_32836_c1 | 3300050515 | Bacteria | 4976 |
| 607 | nmdc:mga0a205_33620_c1 | 3300050515 | Bacteria | 4916 |
| 608 | nmdc:mga0a205_790721_c1 | 3300050515 | Bacteria | 797 |
| 609 | nmdc:mga0a205_85338_c1 | 3300050515 | Bacteria | 3049 |
| 610 | Ga0495601_0035194 | 3300053077 | Bacteria | 3125 |
| 611 | Ga0495601_0163809 | 3300053077 | Bacteria | 1453 |
| 612 | Ga0495601_0627515 | 3300053077 | Bacteria | 688 |
| 613 | Ga0495595_0030566 | 3300053084 | Bacteria | 2417 |
| 614 | Ga0495595_0180905 | 3300053084 | Bacteria | 1045 |
| 615 | Ga0495595_0643268 | 3300053084 | Unclassified | 543 |
| 616 | Ga0495619_0014250 | 3300053085 | Bacteria | 5022 |
| 617 | Ga0495619_0038106 | 3300053085 | Bacteria | 3134 |
| 618 | Ga0495619_0062093 | 3300053085 | Bacteria | 2487 |
| 619 | Ga0495619_0095003 | 3300053085 | Bacteria | 2023 |
| 620 | Ga0495619_0108509 | 3300053085 | Bacteria | 1895 |
| 621 | Ga0495619_0886140 | 3300053085 | Unclassified | 601 |
| 622 | Ga0500611_108964 | 3300053727 | Bacteria | 726 |
| 623 | Ga0501084_1515995 | 3300054114 | Bacteria | 561 |
| 624 | Ga0590071_003058 | 3300059421 | Bacteria | 4147 |
| 625 | Ga0590074_001767 | 3300059423 | Bacteria | 3529 |
| 626 | Ga0590075_000705 | 3300059424 | Bacteria | 8857 |
| 627 | Ga0590077_000272 | 3300059426 | Bacteria | 14641 |
| 628 | Ga0530510_0009173 | 3300061734 | Bacteria | 6931 |
| 629 | Ga0530510_1259188 | 3300061734 | Bacteria | 567 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005356 | Ga0070674_100938395 | Ga0070674_1009383951 | 114 |
| 2 | 3300005840 | Ga0068870_10994360 | Ga0068870_109943601 | 114 |
| 3 | 3300042435 | Ga0439434_0368879 | Ga0439434_0368879_40_393 | 114 |
| 4 | 3300005295 | Ga0065707_10229407 | Ga0065707_102294071 | 115 |
| 5 | 3300005354 | Ga0070675_100250238 | Ga0070675_1002502382 | 115 |
| 6 | 3300005617 | Ga0068859_100094330 | Ga0068859_1000943305 | 115 |
| 7 | 3300005618 | Ga0068864_100171947 | Ga0068864_1001719472 | 115 |
| 8 | 3300005841 | Ga0068863_100471890 | Ga0068863_1004718902 | 115 |
| 9 | 3300005843 | Ga0068860_100254505 | Ga0068860_1002545053 | 115 |
| 10 | 3300006844 | Ga0075428_100155906 | Ga0075428_1001559063 | 115 |
| 11 | 3300006852 | Ga0075433_10295778 | Ga0075433_102957782 | 115 |
| 12 | 3300006871 | Ga0075434_100543261 | Ga0075434_1005432612 | 115 |
| 13 | 3300006880 | Ga0075429_100206107 | Ga0075429_1002061073 | 115 |
| 14 | 3300006931 | Ga0097620_100094330 | Ga0097620_1000943305 | 115 |
| 15 | 3300009148 | Ga0105243_12391753 | Ga0105243_123917531 | 115 |
| 16 | 3300009551 | Ga0105238_12204173 | Ga0105238_122041732 | 115 |
| 17 | 3300025926 | Ga0207659_10036702 | Ga0207659_100367024 | 115 |
| 18 | 3300025926 | Ga0207659_11257471 | Ga0207659_112574712 | 115 |
| 19 | 3300025942 | Ga0207689_11060734 | Ga0207689_110607342 | 115 |
| 20 | 3300026088 | Ga0207641_10707790 | Ga0207641_107077902 | 115 |
| 21 | 3300026095 | Ga0207676_10054987 | Ga0207676_100549872 | 115 |
| 22 | 3300026118 | Ga0207675_100346781 | Ga0207675_1003467812 | 115 |
| 23 | 3300027907 | Ga0207428_10187496 | Ga0207428_101874962 | 115 |
| 24 | 3300028381 | Ga0268264_10279296 | Ga0268264_102792963 | 115 |
| 25 | 3300031548 | Ga0307408_101567194 | Ga0307408_1015671941 | 115 |
| 26 | 3300005843 | Ga0068860_100086969 | Ga0068860_1000869692 | 116 |
| 27 | 3300006871 | Ga0075434_100918225 | Ga0075434_1009182252 | 116 |
| 28 | 3300009101 | Ga0105247_10012110 | Ga0105247_100121105 | 116 |
| 29 | 3300014968 | Ga0157379_10076657 | Ga0157379_100766572 | 116 |
| 30 | 3300025900 | Ga0207710_10057099 | Ga0207710_100570992 | 116 |
| 31 | 3300026035 | Ga0207703_10004285 | Ga0207703_100042855 | 116 |
| 32 | 3300028381 | Ga0268264_10018278 | Ga0268264_100182784 | 116 |
| 33 | 3300050512 | nmdc:mga0n895_967538_c1 | nmdc:mga0n895_967538_c1_171_530 | 116 |
| 34 | 3300011119 | Ga0105246_10740957 | Ga0105246_107409572 | 117 |
| 35 | 3300013308 | Ga0157375_10481794 | Ga0157375_104817942 | 117 |
| 36 | 3300014969 | Ga0157376_10466157 | Ga0157376_104661572 | 117 |
| 37 | 3300025940 | Ga0207691_11671270 | Ga0207691_116712701 | 117 |
| 38 | 3300042436 | Ga0439435_0117461 | Ga0439435_0117461_295_648 | 117 |
| 39 | 3300042437 | Ga0439444_0052281 | Ga0439444_0052281_329_682 | 117 |
| 40 | 3300042993 | Ga0439440_0110606 | Ga0439440_0110606_232_585 | 117 |
| 41 | 3300048917 | Ga0496114_1778988 | Ga0496114_1778988_32_388 | 117 |
| 42 | 3300050513 | nmdc:mga0rr50_711351_c1 | nmdc:mga0rr50_711351_c1_478_837 | 117 |
| 43 | 3300005295 | Ga0065707_10841531 | Ga0065707_108415311 | 118 |
| 44 | 3300005844 | Ga0068862_100932834 | Ga0068862_1009328342 | 118 |
| 45 | 3300005937 | Ga0081455_10027171 | Ga0081455_100271716 | 118 |
| 46 | 3300025917 | Ga0207660_11557915 | Ga0207660_115579151 | 118 |
| 47 | 3300026121 | Ga0207683_10154586 | Ga0207683_101545862 | 118 |
| 48 | 3300050510 | nmdc:mga06r32_1140530_c1 | nmdc:mga06r32_1140530_c1_230_586 | 118 |
| 49 | 3300050515 | nmdc:mga0a205_1320360_c1 | nmdc:mga0a205_1320360_c1_29_385 | 118 |
| 50 | 3300059421 | Ga0590071_003058 | Ga0590071_003058_2344_2712 | 118 |
| 51 | 3300059423 | Ga0590074_001767 | Ga0590074_001767_1853_2221 | 118 |
| 52 | 3300059424 | Ga0590075_000705 | Ga0590075_000705_1724_2092 | 118 |
| 53 | 3300059426 | Ga0590077_000272 | Ga0590077_000272_12344_12712 | 118 |
| 54 | 3300009093 | Ga0105240_12205863 | Ga0105240_122058631 | 119 |
| 55 | 3300009147 | Ga0114129_10288190 | Ga0114129_102881903 | 119 |
| 56 | 3300025898 | Ga0207692_10218378 | Ga0207692_102183782 | 119 |
| 57 | 3300025901 | Ga0207688_10394127 | Ga0207688_103941272 | 119 |
| 58 | 3300025944 | Ga0207661_10089205 | Ga0207661_100892053 | 119 |
| 59 | 3300031852 | Ga0307410_10849581 | Ga0307410_108495812 | 119 |
| 60 | 3300032002 | Ga0307416_100871527 | Ga0307416_1008715272 | 119 |
| 61 | 3300035111 | Ga0373923_0585372 | Ga0373923_0585372_12_371 | 119 |
| 62 | 3300035170 | Ga0373943_0045468 | Ga0373943_0045468_399_758 | 119 |
| 63 | 3300035171 | Ga0373946_0290311 | Ga0373946_0290311_99_458 | 119 |
| 64 | 3300035724 | Ga0373933_0659114 | Ga0373933_0659114_310_669 | 119 |
| 65 | 3300037068 | Ga0373925_0044704 | Ga0373925_0044704_1635_1994 | 119 |
| 66 | 3300046454 | Ga0495592_0730086 | Ga0495592_0730086_146_526 | 119 |
| 67 | 3300046533 | Ga0495640_0929975 | Ga0495640_0929975_107_466 | 119 |
| 68 | 3300046536 | Ga0495587_0064036 | Ga0495587_0064036_627_1007 | 119 |
| 69 | 3300046543 | Ga0495645_0933066 | Ga0495645_0933066_25_384 | 119 |
| 70 | 3300046663 | Ga0495635_0953257 | Ga0495635_0953257_146_505 | 119 |
| 71 | 3300047319 | Ga0495674_0937798 | Ga0495674_0937798_23_382 | 119 |
| 72 | 3300047321 | Ga0495676_0599018 | Ga0495676_0599018_324_683 | 119 |
| 73 | 3300047322 | Ga0495680_0628749 | Ga0495680_0628749_241_621 | 119 |
| 74 | 3300050507 | nmdc:mga05p37_394321_c1 | nmdc:mga05p37_394321_c1_1235_1594 | 119 |
| 75 | 3300050514 | nmdc:mga08x19_433968_c1 | nmdc:mga08x19_433968_c1_110_469 | 119 |
| 76 | 3300053077 | Ga0495601_0163809 | Ga0495601_0163809_167_526 | 119 |
| 77 | 3300053085 | Ga0495619_0038106 | Ga0495619_0038106_1302_1682 | 119 |
| 78 | 3300004800 | Ga0058861_11649032 | Ga0058861_116490321 | 120 |
| 79 | 3300005289 | Ga0065704_10328300 | Ga0065704_103283002 | 120 |
| 80 | 3300005289 | Ga0065704_10395349 | Ga0065704_103953492 | 120 |
| 81 | 3300005290 | Ga0065712_10658778 | Ga0065712_106587782 | 120 |
| 82 | 3300005290 | Ga0065712_10695200 | Ga0065712_106952001 | 120 |
| 83 | 3300005293 | Ga0065715_10235948 | Ga0065715_102359482 | 120 |
| 84 | 3300005295 | Ga0065707_10466030 | Ga0065707_104660302 | 120 |
| 85 | 3300005295 | Ga0065707_10494391 | Ga0065707_104943911 | 120 |
| 86 | 3300005329 | Ga0070683_100307220 | Ga0070683_1003072202 | 120 |
| 87 | 3300005330 | Ga0070690_100004756 | Ga0070690_1000047563 | 120 |
| 88 | 3300005334 | Ga0068869_100110925 | Ga0068869_1001109252 | 120 |
| 89 | 3300005334 | Ga0068869_100683740 | Ga0068869_1006837402 | 120 |
| 90 | 3300005335 | Ga0070666_10004274 | Ga0070666_100042745 | 120 |
| 91 | 3300005335 | Ga0070666_10048991 | Ga0070666_100489912 | 120 |
| 92 | 3300005335 | Ga0070666_10105043 | Ga0070666_101050432 | 120 |
| 93 | 3300005335 | Ga0070666_10991708 | Ga0070666_109917081 | 120 |
| 94 | 3300005336 | Ga0070680_100118471 | Ga0070680_1001184712 | 120 |
| 95 | 3300005337 | Ga0070682_101117536 | Ga0070682_1011175362 | 120 |
| 96 | 3300005337 | Ga0070682_102014643 | Ga0070682_1020146431 | 120 |
| 97 | 3300005338 | Ga0068868_100094450 | Ga0068868_1000944502 | 120 |
| 98 | 3300005338 | Ga0068868_100183193 | Ga0068868_1001831933 | 120 |
| 99 | 3300005338 | Ga0068868_100495622 | Ga0068868_1004956221 | 120 |
| 100 | 3300005338 | Ga0068868_100738452 | Ga0068868_1007384522 | 120 |
| 101 | 3300005339 | Ga0070660_100001966 | Ga0070660_10000196610 | 120 |
| 102 | 3300005343 | Ga0070687_100060442 | Ga0070687_1000604422 | 120 |
| 103 | 3300005344 | Ga0070661_100481554 | Ga0070661_1004815542 | 120 |
| 104 | 3300005345 | Ga0070692_10681153 | Ga0070692_106811532 | 120 |
| 105 | 3300005347 | Ga0070668_102079994 | Ga0070668_1020799941 | 120 |
| 106 | 3300005353 | Ga0070669_100709900 | Ga0070669_1007099001 | 120 |
| 107 | 3300005354 | Ga0070675_100004466 | Ga0070675_10000446611 | 120 |
| 108 | 3300005354 | Ga0070675_100887743 | Ga0070675_1008877432 | 120 |
| 109 | 3300005354 | Ga0070675_101697430 | Ga0070675_1016974302 | 120 |
| 110 | 3300005355 | Ga0070671_100166308 | Ga0070671_1001663082 | 120 |
| 111 | 3300005356 | Ga0070674_100108602 | Ga0070674_1001086022 | 120 |
| 112 | 3300005356 | Ga0070674_101002357 | Ga0070674_1010023571 | 120 |
| 113 | 3300005365 | Ga0070688_100006201 | Ga0070688_1000062015 | 120 |
| 114 | 3300005366 | Ga0070659_100268227 | Ga0070659_1002682272 | 120 |
| 115 | 3300005366 | Ga0070659_100899169 | Ga0070659_1008991692 | 120 |
| 116 | 3300005434 | Ga0070709_10020183 | Ga0070709_100201832 | 120 |
| 117 | 3300005434 | Ga0070709_10673838 | Ga0070709_106738381 | 120 |
| 118 | 3300005435 | Ga0070714_100019930 | Ga0070714_1000199305 | 120 |
| 119 | 3300005435 | Ga0070714_101783007 | Ga0070714_1017830071 | 120 |
| 120 | 3300005436 | Ga0070713_100033773 | Ga0070713_1000337734 | 120 |
| 121 | 3300005436 | Ga0070713_100343239 | Ga0070713_1003432392 | 120 |
| 122 | 3300005436 | Ga0070713_101089000 | Ga0070713_1010890002 | 120 |
| 123 | 3300005439 | Ga0070711_100044962 | Ga0070711_1000449622 | 120 |
| 124 | 3300005444 | Ga0070694_100049881 | Ga0070694_1000498812 | 120 |
| 125 | 3300005445 | Ga0070708_100026937 | Ga0070708_1000269372 | 120 |
| 126 | 3300005456 | Ga0070678_102081469 | Ga0070678_1020814691 | 120 |
| 127 | 3300005458 | Ga0070681_10144591 | Ga0070681_101445912 | 120 |
| 128 | 3300005458 | Ga0070681_11097231 | Ga0070681_110972312 | 120 |
| 129 | 3300005459 | Ga0068867_100017018 | Ga0068867_1000170186 | 120 |
| 130 | 3300005459 | Ga0068867_100028224 | Ga0068867_1000282242 | 120 |
| 131 | 3300005459 | Ga0068867_100043691 | Ga0068867_1000436913 | 120 |
| 132 | 3300005459 | Ga0068867_101669451 | Ga0068867_1016694511 | 120 |
| 133 | 3300005467 | Ga0070706_101532776 | Ga0070706_1015327761 | 120 |
| 134 | 3300005468 | Ga0070707_100023046 | Ga0070707_1000230464 | 120 |
| 135 | 3300005468 | Ga0070707_100259994 | Ga0070707_1002599942 | 120 |
| 136 | 3300005471 | Ga0070698_100621810 | Ga0070698_1006218102 | 120 |
| 137 | 3300005471 | Ga0070698_100970267 | Ga0070698_1009702671 | 120 |
| 138 | 3300005471 | Ga0070698_101409392 | Ga0070698_1014093922 | 120 |
| 139 | 3300005530 | Ga0070679_100033161 | Ga0070679_1000331617 | 120 |
| 140 | 3300005539 | Ga0068853_100260879 | Ga0068853_1002608792 | 120 |
| 141 | 3300005544 | Ga0070686_100000963 | Ga0070686_1000009639 | 120 |
| 142 | 3300005544 | Ga0070686_100100421 | Ga0070686_1001004212 | 120 |
| 143 | 3300005544 | Ga0070686_101097380 | Ga0070686_1010973802 | 120 |
| 144 | 3300005545 | Ga0070695_100001340 | Ga0070695_10000134011 | 120 |
| 145 | 3300005545 | Ga0070695_100592642 | Ga0070695_1005926422 | 120 |
| 146 | 3300005546 | Ga0070696_101338727 | Ga0070696_1013387271 | 120 |
| 147 | 3300005547 | Ga0070693_100251819 | Ga0070693_1002518192 | 120 |
| 148 | 3300005547 | Ga0070693_100491826 | Ga0070693_1004918262 | 120 |
| 149 | 3300005548 | Ga0070665_100015811 | Ga0070665_1000158113 | 120 |
| 150 | 3300005548 | Ga0070665_100040249 | Ga0070665_1000402492 | 120 |
| 151 | 3300005548 | Ga0070665_101038174 | Ga0070665_1010381742 | 120 |
| 152 | 3300005549 | Ga0070704_100008143 | Ga0070704_1000081436 | 120 |
| 153 | 3300005549 | Ga0070704_101593994 | Ga0070704_1015939941 | 120 |
| 154 | 3300005563 | Ga0068855_100050305 | Ga0068855_1000503054 | 120 |
| 155 | 3300005564 | Ga0070664_100735849 | Ga0070664_1007358491 | 120 |
| 156 | 3300005616 | Ga0068852_100884282 | Ga0068852_1008842822 | 120 |
| 157 | 3300005617 | Ga0068859_100086643 | Ga0068859_1000866433 | 120 |
| 158 | 3300005617 | Ga0068859_100172071 | Ga0068859_1001720712 | 120 |
| 159 | 3300005617 | Ga0068859_100181838 | Ga0068859_1001818382 | 120 |
| 160 | 3300005617 | Ga0068859_101156897 | Ga0068859_1011568972 | 120 |
| 161 | 3300005618 | Ga0068864_100047469 | Ga0068864_1000474693 | 120 |
| 162 | 3300005618 | Ga0068864_100178013 | Ga0068864_1001780131 | 120 |
| 163 | 3300005618 | Ga0068864_100426667 | Ga0068864_1004266671 | 120 |
| 164 | 3300005718 | Ga0068866_10522585 | Ga0068866_105225852 | 120 |
| 165 | 3300005719 | Ga0068861_100674299 | Ga0068861_1006742992 | 120 |
| 166 | 3300005719 | Ga0068861_100888633 | Ga0068861_1008886332 | 120 |
| 167 | 3300005834 | Ga0068851_10918967 | Ga0068851_109189671 | 120 |
| 168 | 3300005840 | Ga0068870_10289554 | Ga0068870_102895542 | 120 |
| 169 | 3300005840 | Ga0068870_10353257 | Ga0068870_103532571 | 120 |
| 170 | 3300005841 | Ga0068863_100196799 | Ga0068863_1001967992 | 120 |
| 171 | 3300005841 | Ga0068863_101710232 | Ga0068863_1017102321 | 120 |
| 172 | 3300005842 | Ga0068858_100074465 | Ga0068858_1000744652 | 120 |
| 173 | 3300005842 | Ga0068858_100239411 | Ga0068858_1002394111 | 120 |
| 174 | 3300005842 | Ga0068858_100301885 | Ga0068858_1003018851 | 120 |
| 175 | 3300005842 | Ga0068858_100564256 | Ga0068858_1005642562 | 120 |
| 176 | 3300005842 | Ga0068858_101275742 | Ga0068858_1012757422 | 120 |
| 177 | 3300005843 | Ga0068860_100070798 | Ga0068860_1000707983 | 120 |
| 178 | 3300005843 | Ga0068860_100083516 | Ga0068860_1000835161 | 120 |
| 179 | 3300005843 | Ga0068860_100432237 | Ga0068860_1004322372 | 120 |
| 180 | 3300005843 | Ga0068860_101142541 | Ga0068860_1011425412 | 120 |
| 181 | 3300005843 | Ga0068860_101539996 | Ga0068860_1015399962 | 120 |
| 182 | 3300005937 | Ga0081455_10050866 | Ga0081455_100508662 | 120 |
| 183 | 3300005985 | Ga0081539_10005884 | Ga0081539_100058846 | 120 |
| 184 | 3300005985 | Ga0081539_10203790 | Ga0081539_102037902 | 120 |
| 185 | 3300005985 | Ga0081539_10255204 | Ga0081539_102552042 | 120 |
| 186 | 3300006028 | Ga0070717_10379540 | Ga0070717_103795402 | 120 |
| 187 | 3300006195 | Ga0075366_10080458 | Ga0075366_100804581 | 120 |
| 188 | 3300006237 | Ga0097621_100024756 | Ga0097621_1000247564 | 120 |
| 189 | 3300006237 | Ga0097621_100029071 | Ga0097621_1000290712 | 120 |
| 190 | 3300006237 | Ga0097621_100037069 | Ga0097621_1000370695 | 120 |
| 191 | 3300006237 | Ga0097621_100065556 | Ga0097621_1000655562 | 120 |
| 192 | 3300006237 | Ga0097621_100288417 | Ga0097621_1002884172 | 120 |
| 193 | 3300006358 | Ga0068871_100005117 | Ga0068871_1000051176 | 120 |
| 194 | 3300006358 | Ga0068871_100016282 | Ga0068871_1000162822 | 120 |
| 195 | 3300006358 | Ga0068871_100020872 | Ga0068871_1000208722 | 120 |
| 196 | 3300006358 | Ga0068871_100023236 | Ga0068871_1000232362 | 120 |
| 197 | 3300006358 | Ga0068871_100489376 | Ga0068871_1004893762 | 120 |
| 198 | 3300006847 | Ga0075431_102072731 | Ga0075431_1020727311 | 120 |
| 199 | 3300006852 | Ga0075433_10016223 | Ga0075433_100162235 | 120 |
| 200 | 3300006852 | Ga0075433_10047304 | Ga0075433_100473041 | 120 |
| 201 | 3300006852 | Ga0075433_10153870 | Ga0075433_101538702 | 120 |
| 202 | 3300006852 | Ga0075433_10691655 | Ga0075433_106916552 | 120 |
| 203 | 3300006852 | Ga0075433_11264287 | Ga0075433_112642871 | 120 |
| 204 | 3300006871 | Ga0075434_100000465 | Ga0075434_10000046521 | 120 |
| 205 | 3300006871 | Ga0075434_100000731 | Ga0075434_10000073122 | 120 |
| 206 | 3300006871 | Ga0075434_100042170 | Ga0075434_1000421702 | 120 |
| 207 | 3300006871 | Ga0075434_100477466 | Ga0075434_1004774662 | 120 |
| 208 | 3300006871 | Ga0075434_101121466 | Ga0075434_1011214662 | 120 |
| 209 | 3300006871 | Ga0075434_101136582 | Ga0075434_1011365822 | 120 |
| 210 | 3300006880 | Ga0075429_100295406 | Ga0075429_1002954062 | 120 |
| 211 | 3300006881 | Ga0068865_100046494 | Ga0068865_1000464943 | 120 |
| 212 | 3300006881 | Ga0068865_100499957 | Ga0068865_1004999572 | 120 |
| 213 | 3300006914 | Ga0075436_100004025 | Ga0075436_1000040254 | 120 |
| 214 | 3300006914 | Ga0075436_100005802 | Ga0075436_1000058024 | 120 |
| 215 | 3300006914 | Ga0075436_100040865 | Ga0075436_1000408652 | 120 |
| 216 | 3300006914 | Ga0075436_100149756 | Ga0075436_1001497562 | 120 |
| 217 | 3300006931 | Ga0097620_100086637 | Ga0097620_1000866373 | 120 |
| 218 | 3300006931 | Ga0097620_100172064 | Ga0097620_1001720643 | 120 |
| 219 | 3300006931 | Ga0097620_100181832 | Ga0097620_1001818323 | 120 |
| 220 | 3300006931 | Ga0097620_101156948 | Ga0097620_1011569482 | 120 |
| 221 | 3300007076 | Ga0075435_100000052 | Ga0075435_10000005240 | 120 |
| 222 | 3300007076 | Ga0075435_100013121 | Ga0075435_1000131212 | 120 |
| 223 | 3300007076 | Ga0075435_100015063 | Ga0075435_1000150632 | 120 |
| 224 | 3300007076 | Ga0075435_100082108 | Ga0075435_1000821085 | 120 |
| 225 | 3300007076 | Ga0075435_100208908 | Ga0075435_1002089082 | 120 |
| 226 | 3300007076 | Ga0075435_100970603 | Ga0075435_1009706032 | 120 |
| 227 | 3300007788 | Ga0099795_10171720 | Ga0099795_101717202 | 120 |
| 228 | 3300009011 | Ga0105251_10146622 | Ga0105251_101466222 | 120 |
| 229 | 3300009093 | Ga0105240_10018398 | Ga0105240_100183983 | 120 |
| 230 | 3300009093 | Ga0105240_10035708 | Ga0105240_100357085 | 120 |
| 231 | 3300009093 | Ga0105240_10171280 | Ga0105240_101712802 | 120 |
| 232 | 3300009093 | Ga0105240_10241064 | Ga0105240_102410642 | 120 |
| 233 | 3300009093 | Ga0105240_10755916 | Ga0105240_107559162 | 120 |
| 234 | 3300009093 | Ga0105240_12201075 | Ga0105240_122010751 | 120 |
| 235 | 3300009094 | Ga0111539_12102096 | Ga0111539_121020962 | 120 |
| 236 | 3300009098 | Ga0105245_10005875 | Ga0105245_100058754 | 120 |
| 237 | 3300009098 | Ga0105245_10187510 | Ga0105245_101875102 | 120 |
| 238 | 3300009098 | Ga0105245_10307596 | Ga0105245_103075962 | 120 |
| 239 | 3300009098 | Ga0105245_10717186 | Ga0105245_107171862 | 120 |
| 240 | 3300009098 | Ga0105245_10726059 | Ga0105245_107260592 | 120 |
| 241 | 3300009101 | Ga0105247_10026511 | Ga0105247_100265114 | 120 |
| 242 | 3300009101 | Ga0105247_10080714 | Ga0105247_100807142 | 120 |
| 243 | 3300009147 | Ga0114129_10000307 | Ga0114129_1000030727 | 120 |
| 244 | 3300009147 | Ga0114129_10017851 | Ga0114129_100178512 | 120 |
| 245 | 3300009147 | Ga0114129_10032741 | Ga0114129_100327413 | 120 |
| 246 | 3300009147 | Ga0114129_10098585 | Ga0114129_100985852 | 120 |
| 247 | 3300009147 | Ga0114129_10195912 | Ga0114129_101959123 | 120 |
| 248 | 3300009147 | Ga0114129_10418381 | Ga0114129_104183812 | 120 |
| 249 | 3300009148 | Ga0105243_11562486 | Ga0105243_115624862 | 120 |
| 250 | 3300009174 | Ga0105241_10146136 | Ga0105241_101461361 | 120 |
| 251 | 3300009174 | Ga0105241_12185013 | Ga0105241_121850131 | 120 |
| 252 | 3300009176 | Ga0105242_10009949 | Ga0105242_100099496 | 120 |
| 253 | 3300009176 | Ga0105242_10056866 | Ga0105242_100568663 | 120 |
| 254 | 3300009177 | Ga0105248_10000664 | Ga0105248_1000066426 | 120 |
| 255 | 3300009177 | Ga0105248_10173442 | Ga0105248_101734422 | 120 |
| 256 | 3300009177 | Ga0105248_10325558 | Ga0105248_103255583 | 120 |
| 257 | 3300009177 | Ga0105248_10846000 | Ga0105248_108460002 | 120 |
| 258 | 3300009177 | Ga0105248_10873281 | Ga0105248_108732812 | 120 |
| 259 | 3300009177 | Ga0105248_10958174 | Ga0105248_109581741 | 120 |
| 260 | 3300009177 | Ga0105248_11272525 | Ga0105248_112725252 | 120 |
| 261 | 3300009177 | Ga0105248_13122015 | Ga0105248_131220151 | 120 |
| 262 | 3300009545 | Ga0105237_10712622 | Ga0105237_107126222 | 120 |
| 263 | 3300009551 | Ga0105238_10213283 | Ga0105238_102132832 | 120 |
| 264 | 3300009551 | Ga0105238_10317501 | Ga0105238_103175011 | 120 |
| 265 | 3300009551 | Ga0105238_10450712 | Ga0105238_104507122 | 120 |
| 266 | 3300009551 | Ga0105238_10906446 | Ga0105238_109064462 | 120 |
| 267 | 3300009551 | Ga0105238_11388531 | Ga0105238_113885311 | 120 |
| 268 | 3300009551 | Ga0105238_11887019 | Ga0105238_118870192 | 120 |
| 269 | 3300009551 | Ga0105238_12150919 | Ga0105238_121509192 | 120 |
| 270 | 3300009553 | Ga0105249_10781604 | Ga0105249_107816041 | 120 |
| 271 | 3300009553 | Ga0105249_12164565 | Ga0105249_121645652 | 120 |
| 272 | 3300010159 | Ga0099796_10477380 | Ga0099796_104773801 | 120 |
| 273 | 3300010375 | Ga0105239_11984086 | Ga0105239_119840862 | 120 |
| 274 | 3300013104 | Ga0157370_10269569 | Ga0157370_102695692 | 120 |
| 275 | 3300013104 | Ga0157370_10865933 | Ga0157370_108659332 | 120 |
| 276 | 3300013105 | Ga0157369_10942880 | Ga0157369_109428802 | 120 |
| 277 | 3300013296 | Ga0157374_10042917 | Ga0157374_100429172 | 120 |
| 278 | 3300013296 | Ga0157374_10349483 | Ga0157374_103494832 | 120 |
| 279 | 3300013296 | Ga0157374_10446677 | Ga0157374_104466772 | 120 |
| 280 | 3300013297 | Ga0157378_10032763 | Ga0157378_100327635 | 120 |
| 281 | 3300013297 | Ga0157378_10711969 | Ga0157378_107119691 | 120 |
| 282 | 3300013297 | Ga0157378_11837605 | Ga0157378_118376052 | 120 |
| 283 | 3300013306 | Ga0163162_12136000 | Ga0163162_121360002 | 120 |
| 284 | 3300013307 | Ga0157372_10444709 | Ga0157372_104447092 | 120 |
| 285 | 3300013308 | Ga0157375_10627147 | Ga0157375_106271472 | 120 |
| 286 | 3300013308 | Ga0157375_10840218 | Ga0157375_108402182 | 120 |
| 287 | 3300013308 | Ga0157375_10920154 | Ga0157375_109201542 | 120 |
| 288 | 3300013308 | Ga0157375_11390617 | Ga0157375_113906171 | 120 |
| 289 | 3300013308 | Ga0157375_12339288 | Ga0157375_123392882 | 120 |
| 290 | 3300013308 | Ga0157375_13291409 | Ga0157375_132914091 | 120 |
| 291 | 3300014325 | Ga0163163_10059736 | Ga0163163_100597362 | 120 |
| 292 | 3300014325 | Ga0163163_10097589 | Ga0163163_100975891 | 120 |
| 293 | 3300014325 | Ga0163163_10177830 | Ga0163163_101778303 | 120 |
| 294 | 3300014325 | Ga0163163_10270754 | Ga0163163_102707542 | 120 |
| 295 | 3300014325 | Ga0163163_11556175 | Ga0163163_115561752 | 120 |
| 296 | 3300014325 | Ga0163163_11959106 | Ga0163163_119591061 | 120 |
| 297 | 3300014326 | Ga0157380_10186270 | Ga0157380_101862702 | 120 |
| 298 | 3300014326 | Ga0157380_11094899 | Ga0157380_110948991 | 120 |
| 299 | 3300014745 | Ga0157377_10027736 | Ga0157377_100277362 | 120 |
| 300 | 3300014745 | Ga0157377_10046866 | Ga0157377_100468663 | 120 |
| 301 | 3300014968 | Ga0157379_10298700 | Ga0157379_102987003 | 120 |
| 302 | 3300014968 | Ga0157379_10585140 | Ga0157379_105851401 | 120 |
| 303 | 3300014968 | Ga0157379_12472712 | Ga0157379_124727122 | 120 |
| 304 | 3300014969 | Ga0157376_10030645 | Ga0157376_100306452 | 120 |
| 305 | 3300014969 | Ga0157376_10102220 | Ga0157376_101022202 | 120 |
| 306 | 3300014969 | Ga0157376_10136327 | Ga0157376_101363272 | 120 |
| 307 | 3300014969 | Ga0157376_10502484 | Ga0157376_105024842 | 120 |
| 308 | 3300017792 | Ga0163161_10678193 | Ga0163161_106781932 | 120 |
| 309 | 3300021384 | Ga0213876_10266514 | Ga0213876_102665142 | 120 |
| 310 | 3300025899 | Ga0207642_10294954 | Ga0207642_102949542 | 120 |
| 311 | 3300025899 | Ga0207642_10486661 | Ga0207642_104866612 | 120 |
| 312 | 3300025900 | Ga0207710_10516206 | Ga0207710_105162061 | 120 |
| 313 | 3300025901 | Ga0207688_10189823 | Ga0207688_101898233 | 120 |
| 314 | 3300025903 | Ga0207680_10005662 | Ga0207680_100056622 | 120 |
| 315 | 3300025903 | Ga0207680_10381011 | Ga0207680_103810112 | 120 |
| 316 | 3300025903 | Ga0207680_10673572 | Ga0207680_106735722 | 120 |
| 317 | 3300025905 | Ga0207685_10492460 | Ga0207685_104924601 | 120 |
| 318 | 3300025906 | Ga0207699_10063158 | Ga0207699_100631582 | 120 |
| 319 | 3300025906 | Ga0207699_10622881 | Ga0207699_106228812 | 120 |
| 320 | 3300025906 | Ga0207699_10647623 | Ga0207699_106476232 | 120 |
| 321 | 3300025908 | Ga0207643_10036108 | Ga0207643_100361083 | 120 |
| 322 | 3300025910 | Ga0207684_11515052 | Ga0207684_115150521 | 120 |
| 323 | 3300025911 | Ga0207654_10843416 | Ga0207654_108434162 | 120 |
| 324 | 3300025913 | Ga0207695_10037979 | Ga0207695_100379792 | 120 |
| 325 | 3300025913 | Ga0207695_10069607 | Ga0207695_100696073 | 120 |
| 326 | 3300025913 | Ga0207695_10386824 | Ga0207695_103868242 | 120 |
| 327 | 3300025913 | Ga0207695_10720729 | Ga0207695_107207292 | 120 |
| 328 | 3300025916 | Ga0207663_10293064 | Ga0207663_102930642 | 120 |
| 329 | 3300025916 | Ga0207663_10593727 | Ga0207663_105937272 | 120 |
| 330 | 3300025917 | Ga0207660_10098191 | Ga0207660_100981912 | 120 |
| 331 | 3300025917 | Ga0207660_10708224 | Ga0207660_107082242 | 120 |
| 332 | 3300025918 | Ga0207662_10029144 | Ga0207662_100291442 | 120 |
| 333 | 3300025919 | Ga0207657_10006060 | Ga0207657_100060605 | 120 |
| 334 | 3300025922 | Ga0207646_10025638 | Ga0207646_100256384 | 120 |
| 335 | 3300025922 | Ga0207646_10036451 | Ga0207646_100364512 | 120 |
| 336 | 3300025923 | Ga0207681_10243895 | Ga0207681_102438952 | 120 |
| 337 | 3300025924 | Ga0207694_10701703 | Ga0207694_107017032 | 120 |
| 338 | 3300025924 | Ga0207694_10947711 | Ga0207694_109477112 | 120 |
| 339 | 3300025925 | Ga0207650_10049437 | Ga0207650_100494374 | 120 |
| 340 | 3300025926 | Ga0207659_10000076 | Ga0207659_1000007647 | 120 |
| 341 | 3300025926 | Ga0207659_10143105 | Ga0207659_101431052 | 120 |
| 342 | 3300025926 | Ga0207659_10670628 | Ga0207659_106706281 | 120 |
| 343 | 3300025927 | Ga0207687_10014551 | Ga0207687_100145514 | 120 |
| 344 | 3300025927 | Ga0207687_10296212 | Ga0207687_102962122 | 120 |
| 345 | 3300025928 | Ga0207700_10365812 | Ga0207700_103658122 | 120 |
| 346 | 3300025928 | Ga0207700_10462617 | Ga0207700_104626172 | 120 |
| 347 | 3300025929 | Ga0207664_10329407 | Ga0207664_103294072 | 120 |
| 348 | 3300025931 | Ga0207644_10250904 | Ga0207644_102509042 | 120 |
| 349 | 3300025934 | Ga0207686_10041427 | Ga0207686_100414272 | 120 |
| 350 | 3300025934 | Ga0207686_11389063 | Ga0207686_113890631 | 120 |
| 351 | 3300025936 | Ga0207670_10143021 | Ga0207670_101430212 | 120 |
| 352 | 3300025937 | Ga0207669_10168297 | Ga0207669_101682972 | 120 |
| 353 | 3300025938 | Ga0207704_10007732 | Ga0207704_100077323 | 120 |
| 354 | 3300025938 | Ga0207704_10081580 | Ga0207704_100815802 | 120 |
| 355 | 3300025938 | Ga0207704_10310713 | Ga0207704_103107132 | 120 |
| 356 | 3300025940 | Ga0207691_10214543 | Ga0207691_102145432 | 120 |
| 357 | 3300025941 | Ga0207711_10040961 | Ga0207711_100409613 | 120 |
| 358 | 3300025941 | Ga0207711_10159348 | Ga0207711_101593482 | 120 |
| 359 | 3300025941 | Ga0207711_10374663 | Ga0207711_103746632 | 120 |
| 360 | 3300025942 | Ga0207689_10098427 | Ga0207689_100984272 | 120 |
| 361 | 3300025945 | Ga0207679_10194034 | Ga0207679_101940342 | 120 |
| 362 | 3300025949 | Ga0207667_10268444 | Ga0207667_102684443 | 120 |
| 363 | 3300025949 | Ga0207667_10885614 | Ga0207667_108856142 | 120 |
| 364 | 3300025961 | Ga0207712_10989956 | Ga0207712_109899562 | 120 |
| 365 | 3300025981 | Ga0207640_10432542 | Ga0207640_104325422 | 120 |
| 366 | 3300025986 | Ga0207658_10064302 | Ga0207658_100643022 | 120 |
| 367 | 3300025986 | Ga0207658_10411429 | Ga0207658_104114292 | 120 |
| 368 | 3300026023 | Ga0207677_10377699 | Ga0207677_103776992 | 120 |
| 369 | 3300026035 | Ga0207703_10122717 | Ga0207703_101227172 | 120 |
| 370 | 3300026035 | Ga0207703_10158273 | Ga0207703_101582732 | 120 |
| 371 | 3300026035 | Ga0207703_10754259 | Ga0207703_107542591 | 120 |
| 372 | 3300026035 | Ga0207703_11866391 | Ga0207703_118663911 | 120 |
| 373 | 3300026041 | Ga0207639_10083971 | Ga0207639_100839713 | 120 |
| 374 | 3300026075 | Ga0207708_11763004 | Ga0207708_117630041 | 120 |
| 375 | 3300026088 | Ga0207641_10380237 | Ga0207641_103802372 | 120 |
| 376 | 3300026089 | Ga0207648_10012695 | Ga0207648_100126956 | 120 |
| 377 | 3300026089 | Ga0207648_10054166 | Ga0207648_100541662 | 120 |
| 378 | 3300026089 | Ga0207648_10065690 | Ga0207648_100656902 | 120 |
| 379 | 3300026095 | Ga0207676_10630959 | Ga0207676_106309592 | 120 |
| 380 | 3300026118 | Ga0207675_102747059 | Ga0207675_1027470591 | 120 |
| 381 | 3300026121 | Ga0207683_10141097 | Ga0207683_101410973 | 120 |
| 382 | 3300026121 | Ga0207683_10337631 | Ga0207683_103376311 | 120 |
| 383 | 3300026121 | Ga0207683_11456658 | Ga0207683_114566581 | 120 |
| 384 | 3300026142 | Ga0207698_10790683 | Ga0207698_107906832 | 120 |
| 385 | 3300027614 | Ga0209970_1024966 | Ga0209970_10249662 | 120 |
| 386 | 3300027907 | Ga0207428_10063031 | Ga0207428_100630313 | 120 |
| 387 | 3300028379 | Ga0268266_10289770 | Ga0268266_102897702 | 120 |
| 388 | 3300028379 | Ga0268266_10363307 | Ga0268266_103633071 | 120 |
| 389 | 3300028380 | Ga0268265_11173954 | Ga0268265_111739542 | 120 |
| 390 | 3300028380 | Ga0268265_11315812 | Ga0268265_113158122 | 120 |
| 391 | 3300028381 | Ga0268264_10043052 | Ga0268264_100430522 | 120 |
| 392 | 3300028381 | Ga0268264_10543639 | Ga0268264_105436392 | 120 |
| 393 | 3300028381 | Ga0268264_10553742 | Ga0268264_105537422 | 120 |
| 394 | 3300028381 | Ga0268264_10830879 | Ga0268264_108308792 | 120 |
| 395 | 3300028577 | Ga0265318_10052387 | Ga0265318_100523872 | 120 |
| 396 | 3300031238 | Ga0265332_10058893 | Ga0265332_100588933 | 120 |
| 397 | 3300031239 | Ga0265328_10040050 | Ga0265328_100400502 | 120 |
| 398 | 3300031250 | Ga0265331_10103158 | Ga0265331_101031582 | 120 |
| 399 | 3300031548 | Ga0307408_101111270 | Ga0307408_1011112701 | 120 |
| 400 | 3300031711 | Ga0265314_10032861 | Ga0265314_100328612 | 120 |
| 401 | 3300031711 | Ga0265314_10068592 | Ga0265314_100685923 | 120 |
| 402 | 3300035083 | Ga0373926_0319512 | Ga0373926_0319512_196_558 | 120 |
| 403 | 3300035083 | Ga0373926_0434521 | Ga0373926_0434521_58_423 | 120 |
| 404 | 3300035086 | Ga0373934_0104806 | Ga0373934_0104806_622_987 | 120 |
| 405 | 3300035089 | Ga0373944_0075842 | Ga0373944_0075842_377_742 | 120 |
| 406 | 3300035090 | Ga0373949_0123742 | Ga0373949_0123742_29_400 | 120 |
| 407 | 3300035111 | Ga0373923_0049670 | Ga0373923_0049670_496_858 | 120 |
| 408 | 3300035113 | Ga0373936_0024719 | Ga0373936_0024719_1036_1398 | 120 |
| 409 | 3300035113 | Ga0373936_0290056 | Ga0373936_0290056_191_553 | 120 |
| 410 | 3300035114 | Ga0373939_0358109 | Ga0373939_0358109_19_381 | 120 |
| 411 | 3300035115 | Ga0373941_0010605 | Ga0373941_0010605_1926_2288 | 120 |
| 412 | 3300035117 | Ga0373953_0338135 | Ga0373953_0338135_10_381 | 120 |
| 413 | 3300035118 | Ga0373954_0196748 | Ga0373954_0196748_97_459 | 120 |
| 414 | 3300035119 | Ga0373956_0037425 | Ga0373956_0037425_1599_1961 | 120 |
| 415 | 3300035119 | Ga0373956_0080661 | Ga0373956_0080661_543_905 | 120 |
| 416 | 3300035119 | Ga0373956_0193749 | Ga0373956_0193749_116_481 | 120 |
| 417 | 3300035120 | Ga0373957_0188163 | Ga0373957_0188163_92_454 | 120 |
| 418 | 3300035120 | Ga0373957_0362922 | Ga0373957_0362922_163_525 | 120 |
| 419 | 3300035120 | Ga0373957_0524369 | Ga0373957_0524369_65_430 | 120 |
| 420 | 3300035170 | Ga0373943_0145689 | Ga0373943_0145689_873_1235 | 120 |
| 421 | 3300035170 | Ga0373943_0278047 | Ga0373943_0278047_367_729 | 120 |
| 422 | 3300035171 | Ga0373946_0331851 | Ga0373946_0331851_144_521 | 120 |
| 423 | 3300035172 | Ga0373955_0120510 | Ga0373955_0120510_821_1186 | 120 |
| 424 | 3300035172 | Ga0373955_0198675 | Ga0373955_0198675_89_451 | 120 |
| 425 | 3300035172 | Ga0373955_1046582 | Ga0373955_1046582_35_397 | 120 |
| 426 | 3300035242 | Ga0373962_0204772 | Ga0373962_0204772_69_440 | 120 |
| 427 | 3300035410 | Ga0373924_0018573 | Ga0373924_0018573_352_714 | 120 |
| 428 | 3300035410 | Ga0373924_0425610 | Ga0373924_0425610_79_444 | 120 |
| 429 | 3300035691 | Ga0373931_0532974 | Ga0373931_0532974_341_712 | 120 |
| 430 | 3300035691 | Ga0373931_1167015 | Ga0373931_1167015_31_393 | 120 |
| 431 | 3300035692 | Ga0373935_0002120 | Ga0373935_0002120_3177_3539 | 120 |
| 432 | 3300035692 | Ga0373935_0599482 | Ga0373935_0599482_227_589 | 120 |
| 433 | 3300035692 | Ga0373935_0979983 | Ga0373935_0979983_239_604 | 120 |
| 434 | 3300035695 | Ga0373927_0137642 | Ga0373927_0137642_1191_1553 | 120 |
| 435 | 3300035695 | Ga0373927_0223478 | Ga0373927_0223478_484_846 | 120 |
| 436 | 3300035695 | Ga0373927_0383435 | Ga0373927_0383435_375_740 | 120 |
| 437 | 3300035724 | Ga0373933_0158599 | Ga0373933_0158599_979_1341 | 120 |
| 438 | 3300035724 | Ga0373933_0253833 | Ga0373933_0253833_188_550 | 120 |
| 439 | 3300035725 | Ga0373947_0010402 | Ga0373947_0010402_1858_2220 | 120 |
| 440 | 3300035725 | Ga0373947_0100540 | Ga0373947_0100540_313_675 | 120 |
| 441 | 3300035725 | Ga0373947_0174108 | Ga0373947_0174108_126_488 | 120 |
| 442 | 3300036401 | Ga0373937_0118403 | Ga0373937_0118403_1449_1811 | 120 |
| 443 | 3300036401 | Ga0373937_0289541 | Ga0373937_0289541_777_1139 | 120 |
| 444 | 3300036401 | Ga0373937_0361132 | Ga0373937_0361132_739_1104 | 120 |
| 445 | 3300037068 | Ga0373925_0000666 | Ga0373925_0000666_4022_4384 | 120 |
| 446 | 3300037068 | Ga0373925_0178785 | Ga0373925_0178785_1241_1606 | 120 |
| 447 | 3300037068 | Ga0373925_0387939 | Ga0373925_0387939_271_633 | 120 |
| 448 | 3300037068 | Ga0373925_0409993 | Ga0373925_0409993_112_474 | 120 |
| 449 | 3300037068 | Ga0373925_0826990 | Ga0373925_0826990_373_735 | 120 |
| 450 | 3300037068 | Ga0373925_1049565 | Ga0373925_1049565_11_373 | 120 |
| 451 | 3300037471 | Ga0395905_1390457 | Ga0395905_1390457_187_549 | 120 |
| 452 | 3300039437 | Ga0436365_0339417 | Ga0436365_0339417_679_1053 | 120 |
| 453 | 3300039437 | Ga0436365_1264879 | Ga0436365_1264879_27_389 | 120 |
| 454 | 3300039450 | Ga0436363_0101575 | Ga0436363_0101575_26_388 | 120 |
| 455 | 3300039450 | Ga0436363_1065876 | Ga0436363_1065876_276_638 | 120 |
| 456 | 3300042118 | Ga0450914_001439 | Ga0450914_001439_161_523 | 120 |
| 457 | 3300042435 | Ga0439434_0075346 | Ga0439434_0075346_19_399 | 120 |
| 458 | 3300042876 | Ga0451577_1128659 | Ga0451577_1128659_124_486 | 120 |
| 459 | 3300044694 | Ga0466963_0005646 | Ga0466963_0005646_1976_2338 | 120 |
| 460 | 3300044694 | Ga0466963_0193269 | Ga0466963_0193269_620_982 | 120 |
| 461 | 3300045051 | Ga0451576_0259704 | Ga0451576_0259704_1122_1484 | 120 |
| 462 | 3300045051 | Ga0451576_1530717 | Ga0451576_1530717_162_524 | 120 |
| 463 | 3300045836 | Ga0466958_0405566 | Ga0466958_0405566_400_762 | 120 |
| 464 | 3300045976 | Ga0466967_1853515 | Ga0466967_1853515_54_428 | 120 |
| 465 | 3300046454 | Ga0495592_0491643 | Ga0495592_0491643_225_587 | 120 |
| 466 | 3300046457 | Ga0495590_0218433 | Ga0495590_0218433_75_440 | 120 |
| 467 | 3300046459 | Ga0495629_0151595 | Ga0495629_0151595_431_796 | 120 |
| 468 | 3300046459 | Ga0495629_0911994 | Ga0495629_0911994_181_543 | 120 |
| 469 | 3300046462 | Ga0495651_0246386 | Ga0495651_0246386_549_911 | 120 |
| 470 | 3300046463 | Ga0495653_0187500 | Ga0495653_0187500_890_1252 | 120 |
| 471 | 3300046463 | Ga0495653_0305177 | Ga0495653_0305177_311_673 | 120 |
| 472 | 3300046472 | Ga0495580_0453694 | Ga0495580_0453694_61_423 | 120 |
| 473 | 3300046472 | Ga0495580_0521995 | Ga0495580_0521995_298_660 | 120 |
| 474 | 3300046473 | Ga0495582_0027014 | Ga0495582_0027014_1099_1461 | 120 |
| 475 | 3300046473 | Ga0495582_0279381 | Ga0495582_0279381_425_787 | 120 |
| 476 | 3300046473 | Ga0495582_0300638 | Ga0495582_0300638_541_906 | 120 |
| 477 | 3300046475 | Ga0495639_0233651 | Ga0495639_0233651_441_812 | 120 |
| 478 | 3300046476 | Ga0495662_0129442 | Ga0495662_0129442_510_875 | 120 |
| 479 | 3300046476 | Ga0495662_0195613 | Ga0495662_0195613_594_956 | 120 |
| 480 | 3300046476 | Ga0495662_0288200 | Ga0495662_0288200_300_662 | 120 |
| 481 | 3300046491 | Ga0495584_0378858 | Ga0495584_0378858_232_594 | 120 |
| 482 | 3300046514 | Ga0495618_0200308 | Ga0495618_0200308_100_462 | 120 |
| 483 | 3300046516 | Ga0495628_0023497 | Ga0495628_0023497_4266_4628 | 120 |
| 484 | 3300046516 | Ga0495628_0609843 | Ga0495628_0609843_371_733 | 120 |
| 485 | 3300046517 | Ga0495630_0037113 | Ga0495630_0037113_717_1079 | 120 |
| 486 | 3300046517 | Ga0495630_0038450 | Ga0495630_0038450_131_496 | 120 |
| 487 | 3300046517 | Ga0495630_0474884 | Ga0495630_0474884_354_719 | 120 |
| 488 | 3300046517 | Ga0495630_1013747 | Ga0495630_1013747_64_429 | 120 |
| 489 | 3300046526 | Ga0495666_0463440 | Ga0495666_0463440_92_463 | 120 |
| 490 | 3300046529 | Ga0495652_0168834 | Ga0495652_0168834_971_1333 | 120 |
| 491 | 3300046531 | Ga0495665_0233554 | Ga0495665_0233554_239_601 | 120 |
| 492 | 3300046531 | Ga0495665_0637733 | Ga0495665_0637733_113_475 | 120 |
| 493 | 3300046533 | Ga0495640_0175705 | Ga0495640_0175705_296_658 | 120 |
| 494 | 3300046533 | Ga0495640_0248295 | Ga0495640_0248295_457_822 | 120 |
| 495 | 3300046535 | Ga0495586_0050044 | Ga0495586_0050044_1745_2110 | 120 |
| 496 | 3300046535 | Ga0495586_0154001 | Ga0495586_0154001_87_449 | 120 |
| 497 | 3300046535 | Ga0495586_0319195 | Ga0495586_0319195_88_453 | 120 |
| 498 | 3300046536 | Ga0495587_0138998 | Ga0495587_0138998_91_453 | 120 |
| 499 | 3300046539 | Ga0495621_0249567 | Ga0495621_0249567_11_376 | 120 |
| 500 | 3300046543 | Ga0495645_0000493 | Ga0495645_0000493_20574_20939 | 120 |
| 501 | 3300046543 | Ga0495645_0063124 | Ga0495645_0063124_1478_1840 | 120 |
| 502 | 3300046558 | Ga0495633_0160913 | Ga0495633_0160913_634_996 | 120 |
| 503 | 3300046558 | Ga0495633_0194498 | Ga0495633_0194498_171_533 | 120 |
| 504 | 3300046558 | Ga0495633_0589421 | Ga0495633_0589421_39_416 | 120 |
| 505 | 3300046559 | Ga0495667_0190383 | Ga0495667_0190383_207_569 | 120 |
| 506 | 3300046559 | Ga0495667_0367011 | Ga0495667_0367011_320_685 | 120 |
| 507 | 3300046642 | Ga0495634_0113784 | Ga0495634_0113784_810_1175 | 120 |
| 508 | 3300046642 | Ga0495634_0167559 | Ga0495634_0167559_393_755 | 120 |
| 509 | 3300046642 | Ga0495634_0237252 | Ga0495634_0237252_579_950 | 120 |
| 510 | 3300046642 | Ga0495634_0371073 | Ga0495634_0371073_397_759 | 120 |
| 511 | 3300046664 | Ga0495659_0081917 | Ga0495659_0081917_656_1018 | 120 |
| 512 | 3300046664 | Ga0495659_0239510 | Ga0495659_0239510_214_576 | 120 |
| 513 | 3300046664 | Ga0495659_0440473 | Ga0495659_0440473_152_514 | 120 |
| 514 | 3300046675 | Ga0495657_0560655 | Ga0495657_0560655_61_423 | 120 |
| 515 | 3300046678 | Ga0495599_0028045 | Ga0495599_0028045_1677_2039 | 120 |
| 516 | 3300046679 | Ga0495623_0091596 | Ga0495623_0091596_1168_1530 | 120 |
| 517 | 3300046680 | Ga0495646_0536960 | Ga0495646_0536960_137_499 | 120 |
| 518 | 3300046681 | Ga0495647_0081654 | Ga0495647_0081654_890_1252 | 120 |
| 519 | 3300046681 | Ga0495647_0127702 | Ga0495647_0127702_299_664 | 120 |
| 520 | 3300046681 | Ga0495647_0303317 | Ga0495647_0303317_76_441 | 120 |
| 521 | 3300046683 | Ga0495658_0033050 | Ga0495658_0033050_1549_1914 | 120 |
| 522 | 3300046683 | Ga0495658_0161678 | Ga0495658_0161678_961_1326 | 120 |
| 523 | 3300046683 | Ga0495658_0174394 | Ga0495658_0174394_783_1145 | 120 |
| 524 | 3300046683 | Ga0495658_0340359 | Ga0495658_0340359_215_577 | 120 |
| 525 | 3300046683 | Ga0495658_0377457 | Ga0495658_0377457_101_463 | 120 |
| 526 | 3300046684 | Ga0495669_0004735 | Ga0495669_0004735_5165_5527 | 120 |
| 527 | 3300046684 | Ga0495669_0016913 | Ga0495669_0016913_925_1287 | 120 |
| 528 | 3300046689 | Ga0495613_0001719 | Ga0495613_0001719_6528_6890 | 120 |
| 529 | 3300046689 | Ga0495613_0388712 | Ga0495613_0388712_159_521 | 120 |
| 530 | 3300046689 | Ga0495613_0457580 | Ga0495613_0457580_429_794 | 120 |
| 531 | 3300046689 | Ga0495613_0624141 | Ga0495613_0624141_221_586 | 120 |
| 532 | 3300046690 | Ga0495624_0666624 | Ga0495624_0666624_236_598 | 120 |
| 533 | 3300046691 | Ga0495670_0216473 | Ga0495670_0216473_543_905 | 120 |
| 534 | 3300046809 | Ga0495600_0021713 | Ga0495600_0021713_1859_2224 | 120 |
| 535 | 3300046809 | Ga0495600_0100542 | Ga0495600_0100542_912_1274 | 120 |
| 536 | 3300047317 | Ga0495604_0037955 | Ga0495604_0037955_1786_2148 | 120 |
| 537 | 3300047317 | Ga0495604_0305644 | Ga0495604_0305644_312_677 | 120 |
| 538 | 3300047317 | Ga0495604_0982907 | Ga0495604_0982907_127_492 | 120 |
| 539 | 3300047319 | Ga0495674_0268586 | Ga0495674_0268586_873_1235 | 120 |
| 540 | 3300047319 | Ga0495674_0902644 | Ga0495674_0902644_143_505 | 120 |
| 541 | 3300047321 | Ga0495676_0168169 | Ga0495676_0168169_582_947 | 120 |
| 542 | 3300047322 | Ga0495680_0166691 | Ga0495680_0166691_456_821 | 120 |
| 543 | 3300047444 | Ga0495675_0715304 | Ga0495675_0715304_170_532 | 120 |
| 544 | 3300047471 | Ga0495684_0002104 | Ga0495684_0002104_11538_11900 | 120 |
| 545 | 3300048903 | Ga0496100_0002378 | Ga0496100_0002378_3905_4291 | 120 |
| 546 | 3300048903 | Ga0496100_1342712 | Ga0496100_1342712_171_533 | 120 |
| 547 | 3300048904 | Ga0496101_0002831 | Ga0496101_0002831_4564_4950 | 120 |
| 548 | 3300048905 | Ga0496102_0027881 | Ga0496102_0027881_2479_2841 | 120 |
| 549 | 3300048905 | Ga0496102_0105822 | Ga0496102_0105822_1856_2218 | 120 |
| 550 | 3300048906 | Ga0496103_0832047 | Ga0496103_0832047_178_564 | 120 |
| 551 | 3300048906 | Ga0496103_0965930 | Ga0496103_0965930_151_513 | 120 |
| 552 | 3300048906 | Ga0496103_0983213 | Ga0496103_0983213_55_417 | 120 |
| 553 | 3300048907 | Ga0496104_0001613 | Ga0496104_0001613_6431_6817 | 120 |
| 554 | 3300048907 | Ga0496104_0062944 | Ga0496104_0062944_1266_1631 | 120 |
| 555 | 3300048907 | Ga0496104_0905168 | Ga0496104_0905168_185_547 | 120 |
| 556 | 3300048907 | Ga0496104_1134616 | Ga0496104_1134616_118_483 | 120 |
| 557 | 3300048907 | Ga0496104_1796485 | Ga0496104_1796485_13_390 | 120 |
| 558 | 3300048908 | Ga0496105_0035337 | Ga0496105_0035337_2646_3032 | 120 |
| 559 | 3300048908 | Ga0496105_0322977 | Ga0496105_0322977_493_858 | 120 |
| 560 | 3300048909 | Ga0496106_0070873 | Ga0496106_0070873_866_1228 | 120 |
| 561 | 3300048909 | Ga0496106_0083036 | Ga0496106_0083036_1490_1876 | 120 |
| 562 | 3300048909 | Ga0496106_0193359 | Ga0496106_0193359_1118_1480 | 120 |
| 563 | 3300048909 | Ga0496106_1579622 | Ga0496106_1579622_50_427 | 120 |
| 564 | 3300048911 | Ga0496108_0012522 | Ga0496108_0012522_2454_2819 | 120 |
| 565 | 3300048912 | Ga0496109_0170381 | Ga0496109_0170381_1207_1572 | 120 |
| 566 | 3300048912 | Ga0496109_0221537 | Ga0496109_0221537_52_414 | 120 |
| 567 | 3300048914 | Ga0496111_0079422 | Ga0496111_0079422_198_563 | 120 |
| 568 | 3300048915 | Ga0496112_0091866 | Ga0496112_0091866_1534_1899 | 120 |
| 569 | 3300048915 | Ga0496112_0156768 | Ga0496112_0156768_659_1033 | 120 |
| 570 | 3300048915 | Ga0496112_0713764 | Ga0496112_0713764_219_581 | 120 |
| 571 | 3300048915 | Ga0496112_1002025 | Ga0496112_1002025_215_580 | 120 |
| 572 | 3300048915 | Ga0496112_1847479 | Ga0496112_1847479_32_394 | 120 |
| 573 | 3300048917 | Ga0496114_0002181 | Ga0496114_0002181_1446_1832 | 120 |
| 574 | 3300048917 | Ga0496114_0097030 | Ga0496114_0097030_439_804 | 120 |
| 575 | 3300048917 | Ga0496114_0110368 | Ga0496114_0110368_1622_1999 | 120 |
| 576 | 3300048917 | Ga0496114_0366796 | Ga0496114_0366796_391_753 | 120 |
| 577 | 3300048917 | Ga0496114_0385263 | Ga0496114_0385263_468_830 | 120 |
| 578 | 3300048917 | Ga0496114_0417936 | Ga0496114_0417936_787_1149 | 120 |
| 579 | 3300048917 | Ga0496114_0773843 | Ga0496114_0773843_223_600 | 120 |
| 580 | 3300048917 | Ga0496114_0919991 | Ga0496114_0919991_354_716 | 120 |
| 581 | 3300049591 | Ga0501075_0225635 | Ga0501075_0225635_475_843 | 120 |
| 582 | 3300049592 | Ga0501076_0154693 | Ga0501076_0154693_900_1268 | 120 |
| 583 | 3300049592 | Ga0501076_0383983 | Ga0501076_0383983_90_491 | 120 |
| 584 | 3300049824 | Ga0501045_0118396 | Ga0501045_0118396_1460_1828 | 120 |
| 585 | 3300050493 | nmdc:mga0k408_77305_c1 | nmdc:mga0k408_77305_c1_65_433 | 120 |
| 586 | 3300050507 | nmdc:mga05p37_194416_c1 | nmdc:mga05p37_194416_c1_2039_2401 | 120 |
| 587 | 3300050507 | nmdc:mga05p37_233602_c1 | nmdc:mga05p37_233602_c1_119_481 | 120 |
| 588 | 3300050507 | nmdc:mga05p37_36152_c1 | nmdc:mga05p37_36152_c1_3629_3991 | 120 |
| 589 | 3300050507 | nmdc:mga05p37_6700_c1 | nmdc:mga05p37_6700_c1_5440_5802 | 120 |
| 590 | 3300050507 | nmdc:mga05p37_736914_c1 | nmdc:mga05p37_736914_c1_64_426 | 120 |
| 591 | 3300050508 | nmdc:mga09592_289520_c1 | nmdc:mga09592_289520_c1_522_884 | 120 |
| 592 | 3300050508 | nmdc:mga09592_84843_c1 | nmdc:mga09592_84843_c1_1502_1864 | 120 |
| 593 | 3300050509 | nmdc:mga0qj67_1422857_c1 | nmdc:mga0qj67_1422857_c1_141_518 | 120 |
| 594 | 3300050511 | nmdc:mga08y16_52740_c1 | nmdc:mga08y16_52740_c1_2430_2792 | 120 |
| 595 | 3300050512 | nmdc:mga0n895_16356_c1 | nmdc:mga0n895_16356_c1_1959_2321 | 120 |
| 596 | 3300050512 | nmdc:mga0n895_380594_c1 | nmdc:mga0n895_380594_c1_587_949 | 120 |
| 597 | 3300050512 | nmdc:mga0n895_4910_c1 | nmdc:mga0n895_4910_c1_6727_7107 | 120 |
| 598 | 3300050512 | nmdc:mga0n895_613748_c1 | nmdc:mga0n895_613748_c1_278_640 | 120 |
| 599 | 3300050512 | nmdc:mga0n895_844_c1 | nmdc:mga0n895_844_c1_1251_1613 | 120 |
| 600 | 3300050513 | nmdc:mga0rr50_1058059_c1 | nmdc:mga0rr50_1058059_c1_278_640 | 120 |
| 601 | 3300050513 | nmdc:mga0rr50_156161_c1 | nmdc:mga0rr50_156161_c1_900_1262 | 120 |
| 602 | 3300050513 | nmdc:mga0rr50_23_c1 | nmdc:mga0rr50_23_c1_20384_20746 | 120 |
| 603 | 3300050513 | nmdc:mga0rr50_521877_c1 | nmdc:mga0rr50_521877_c1_358_720 | 120 |
| 604 | 3300050513 | nmdc:mga0rr50_5303_c1 | nmdc:mga0rr50_5303_c1_2698_3060 | 120 |
| 605 | 3300050513 | nmdc:mga0rr50_994191_c1 | nmdc:mga0rr50_994191_c1_224_586 | 120 |
| 606 | 3300050514 | nmdc:mga08x19_11103_c1 | nmdc:mga08x19_11103_c1_3581_3943 | 120 |
| 607 | 3300050514 | nmdc:mga08x19_165_c1 | nmdc:mga08x19_165_c1_34246_34608 | 120 |
| 608 | 3300050514 | nmdc:mga08x19_58847_c1 | nmdc:mga08x19_58847_c1_505_867 | 120 |
| 609 | 3300050514 | nmdc:mga08x19_646_c1 | nmdc:mga08x19_646_c1_18692_19054 | 120 |
| 610 | 3300050515 | nmdc:mga0a205_100953_c1 | nmdc:mga0a205_100953_c1_1958_2320 | 120 |
| 611 | 3300050515 | nmdc:mga0a205_1041612_c1 | nmdc:mga0a205_1041612_c1_259_621 | 120 |
| 612 | 3300050515 | nmdc:mga0a205_32836_c1 | nmdc:mga0a205_32836_c1_1239_1619 | 120 |
| 613 | 3300050515 | nmdc:mga0a205_33620_c1 | nmdc:mga0a205_33620_c1_23_385 | 120 |
| 614 | 3300050515 | nmdc:mga0a205_790721_c1 | nmdc:mga0a205_790721_c1_31_393 | 120 |
| 615 | 3300050515 | nmdc:mga0a205_85338_c1 | nmdc:mga0a205_85338_c1_752_1114 | 120 |
| 616 | 3300053077 | Ga0495601_0035194 | Ga0495601_0035194_2446_2811 | 120 |
| 617 | 3300053077 | Ga0495601_0627515 | Ga0495601_0627515_304_666 | 120 |
| 618 | 3300053084 | Ga0495595_0030566 | Ga0495595_0030566_29_391 | 120 |
| 619 | 3300053084 | Ga0495595_0180905 | Ga0495595_0180905_379_741 | 120 |
| 620 | 3300053084 | Ga0495595_0643268 | Ga0495595_0643268_115_480 | 120 |
| 621 | 3300053085 | Ga0495619_0014250 | Ga0495619_0014250_3097_3459 | 120 |
| 622 | 3300053085 | Ga0495619_0062093 | Ga0495619_0062093_1325_1687 | 120 |
| 623 | 3300053085 | Ga0495619_0095003 | Ga0495619_0095003_321_686 | 120 |
| 624 | 3300053085 | Ga0495619_0108509 | Ga0495619_0108509_151_513 | 120 |
| 625 | 3300053085 | Ga0495619_0886140 | Ga0495619_0886140_196_558 | 120 |
| 626 | 3300053727 | Ga0500611_108964 | Ga0500611_108964_81_449 | 120 |
| 627 | 3300054114 | Ga0501084_1515995 | Ga0501084_1515995_161_529 | 120 |
| 628 | 3300061734 | Ga0530510_0009173 | Ga0530510_0009173_1708_2076 | 120 |
| 629 | 3300061734 | Ga0530510_1259188 | Ga0530510_1259188_19_420 | 120 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kv9-assembly1.cif.gz_A | structure of kiaa1718 jumonji domain | 0.9717 | 35 | 104 |
| 7zyb-assembly1.cif.gz_A | bekdgf with ca | 0.9489 | 10 | 112 |
| 3fjs-assembly2.cif.gz_D | crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution | 0.9444 | 25 | 106 |
| 1vrb-assembly1.cif.gz_A | crystal structure of putative asparaginyl hydroxylase (2636534) from bacillus subtilis at 2.60 a resolution | 0.9392 | 33 | 106 |
| 2y0o-assembly1.cif.gz_A-2 | the structure of a d-lyxose isomerase from the sigmab regulon of bacillus subtilis | 0.9279 | 23 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O13977_7_331_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.9498 | 35 | 101 | 2.60.120.650 |
| af_Q17765_350_577_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.9496 | 33 | 103 | 2.60.120.650 |
| af_A0A0P0V3U4_1_196_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.9467 | 35 | 101 | 2.60.120.650 |
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9403 | 25 | 106 | 2.60.120.10 |
| af_Q5RHD1_1_363_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.9401 | 35 | 107 | 2.60.120.650 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7AI81-F1-model_v4 | Cupin | 1.001 | 22 | 120 |
|
| AF-A0A7R8B007-F1-model_v4 | deleted | 0.9992 | 6 | 107 |
|
| AF-A0A2E9NQR5-F1-model_v4 | Cupin | 0.9984 | 22 | 111 |
|
| AF-A0A356IDE1-F1-model_v4 | Cupin domain-containing protein | 0.9977 | 22 | 110 |
|
| AF-A0A7C7LMA4-F1-model_v4 | Cupin domain-containing protein | 0.9967 | 6 | 111 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar