F470709

General Info

Members Datasets Scaffolds Average Seq Length
629 277 629 122

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100004466|Ga0070675_10000446611
Length 144
Sequence MQILYQSGAARPQWPRTAWYMLPAMSTQTVRLHRWDEIALEKVTEMISRKVVTGEREMIAQIYLKRGCVVPMHSHESEQMTYILQGALKFLINGEDITVREGEVLHIPSWVKHQAEALEDTFELDVFSPIRQDWLDHTDDYFHR

Samples

Sample ID Description Type Environment
1 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 5.88
Rhizosphere 92.85
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_11649032 3300004800 Unclassified 614
2 Ga0065704_10328300 3300005289 Unclassified 770
3 Ga0065704_10395349 3300005289 Unclassified 758
4 Ga0065712_10658778 3300005290 Unclassified 564
5 Ga0065712_10695200 3300005290 Unclassified 549
6 Ga0065715_10235948 3300005293 Unclassified 1217
7 Ga0065707_10229407 3300005295 Bacteria 1194
8 Ga0065707_10466030 3300005295 Bacteria 786
9 Ga0065707_10494391 3300005295 Bacteria 753
10 Ga0065707_10841531 3300005295 Unclassified 585
11 Ga0070683_100307220 3300005329 Bacteria 1509
12 Ga0070690_100004756 3300005330 Bacteria 7578
13 Ga0068869_100110925 3300005334 Bacteria 2087
14 Ga0068869_100683740 3300005334 Bacteria 874
15 Ga0070666_10004274 3300005335 Bacteria 8686
16 Ga0070666_10048991 3300005335 Bacteria 2839
17 Ga0070666_10105043 3300005335 Bacteria 1950
18 Ga0070666_10991708 3300005335 Bacteria 623
19 Ga0070680_100118471 3300005336 Bacteria 2209
20 Ga0070682_101117536 3300005337 Bacteria 661
21 Ga0070682_102014643 3300005337 Bacteria 508
22 Ga0068868_100094450 3300005338 Bacteria 2413
23 Ga0068868_100183193 3300005338 Bacteria 1738
24 Ga0068868_100495622 3300005338 Bacteria 1069
25 Ga0068868_100738452 3300005338 Bacteria 884
26 Ga0070660_100001966 3300005339 Bacteria 14175
27 Ga0070687_100060442 3300005343 Bacteria 1999
28 Ga0070661_100481554 3300005344 Bacteria 991
29 Ga0070692_10681153 3300005345 Bacteria 690
30 Ga0070668_102079994 3300005347 Unclassified 524
31 Ga0070669_100709900 3300005353 Bacteria 850
32 Ga0070675_100004466 3300005354 Bacteria 10667
33 Ga0070675_100250238 3300005354 Bacteria 1551
34 Ga0070675_100887743 3300005354 Bacteria 817
35 Ga0070675_101697430 3300005354 Unclassified 583
36 Ga0070671_100166308 3300005355 Bacteria 1865
37 Ga0070674_100108602 3300005356 Bacteria 2033
38 Ga0070674_100938395 3300005356 Bacteria 756
39 Ga0070674_101002357 3300005356 Bacteria 733
40 Ga0070688_100006201 3300005365 Bacteria 6367
41 Ga0070659_100268227 3300005366 Bacteria 1418
42 Ga0070659_100899169 3300005366 Bacteria 774
43 Ga0070709_10020183 3300005434 Bacteria 3863
44 Ga0070709_10673838 3300005434 Unclassified 803
45 Ga0070714_100019930 3300005435 Bacteria 5472
46 Ga0070714_101783007 3300005435 Unclassified 601
47 Ga0070713_100033773 3300005436 Unclassified 4102
48 Ga0070713_100343239 3300005436 Bacteria 1384
49 Ga0070713_101089000 3300005436 Unclassified 772
50 Ga0070711_100044962 3300005439 Unclassified 3000
51 Ga0070694_100049881 3300005444 Bacteria 2820
52 Ga0070708_100026937 3300005445 Bacteria 4926
53 Ga0070678_102081469 3300005456 Bacteria 537
54 Ga0070681_10144591 3300005458 Bacteria 2307
55 Ga0070681_11097231 3300005458 Bacteria 717
56 Ga0068867_100017018 3300005459 Bacteria 5166
57 Ga0068867_100028224 3300005459 Bacteria 4040
58 Ga0068867_100043691 3300005459 Bacteria 3281
59 Ga0068867_101669451 3300005459 Unclassified 597
60 Ga0070706_101532776 3300005467 Unclassified 609
61 Ga0070707_100023046 3300005468 Bacteria 5890
62 Ga0070707_100259994 3300005468 Bacteria 1689
63 Ga0070698_100621810 3300005471 Bacteria 1021
64 Ga0070698_100970267 3300005471 Bacteria 797
65 Ga0070698_101409392 3300005471 Bacteria 648
66 Ga0070679_100033161 3300005530 Bacteria 5113
67 Ga0068853_100260879 3300005539 Bacteria 1593
68 Ga0070686_100000963 3300005544 Bacteria 16588
69 Ga0070686_100100421 3300005544 Bacteria 1954
70 Ga0070686_101097380 3300005544 Bacteria 657
71 Ga0070695_100001340 3300005545 Bacteria 13632
72 Ga0070695_100592642 3300005545 Unclassified 869
73 Ga0070696_101338727 3300005546 Unclassified 609
74 Ga0070693_100251819 3300005547 Bacteria 1171
75 Ga0070693_100491826 3300005547 Unclassified 869
76 Ga0070665_100015811 3300005548 Bacteria 7579
77 Ga0070665_100040249 3300005548 Bacteria 4698
78 Ga0070665_101038174 3300005548 Bacteria 832
79 Ga0070704_100008143 3300005549 Bacteria 6267
80 Ga0070704_101593994 3300005549 Unclassified 602
81 Ga0068855_100050305 3300005563 Bacteria 4912
82 Ga0070664_100735849 3300005564 Unclassified 920
83 Ga0068852_100884282 3300005616 Bacteria 910
84 Ga0068859_100086643 3300005617 Bacteria 3179
85 Ga0068859_100094330 3300005617 Bacteria 3044
86 Ga0068859_100172071 3300005617 Bacteria 2247
87 Ga0068859_100181838 3300005617 Bacteria 2186
88 Ga0068859_101156897 3300005617 Bacteria 852
89 Ga0068864_100047469 3300005618 Bacteria 3688
90 Ga0068864_100171947 3300005618 Bacteria 1976
91 Ga0068864_100178013 3300005618 Bacteria 1942
92 Ga0068864_100426667 3300005618 Bacteria 1264
93 Ga0068866_10522585 3300005718 Bacteria 789
94 Ga0068861_100674299 3300005719 Bacteria 958
95 Ga0068861_100888633 3300005719 Bacteria 843
96 Ga0068851_10918967 3300005834 Bacteria 549
97 Ga0068870_10289554 3300005840 Bacteria 1030
98 Ga0068870_10353257 3300005840 Bacteria 944
99 Ga0068870_10994360 3300005840 Bacteria 598
100 Ga0068863_100196799 3300005841 Bacteria 1937
101 Ga0068863_100471890 3300005841 Bacteria 1233
102 Ga0068863_101710232 3300005841 Unclassified 639
103 Ga0068858_100074465 3300005842 Bacteria 3152
104 Ga0068858_100239411 3300005842 Bacteria 1722
105 Ga0068858_100301885 3300005842 Bacteria 1528
106 Ga0068858_100564256 3300005842 Bacteria 1102
107 Ga0068858_101275742 3300005842 Bacteria 723
108 Ga0068860_100070798 3300005843 Bacteria 3316
109 Ga0068860_100083516 3300005843 Bacteria 3038
110 Ga0068860_100086969 3300005843 Bacteria 2975
111 Ga0068860_100254505 3300005843 Bacteria 1711
112 Ga0068860_100432237 3300005843 Bacteria 1306
113 Ga0068860_101142541 3300005843 Bacteria 799
114 Ga0068860_101539996 3300005843 Bacteria 687
115 Ga0068862_100932834 3300005844 Unclassified 855
116 Ga0081455_10027171 3300005937 Bacteria 5246
117 Ga0081455_10050866 3300005937 Bacteria 3558
118 Ga0081539_10005884 3300005985 Bacteria 12142
119 Ga0081539_10203790 3300005985 Bacteria 911
120 Ga0081539_10255204 3300005985 Unclassified 777
121 Ga0070717_10379540 3300006028 Unclassified 1267
122 Ga0075366_10080458 3300006195 Bacteria 1946
123 Ga0097621_100024756 3300006237 Bacteria 4691
124 Ga0097621_100029071 3300006237 Bacteria 4363
125 Ga0097621_100037069 3300006237 Unclassified 3903
126 Ga0097621_100065556 3300006237 Bacteria 2989
127 Ga0097621_100288417 3300006237 Unclassified 1446
128 Ga0068871_100005117 3300006358 Bacteria 9159
129 Ga0068871_100016282 3300006358 Bacteria 5594
130 Ga0068871_100020872 3300006358 Bacteria 5025
131 Ga0068871_100023236 3300006358 Bacteria 4792
132 Ga0068871_100489376 3300006358 Bacteria 1107
133 Ga0075428_100155906 3300006844 Bacteria 2481
134 Ga0075431_102072731 3300006847 Unclassified 524
135 Ga0075433_10016223 3300006852 Bacteria 6128
136 Ga0075433_10047304 3300006852 Bacteria 3742
137 Ga0075433_10153870 3300006852 Bacteria 2046
138 Ga0075433_10295778 3300006852 Unclassified 1434
139 Ga0075433_10691655 3300006852 Bacteria 893
140 Ga0075433_11264287 3300006852 Unclassified 640
141 Ga0075434_100000465 3300006871 Bacteria 30350
142 Ga0075434_100000731 3300006871 Bacteria 25794
143 Ga0075434_100042170 3300006871 Bacteria 4523
144 Ga0075434_100477466 3300006871 Bacteria 1268
145 Ga0075434_100543261 3300006871 Unclassified 1182
146 Ga0075434_100918225 3300006871 Bacteria 890
147 Ga0075434_101121466 3300006871 Bacteria 800
148 Ga0075434_101136582 3300006871 Unclassified 794
149 Ga0075429_100206107 3300006880 Bacteria 1723
150 Ga0075429_100295406 3300006880 Bacteria 1418
151 Ga0068865_100046494 3300006881 Bacteria 2978
152 Ga0068865_100499957 3300006881 Bacteria 1013
153 Ga0075436_100004025 3300006914 Bacteria 10084
154 Ga0075436_100005802 3300006914 Bacteria 8479
155 Ga0075436_100040865 3300006914 Bacteria 3200
156 Ga0075436_100149756 3300006914 Bacteria 1642
157 Ga0097620_100086637 3300006931 Bacteria 3179
158 Ga0097620_100094330 3300006931 Bacteria 3044
159 Ga0097620_100172064 3300006931 Bacteria 2247
160 Ga0097620_100181832 3300006931 Bacteria 2186
161 Ga0097620_101156948 3300006931 Bacteria 852
162 Ga0075435_100000052 3300007076 Bacteria 58955
163 Ga0075435_100013121 3300007076 Bacteria 6155
164 Ga0075435_100015063 3300007076 Bacteria 5803
165 Ga0075435_100082108 3300007076 Bacteria 2649
166 Ga0075435_100208908 3300007076 Bacteria 1655
167 Ga0075435_100970603 3300007076 Bacteria 742
168 Ga0099795_10171720 3300007788 Unclassified 901
169 Ga0105251_10146622 3300009011 Bacteria 1067
170 Ga0105240_10018398 3300009093 Bacteria 9381
171 Ga0105240_10035708 3300009093 Bacteria 6403
172 Ga0105240_10171280 3300009093 Bacteria 2571
173 Ga0105240_10241064 3300009093 Bacteria 2096
174 Ga0105240_10755916 3300009093 Bacteria 1056
175 Ga0105240_12201075 3300009093 Unclassified 572
176 Ga0105240_12205863 3300009093 Unclassified 571
177 Ga0111539_12102096 3300009094 Unclassified 655
178 Ga0105245_10005875 3300009098 Bacteria 10780
179 Ga0105245_10187510 3300009098 Bacteria 1979
180 Ga0105245_10307596 3300009098 Bacteria 1557
181 Ga0105245_10717186 3300009098 Unclassified 1034
182 Ga0105245_10726059 3300009098 Bacteria 1028
183 Ga0105247_10012110 3300009101 Bacteria 5185
184 Ga0105247_10026511 3300009101 Bacteria 3500
185 Ga0105247_10080714 3300009101 Bacteria 2049
186 Ga0114129_10000307 3300009147 Bacteria 57086
187 Ga0114129_10017851 3300009147 Bacteria 10104
188 Ga0114129_10032741 3300009147 Bacteria 7345
189 Ga0114129_10098585 3300009147 Bacteria 4045
190 Ga0114129_10195912 3300009147 Bacteria 2740
191 Ga0114129_10288190 3300009147 Bacteria 2192
192 Ga0114129_10418381 3300009147 Unclassified 1763
193 Ga0105243_11562486 3300009148 Unclassified 685
194 Ga0105243_12391753 3300009148 Unclassified 566
195 Ga0105241_10146136 3300009174 Bacteria 1929
196 Ga0105241_12185013 3300009174 Bacteria 549
197 Ga0105242_10009949 3300009176 Bacteria 7283
198 Ga0105242_10056866 3300009176 Bacteria 3202
199 Ga0105248_10000664 3300009177 Bacteria 39095
200 Ga0105248_10173442 3300009177 Bacteria 2431
201 Ga0105248_10325558 3300009177 Unclassified 1731
202 Ga0105248_10846000 3300009177 Bacteria 1033
203 Ga0105248_10873281 3300009177 Bacteria 1015
204 Ga0105248_10958174 3300009177 Unclassified 966
205 Ga0105248_11272525 3300009177 Bacteria 832
206 Ga0105248_13122015 3300009177 Unclassified 527
207 Ga0105237_10712622 3300009545 Bacteria 1010
208 Ga0105238_10213283 3300009551 Bacteria 1907
209 Ga0105238_10317501 3300009551 Bacteria 1543
210 Ga0105238_10450712 3300009551 Unclassified 1284
211 Ga0105238_10906446 3300009551 Bacteria 900
212 Ga0105238_11388531 3300009551 Bacteria 729
213 Ga0105238_11887019 3300009551 Bacteria 630
214 Ga0105238_12150919 3300009551 Bacteria 592
215 Ga0105238_12204173 3300009551 Bacteria 586
216 Ga0105249_10781604 3300009553 Unclassified 1018
217 Ga0105249_12164565 3300009553 Bacteria 629
218 Ga0099796_10477380 3300010159 Bacteria 557
219 Ga0105239_11984086 3300010375 Unclassified 675
220 Ga0105246_10740957 3300011119 Unclassified 866
221 Ga0157370_10269569 3300013104 Unclassified 1573
222 Ga0157370_10865933 3300013104 Bacteria 821
223 Ga0157369_10942880 3300013105 Bacteria 885
224 Ga0157374_10042917 3300013296 Bacteria 4175
225 Ga0157374_10349483 3300013296 Bacteria 1469
226 Ga0157374_10446677 3300013296 Bacteria 1294
227 Ga0157378_10032763 3300013297 Bacteria 4593
228 Ga0157378_10711969 3300013297 Bacteria 1024
229 Ga0157378_11837605 3300013297 Unclassified 654
230 Ga0163162_12136000 3300013306 Unclassified 642
231 Ga0157372_10444709 3300013307 Unclassified 1511
232 Ga0157375_10481794 3300013308 Bacteria 1406
233 Ga0157375_10627147 3300013308 Unclassified 1233
234 Ga0157375_10840218 3300013308 Bacteria 1065
235 Ga0157375_10920154 3300013308 Unclassified 1018
236 Ga0157375_11390617 3300013308 Bacteria 827
237 Ga0157375_12339288 3300013308 Bacteria 637
238 Ga0157375_13291409 3300013308 Unclassified 539
239 Ga0163163_10059736 3300014325 Bacteria 3773
240 Ga0163163_10097589 3300014325 Bacteria 2959
241 Ga0163163_10177830 3300014325 Bacteria 2175
242 Ga0163163_10270754 3300014325 Unclassified 1750
243 Ga0163163_11556175 3300014325 Bacteria 722
244 Ga0163163_11959106 3300014325 Unclassified 646
245 Ga0157380_10186270 3300014326 Unclassified 1828
246 Ga0157380_11094899 3300014326 Unclassified 835
247 Ga0157377_10027736 3300014745 Bacteria 3043
248 Ga0157377_10046866 3300014745 Bacteria 2420
249 Ga0157379_10076657 3300014968 Bacteria 2994
250 Ga0157379_10298700 3300014968 Bacteria 1467
251 Ga0157379_10585140 3300014968 Bacteria 1041
252 Ga0157379_12472712 3300014968 Bacteria 519
253 Ga0157376_10030645 3300014969 Bacteria 4298
254 Ga0157376_10102220 3300014969 Unclassified 2507
255 Ga0157376_10136327 3300014969 Bacteria 2197
256 Ga0157376_10466157 3300014969 Bacteria 1235
257 Ga0157376_10502484 3300014969 Bacteria 1192
258 Ga0163161_10678193 3300017792 Bacteria 856
259 Ga0213876_10266514 3300021384 Unclassified 910
260 Ga0207692_10218378 3300025898 Bacteria 1129
261 Ga0207642_10294954 3300025899 Bacteria 938
262 Ga0207642_10486661 3300025899 Bacteria 753
263 Ga0207710_10057099 3300025900 Bacteria 1763
264 Ga0207710_10516206 3300025900 Unclassified 621
265 Ga0207688_10189823 3300025901 Unclassified 1228
266 Ga0207688_10394127 3300025901 Bacteria 858
267 Ga0207680_10005662 3300025903 Bacteria 5979
268 Ga0207680_10381011 3300025903 Unclassified 994
269 Ga0207680_10673572 3300025903 Bacteria 741
270 Ga0207685_10492460 3300025905 Unclassified 644
271 Ga0207699_10063158 3300025906 Unclassified 2236
272 Ga0207699_10622881 3300025906 Unclassified 787
273 Ga0207699_10647623 3300025906 Bacteria 771
274 Ga0207643_10036108 3300025908 Bacteria 2771
275 Ga0207684_11515052 3300025910 Bacteria 545
276 Ga0207654_10843416 3300025911 Bacteria 663
277 Ga0207695_10037979 3300025913 Bacteria 5191
278 Ga0207695_10069607 3300025913 Bacteria 3600
279 Ga0207695_10386824 3300025913 Bacteria 1284
280 Ga0207695_10720729 3300025913 Bacteria 878
281 Ga0207663_10293064 3300025916 Bacteria 1213
282 Ga0207663_10593727 3300025916 Unclassified 869
283 Ga0207660_10098191 3300025917 Bacteria 2184
284 Ga0207660_10708224 3300025917 Bacteria 821
285 Ga0207660_11557915 3300025917 Unclassified 533
286 Ga0207662_10029144 3300025918 Bacteria 3196
287 Ga0207657_10006060 3300025919 Bacteria 12572
288 Ga0207646_10025638 3300025922 Bacteria 5392
289 Ga0207646_10036451 3300025922 Bacteria 4440
290 Ga0207681_10243895 3300025923 Bacteria 1400
291 Ga0207694_10701703 3300025924 Unclassified 853
292 Ga0207694_10947711 3300025924 Bacteria 728
293 Ga0207650_10049437 3300025925 Bacteria 3105
294 Ga0207659_10000076 3300025926 Bacteria 62373
295 Ga0207659_10036702 3300025926 Bacteria 3397
296 Ga0207659_10143105 3300025926 Bacteria 1858
297 Ga0207659_10670628 3300025926 Bacteria 887
298 Ga0207659_11257471 3300025926 Unclassified 636
299 Ga0207687_10014551 3300025927 Bacteria 5151
300 Ga0207687_10296212 3300025927 Bacteria 1302
301 Ga0207700_10365812 3300025928 Unclassified 1258
302 Ga0207700_10462617 3300025928 Bacteria 1119
303 Ga0207664_10329407 3300025929 Bacteria 1348
304 Ga0207644_10250904 3300025931 Bacteria 1412
305 Ga0207686_10041427 3300025934 Bacteria 2808
306 Ga0207686_11389063 3300025934 Bacteria 578
307 Ga0207670_10143021 3300025936 Bacteria 1766
308 Ga0207669_10168297 3300025937 Bacteria 1557
309 Ga0207704_10007732 3300025938 Bacteria 5099
310 Ga0207704_10081580 3300025938 Bacteria 2092
311 Ga0207704_10310713 3300025938 Unclassified 1212
312 Ga0207691_10214543 3300025940 Bacteria 1671
313 Ga0207691_11671270 3300025940 Bacteria 516
314 Ga0207711_10040961 3300025941 Bacteria 3942
315 Ga0207711_10159348 3300025941 Bacteria 2041
316 Ga0207711_10374663 3300025941 Bacteria 1320
317 Ga0207689_10098427 3300025942 Bacteria 2403
318 Ga0207689_11060734 3300025942 Bacteria 683
319 Ga0207661_10089205 3300025944 Bacteria 2565
320 Ga0207679_10194034 3300025945 Archaea 1691
321 Ga0207667_10268444 3300025949 Bacteria 1744
322 Ga0207667_10885614 3300025949 Bacteria 885
323 Ga0207712_10989956 3300025961 Bacteria 746
324 Ga0207640_10432542 3300025981 Bacteria 1080
325 Ga0207658_10064302 3300025986 Bacteria 2752
326 Ga0207658_10411429 3300025986 Bacteria 1191
327 Ga0207677_10377699 3300026023 Bacteria 1195
328 Ga0207703_10004285 3300026035 Bacteria 11732
329 Ga0207703_10122717 3300026035 Bacteria 2232
330 Ga0207703_10158273 3300026035 Bacteria 1982
331 Ga0207703_10754259 3300026035 Bacteria 927
332 Ga0207703_11866391 3300026035 Bacteria 577
333 Ga0207639_10083971 3300026041 Bacteria 2529
334 Ga0207708_11763004 3300026075 Bacteria 543
335 Ga0207641_10380237 3300026088 Bacteria 1352
336 Ga0207641_10707790 3300026088 Bacteria 992
337 Ga0207648_10012695 3300026089 Bacteria 7873
338 Ga0207648_10054166 3300026089 Bacteria 3504
339 Ga0207648_10065690 3300026089 Bacteria 3163
340 Ga0207676_10054987 3300026095 Bacteria 3122
341 Ga0207676_10630959 3300026095 Bacteria 1032
342 Ga0207675_100346781 3300026118 Bacteria 1454
343 Ga0207675_102747059 3300026118 Unclassified 500
344 Ga0207683_10141097 3300026121 Bacteria 2171
345 Ga0207683_10154586 3300026121 Bacteria 2072
346 Ga0207683_10337631 3300026121 Bacteria 1381
347 Ga0207683_11456658 3300026121 Bacteria 633
348 Ga0207698_10790683 3300026142 Bacteria 950
349 Ga0209970_1024966 3300027614 Bacteria 1023
350 Ga0207428_10063031 3300027907 Bacteria 2930
351 Ga0207428_10187496 3300027907 Bacteria 1560
352 Ga0268266_10289770 3300028379 Bacteria 1524
353 Ga0268266_10363307 3300028379 Bacteria 1362
354 Ga0268265_11173954 3300028380 Bacteria 764
355 Ga0268265_11315812 3300028380 Bacteria 723
356 Ga0268264_10018278 3300028381 Bacteria 5733
357 Ga0268264_10043052 3300028381 Bacteria 3740
358 Ga0268264_10279296 3300028381 Bacteria 1563
359 Ga0268264_10543639 3300028381 Bacteria 1138
360 Ga0268264_10553742 3300028381 Bacteria 1128
361 Ga0268264_10830879 3300028381 Bacteria 924
362 Ga0265318_10052387 3300028577 Unclassified 1532
363 Ga0265332_10058893 3300031238 Bacteria 1644
364 Ga0265328_10040050 3300031239 Bacteria 1728
365 Ga0265331_10103158 3300031250 Bacteria 1311
366 Ga0307408_101111270 3300031548 Bacteria 734
367 Ga0307408_101567194 3300031548 Unclassified 625
368 Ga0265314_10032861 3300031711 Bacteria 3812
369 Ga0265314_10068592 3300031711 Bacteria 2383
370 Ga0307410_10849581 3300031852 Bacteria 779
371 Ga0307416_100871527 3300032002 Bacteria 999
372 Ga0373926_0319512 3300035083 Unclassified 607
373 Ga0373926_0434521 3300035083 Bacteria 520
374 Ga0373934_0104806 3300035086 Bacteria 1144
375 Ga0373944_0075842 3300035089 Bacteria 1103
376 Ga0373949_0123742 3300035090 Unclassified 728
377 Ga0373923_0049670 3300035111 Bacteria 1755
378 Ga0373923_0585372 3300035111 Bacteria 549
379 Ga0373936_0024719 3300035113 Bacteria 2347
380 Ga0373936_0290056 3300035113 Bacteria 737
381 Ga0373939_0358109 3300035114 Unclassified 595
382 Ga0373941_0010605 3300035115 Bacteria 2359
383 Ga0373953_0338135 3300035117 Bacteria 659
384 Ga0373954_0196748 3300035118 Unclassified 990
385 Ga0373956_0037425 3300035119 Bacteria 2145
386 Ga0373956_0080661 3300035119 Bacteria 1493
387 Ga0373956_0193749 3300035119 Bacteria 963
388 Ga0373957_0188163 3300035120 Unclassified 857
389 Ga0373957_0362922 3300035120 Bacteria 620
390 Ga0373957_0524369 3300035120 Unclassified 517
391 Ga0373943_0045468 3300035170 Bacteria 2140
392 Ga0373943_0145689 3300035170 Bacteria 1279
393 Ga0373943_0278047 3300035170 Bacteria 946
394 Ga0373946_0290311 3300035171 Unclassified 806
395 Ga0373946_0331851 3300035171 Bacteria 757
396 Ga0373955_0120510 3300035172 Bacteria 1525
397 Ga0373955_0198675 3300035172 Bacteria 1193
398 Ga0373955_1046582 3300035172 Unclassified 503
399 Ga0373962_0204772 3300035242 Unclassified 669
400 Ga0373924_0018573 3300035410 Bacteria 2681
401 Ga0373924_0425610 3300035410 Bacteria 594
402 Ga0373931_0532974 3300035691 Bacteria 761
403 Ga0373931_1167015 3300035691 Unclassified 526
404 Ga0373935_0002120 3300035692 Bacteria 11251
405 Ga0373935_0599482 3300035692 Unclassified 805
406 Ga0373935_0979983 3300035692 Bacteria 628
407 Ga0373927_0137642 3300035695 Bacteria 1596
408 Ga0373927_0223478 3300035695 Bacteria 1237
409 Ga0373927_0383435 3300035695 Bacteria 927
410 Ga0373933_0158599 3300035724 Bacteria 1436
411 Ga0373933_0253833 3300035724 Bacteria 1133
412 Ga0373933_0659114 3300035724 Bacteria 688
413 Ga0373947_0010402 3300035725 Bacteria 5338
414 Ga0373947_0100540 3300035725 Bacteria 1817
415 Ga0373947_0174108 3300035725 Bacteria 1398
416 Ga0373937_0118403 3300036401 Bacteria 2467
417 Ga0373937_0289541 3300036401 Bacteria 1547
418 Ga0373937_0361132 3300036401 Bacteria 1376
419 Ga0373925_0000666 3300037068 Bacteria 32236
420 Ga0373925_0044704 3300037068 Bacteria 3289
421 Ga0373925_0178785 3300037068 Bacteria 1678
422 Ga0373925_0387939 3300037068 Bacteria 1138
423 Ga0373925_0409993 3300037068 Bacteria 1106
424 Ga0373925_0826990 3300037068 Bacteria 763
425 Ga0373925_1049565 3300037068 Bacteria 671
426 Ga0395905_1390457 3300037471 Bacteria 606
427 Ga0436365_0339417 3300039437 Unclassified 1660
428 Ga0436365_1264879 3300039437 Unclassified 560
429 Ga0436363_0101575 3300039450 Bacteria 765
430 Ga0436363_1065876 3300039450 Bacteria 827
431 Ga0450914_001439 3300042118 Bacteria 1494
432 Ga0439434_0075346 3300042435 Bacteria 1066
433 Ga0439434_0368879 3300042435 Unclassified 503
434 Ga0439435_0117461 3300042436 Bacteria 830
435 Ga0439444_0052281 3300042437 Bacteria 833
436 Ga0451577_1128659 3300042876 Bacteria 701
437 Ga0439440_0110606 3300042993 Bacteria 756
438 Ga0466963_0005646 3300044694 Bacteria 7346
439 Ga0466963_0193269 3300044694 Bacteria 1422
440 Ga0451576_0259704 3300045051 Bacteria 1815
441 Ga0451576_1530717 3300045051 Bacteria 693
442 Ga0466958_0405566 3300045836 Bacteria 880
443 Ga0466967_1853515 3300045976 Bacteria 600
444 Ga0495592_0491643 3300046454 Bacteria 763
445 Ga0495592_0730086 3300046454 Bacteria 594
446 Ga0495590_0218433 3300046457 Bacteria 704
447 Ga0495629_0151595 3300046459 Bacteria 1611
448 Ga0495629_0911994 3300046459 Unclassified 575
449 Ga0495651_0246386 3300046462 Bacteria 1223
450 Ga0495653_0187500 3300046463 Unclassified 1414
451 Ga0495653_0305177 3300046463 Bacteria 1037
452 Ga0495580_0453694 3300046472 Bacteria 860
453 Ga0495580_0521995 3300046472 Unclassified 791
454 Ga0495582_0027014 3300046473 Bacteria 3146
455 Ga0495582_0279381 3300046473 Bacteria 959
456 Ga0495582_0300638 3300046473 Bacteria 922
457 Ga0495639_0233651 3300046475 Bacteria 906
458 Ga0495662_0129442 3300046476 Bacteria 1241
459 Ga0495662_0195613 3300046476 Bacteria 997
460 Ga0495662_0288200 3300046476 Bacteria 808
461 Ga0495584_0378858 3300046491 Bacteria 719
462 Ga0495618_0200308 3300046514 Bacteria 1264
463 Ga0495628_0023497 3300046516 Bacteria 5059
464 Ga0495628_0609843 3300046516 Bacteria 779
465 Ga0495630_0037113 3300046517 Bacteria 3643
466 Ga0495630_0038450 3300046517 Unclassified 3579
467 Ga0495630_0474884 3300046517 Bacteria 959
468 Ga0495630_1013747 3300046517 Bacteria 631
469 Ga0495666_0463440 3300046526 Bacteria 567
470 Ga0495652_0168834 3300046529 Bacteria 1691
471 Ga0495665_0233554 3300046531 Bacteria 949
472 Ga0495665_0637733 3300046531 Unclassified 531
473 Ga0495640_0175705 3300046533 Bacteria 1367
474 Ga0495640_0248295 3300046533 Bacteria 1115
475 Ga0495640_0929975 3300046533 Unclassified 514
476 Ga0495586_0050044 3300046535 Bacteria 2260
477 Ga0495586_0154001 3300046535 Bacteria 1294
478 Ga0495586_0319195 3300046535 Bacteria 891
479 Ga0495587_0064036 3300046536 Bacteria 2149
480 Ga0495587_0138998 3300046536 Bacteria 1387
481 Ga0495621_0249567 3300046539 Bacteria 725
482 Ga0495645_0000493 3300046543 Bacteria 27347
483 Ga0495645_0063124 3300046543 Bacteria 2682
484 Ga0495645_0933066 3300046543 Unclassified 514
485 Ga0495633_0160913 3300046558 Bacteria 1036
486 Ga0495633_0194498 3300046558 Bacteria 932
487 Ga0495633_0589421 3300046558 Bacteria 500
488 Ga0495667_0190383 3300046559 Bacteria 1315
489 Ga0495667_0367011 3300046559 Bacteria 909
490 Ga0495634_0113784 3300046642 Bacteria 1738
491 Ga0495634_0167559 3300046642 Bacteria 1382
492 Ga0495634_0237252 3300046642 Bacteria 1120
493 Ga0495634_0371073 3300046642 Bacteria 854
494 Ga0495635_0953257 3300046663 Bacteria 548
495 Ga0495659_0081917 3300046664 Unclassified 1226
496 Ga0495659_0239510 3300046664 Bacteria 754
497 Ga0495659_0440473 3300046664 Unclassified 566
498 Ga0495657_0560655 3300046675 Bacteria 663
499 Ga0495599_0028045 3300046678 Bacteria 3528
500 Ga0495623_0091596 3300046679 Bacteria 1865
501 Ga0495646_0536960 3300046680 Unclassified 598
502 Ga0495647_0081654 3300046681 Bacteria 1312
503 Ga0495647_0127702 3300046681 Bacteria 1075
504 Ga0495647_0303317 3300046681 Bacteria 720
505 Ga0495658_0033050 3300046683 Bacteria 2830
506 Ga0495658_0161678 3300046683 Bacteria 1381
507 Ga0495658_0174394 3300046683 Bacteria 1332
508 Ga0495658_0340359 3300046683 Unclassified 953
509 Ga0495658_0377457 3300046683 Bacteria 902
510 Ga0495669_0004735 3300046684 Bacteria 5645
511 Ga0495669_0016913 3300046684 Bacteria 3128
512 Ga0495613_0001719 3300046689 Bacteria 16660
513 Ga0495613_0388712 3300046689 Bacteria 953
514 Ga0495613_0457580 3300046689 Bacteria 864
515 Ga0495613_0624141 3300046689 Bacteria 715
516 Ga0495624_0666624 3300046690 Bacteria 618
517 Ga0495670_0216473 3300046691 Unclassified 1017
518 Ga0495600_0021713 3300046809 Bacteria 4116
519 Ga0495600_0100542 3300046809 Bacteria 1885
520 Ga0495604_0037955 3300047317 Bacteria 3791
521 Ga0495604_0305644 3300047317 Bacteria 1067
522 Ga0495604_0982907 3300047317 Bacteria 523
523 Ga0495674_0268586 3300047319 Bacteria 1400
524 Ga0495674_0902644 3300047319 Unclassified 682
525 Ga0495674_0937798 3300047319 Unclassified 666
526 Ga0495676_0168169 3300047321 Bacteria 1545
527 Ga0495676_0599018 3300047321 Unclassified 718
528 Ga0495680_0166691 3300047322 Bacteria 1597
529 Ga0495680_0628749 3300047322 Bacteria 716
530 Ga0495675_0715304 3300047444 Bacteria 560
531 Ga0495684_0002104 3300047471 Bacteria 15970
532 Ga0496100_0002378 3300048903 Bacteria 9518
533 Ga0496100_1342712 3300048903 Unclassified 564
534 Ga0496101_0002831 3300048904 Bacteria 10657
535 Ga0496102_0027881 3300048905 Bacteria 5045
536 Ga0496102_0105822 3300048905 Bacteria 2617
537 Ga0496103_0832047 3300048906 Bacteria 581
538 Ga0496103_0965930 3300048906 Unclassified 532
539 Ga0496103_0983213 3300048906 Unclassified 526
540 Ga0496104_0001613 3300048907 Bacteria 19451
541 Ga0496104_0062944 3300048907 Bacteria 3518
542 Ga0496104_0905168 3300048907 Unclassified 787
543 Ga0496104_1134616 3300048907 Bacteria 685
544 Ga0496104_1796485 3300048907 Unclassified 515
545 Ga0496105_0035337 3300048908 Bacteria 4113
546 Ga0496105_0322977 3300048908 Bacteria 1237
547 Ga0496106_0070873 3300048909 Bacteria 2663
548 Ga0496106_0083036 3300048909 Unclassified 2464
549 Ga0496106_0193359 3300048909 Bacteria 1618
550 Ga0496106_1579622 3300048909 Unclassified 503
551 Ga0496108_0012522 3300048911 Bacteria 6907
552 Ga0496109_0170381 3300048912 Bacteria 2042
553 Ga0496109_0221537 3300048912 Bacteria 1779
554 Ga0496111_0079422 3300048914 Bacteria 2393
555 Ga0496112_0091866 3300048915 Bacteria 3004
556 Ga0496112_0156768 3300048915 Bacteria 2244
557 Ga0496112_0713764 3300048915 Bacteria 930
558 Ga0496112_1002025 3300048915 Bacteria 755
559 Ga0496112_1847479 3300048915 Unclassified 516
560 Ga0496114_0002181 3300048917 Bacteria 14900
561 Ga0496114_0097030 3300048917 Bacteria 2510
562 Ga0496114_0110368 3300048917 Bacteria 2356
563 Ga0496114_0366796 3300048917 Bacteria 1274
564 Ga0496114_0385263 3300048917 Bacteria 1241
565 Ga0496114_0417936 3300048917 Bacteria 1188
566 Ga0496114_0773843 3300048917 Unclassified 838
567 Ga0496114_0919991 3300048917 Unclassified 756
568 Ga0496114_1778988 3300048917 Bacteria 504
569 Ga0501075_0225635 3300049591 Bacteria 1429
570 Ga0501076_0154693 3300049592 Bacteria 1866
571 Ga0501076_0383983 3300049592 Bacteria 1154
572 Ga0501045_0118396 3300049824 Bacteria 1966
573 nmdc:mga0k408_77305_c1 3300050493 Bacteria 1946
574 nmdc:mga05p37_194416_c1 3300050507 Bacteria 2461
575 nmdc:mga05p37_233602_c1 3300050507 Bacteria 2214
576 nmdc:mga05p37_36152_c1 3300050507 Bacteria 6060
577 nmdc:mga05p37_394321_c1 3300050507 Bacteria 1618
578 nmdc:mga05p37_6700_c1 3300050507 Bacteria 13572
579 nmdc:mga05p37_736914_c1 3300050507 Bacteria 1089
580 nmdc:mga09592_289520_c1 3300050508 Unclassified 1420
581 nmdc:mga09592_84843_c1 3300050508 Bacteria 2701
582 nmdc:mga0qj67_1422857_c1 3300050509 Bacteria 535
583 nmdc:mga06r32_1140530_c1 3300050510 Unclassified 727
584 nmdc:mga08y16_52740_c1 3300050511 Bacteria 4255
585 nmdc:mga0n895_16356_c1 3300050512 Bacteria 6803
586 nmdc:mga0n895_380594_c1 3300050512 Bacteria 1428
587 nmdc:mga0n895_4910_c1 3300050512 Bacteria 11084
588 nmdc:mga0n895_613748_c1 3300050512 Bacteria 1089
589 nmdc:mga0n895_844_c1 3300050512 Bacteria 21996
590 nmdc:mga0n895_967538_c1 3300050512 Bacteria 834
591 nmdc:mga0rr50_1058059_c1 3300050513 Bacteria 691
592 nmdc:mga0rr50_156161_c1 3300050513 Bacteria 1848
593 nmdc:mga0rr50_23_c1 3300050513 Bacteria 116800
594 nmdc:mga0rr50_521877_c1 3300050513 Bacteria 1011
595 nmdc:mga0rr50_5303_c1 3300050513 Bacteria 7669
596 nmdc:mga0rr50_711351_c1 3300050513 Bacteria 857
597 nmdc:mga0rr50_994191_c1 3300050513 Unclassified 715
598 nmdc:mga08x19_11103_c1 3300050514 Bacteria 5422
599 nmdc:mga08x19_165_c1 3300050514 Bacteria 54991
600 nmdc:mga08x19_433968_c1 3300050514 Bacteria 923
601 nmdc:mga08x19_58847_c1 3300050514 Bacteria 2487
602 nmdc:mga08x19_646_c1 3300050514 Bacteria 22496
603 nmdc:mga0a205_100953_c1 3300050515 Unclassified 2784
604 nmdc:mga0a205_1041612_c1 3300050515 Unclassified 665
605 nmdc:mga0a205_1320360_c1 3300050515 Unclassified 569
606 nmdc:mga0a205_32836_c1 3300050515 Bacteria 4976
607 nmdc:mga0a205_33620_c1 3300050515 Bacteria 4916
608 nmdc:mga0a205_790721_c1 3300050515 Bacteria 797
609 nmdc:mga0a205_85338_c1 3300050515 Bacteria 3049
610 Ga0495601_0035194 3300053077 Bacteria 3125
611 Ga0495601_0163809 3300053077 Bacteria 1453
612 Ga0495601_0627515 3300053077 Bacteria 688
613 Ga0495595_0030566 3300053084 Bacteria 2417
614 Ga0495595_0180905 3300053084 Bacteria 1045
615 Ga0495595_0643268 3300053084 Unclassified 543
616 Ga0495619_0014250 3300053085 Bacteria 5022
617 Ga0495619_0038106 3300053085 Bacteria 3134
618 Ga0495619_0062093 3300053085 Bacteria 2487
619 Ga0495619_0095003 3300053085 Bacteria 2023
620 Ga0495619_0108509 3300053085 Bacteria 1895
621 Ga0495619_0886140 3300053085 Unclassified 601
622 Ga0500611_108964 3300053727 Bacteria 726
623 Ga0501084_1515995 3300054114 Bacteria 561
624 Ga0590071_003058 3300059421 Bacteria 4147
625 Ga0590074_001767 3300059423 Bacteria 3529
626 Ga0590075_000705 3300059424 Bacteria 8857
627 Ga0590077_000272 3300059426 Bacteria 14641
628 Ga0530510_0009173 3300061734 Bacteria 6931
629 Ga0530510_1259188 3300061734 Bacteria 567

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100938395 Ga0070674_1009383951 114
2 3300005840 Ga0068870_10994360 Ga0068870_109943601 114
3 3300042435 Ga0439434_0368879 Ga0439434_0368879_40_393 114
4 3300005295 Ga0065707_10229407 Ga0065707_102294071 115
5 3300005354 Ga0070675_100250238 Ga0070675_1002502382 115
6 3300005617 Ga0068859_100094330 Ga0068859_1000943305 115
7 3300005618 Ga0068864_100171947 Ga0068864_1001719472 115
8 3300005841 Ga0068863_100471890 Ga0068863_1004718902 115
9 3300005843 Ga0068860_100254505 Ga0068860_1002545053 115
10 3300006844 Ga0075428_100155906 Ga0075428_1001559063 115
11 3300006852 Ga0075433_10295778 Ga0075433_102957782 115
12 3300006871 Ga0075434_100543261 Ga0075434_1005432612 115
13 3300006880 Ga0075429_100206107 Ga0075429_1002061073 115
14 3300006931 Ga0097620_100094330 Ga0097620_1000943305 115
15 3300009148 Ga0105243_12391753 Ga0105243_123917531 115
16 3300009551 Ga0105238_12204173 Ga0105238_122041732 115
17 3300025926 Ga0207659_10036702 Ga0207659_100367024 115
18 3300025926 Ga0207659_11257471 Ga0207659_112574712 115
19 3300025942 Ga0207689_11060734 Ga0207689_110607342 115
20 3300026088 Ga0207641_10707790 Ga0207641_107077902 115
21 3300026095 Ga0207676_10054987 Ga0207676_100549872 115
22 3300026118 Ga0207675_100346781 Ga0207675_1003467812 115
23 3300027907 Ga0207428_10187496 Ga0207428_101874962 115
24 3300028381 Ga0268264_10279296 Ga0268264_102792963 115
25 3300031548 Ga0307408_101567194 Ga0307408_1015671941 115
26 3300005843 Ga0068860_100086969 Ga0068860_1000869692 116
27 3300006871 Ga0075434_100918225 Ga0075434_1009182252 116
28 3300009101 Ga0105247_10012110 Ga0105247_100121105 116
29 3300014968 Ga0157379_10076657 Ga0157379_100766572 116
30 3300025900 Ga0207710_10057099 Ga0207710_100570992 116
31 3300026035 Ga0207703_10004285 Ga0207703_100042855 116
32 3300028381 Ga0268264_10018278 Ga0268264_100182784 116
33 3300050512 nmdc:mga0n895_967538_c1 nmdc:mga0n895_967538_c1_171_530 116
34 3300011119 Ga0105246_10740957 Ga0105246_107409572 117
35 3300013308 Ga0157375_10481794 Ga0157375_104817942 117
36 3300014969 Ga0157376_10466157 Ga0157376_104661572 117
37 3300025940 Ga0207691_11671270 Ga0207691_116712701 117
38 3300042436 Ga0439435_0117461 Ga0439435_0117461_295_648 117
39 3300042437 Ga0439444_0052281 Ga0439444_0052281_329_682 117
40 3300042993 Ga0439440_0110606 Ga0439440_0110606_232_585 117
41 3300048917 Ga0496114_1778988 Ga0496114_1778988_32_388 117
42 3300050513 nmdc:mga0rr50_711351_c1 nmdc:mga0rr50_711351_c1_478_837 117
43 3300005295 Ga0065707_10841531 Ga0065707_108415311 118
44 3300005844 Ga0068862_100932834 Ga0068862_1009328342 118
45 3300005937 Ga0081455_10027171 Ga0081455_100271716 118
46 3300025917 Ga0207660_11557915 Ga0207660_115579151 118
47 3300026121 Ga0207683_10154586 Ga0207683_101545862 118
48 3300050510 nmdc:mga06r32_1140530_c1 nmdc:mga06r32_1140530_c1_230_586 118
49 3300050515 nmdc:mga0a205_1320360_c1 nmdc:mga0a205_1320360_c1_29_385 118
50 3300059421 Ga0590071_003058 Ga0590071_003058_2344_2712 118
51 3300059423 Ga0590074_001767 Ga0590074_001767_1853_2221 118
52 3300059424 Ga0590075_000705 Ga0590075_000705_1724_2092 118
53 3300059426 Ga0590077_000272 Ga0590077_000272_12344_12712 118
54 3300009093 Ga0105240_12205863 Ga0105240_122058631 119
55 3300009147 Ga0114129_10288190 Ga0114129_102881903 119
56 3300025898 Ga0207692_10218378 Ga0207692_102183782 119
57 3300025901 Ga0207688_10394127 Ga0207688_103941272 119
58 3300025944 Ga0207661_10089205 Ga0207661_100892053 119
59 3300031852 Ga0307410_10849581 Ga0307410_108495812 119
60 3300032002 Ga0307416_100871527 Ga0307416_1008715272 119
61 3300035111 Ga0373923_0585372 Ga0373923_0585372_12_371 119
62 3300035170 Ga0373943_0045468 Ga0373943_0045468_399_758 119
63 3300035171 Ga0373946_0290311 Ga0373946_0290311_99_458 119
64 3300035724 Ga0373933_0659114 Ga0373933_0659114_310_669 119
65 3300037068 Ga0373925_0044704 Ga0373925_0044704_1635_1994 119
66 3300046454 Ga0495592_0730086 Ga0495592_0730086_146_526 119
67 3300046533 Ga0495640_0929975 Ga0495640_0929975_107_466 119
68 3300046536 Ga0495587_0064036 Ga0495587_0064036_627_1007 119
69 3300046543 Ga0495645_0933066 Ga0495645_0933066_25_384 119
70 3300046663 Ga0495635_0953257 Ga0495635_0953257_146_505 119
71 3300047319 Ga0495674_0937798 Ga0495674_0937798_23_382 119
72 3300047321 Ga0495676_0599018 Ga0495676_0599018_324_683 119
73 3300047322 Ga0495680_0628749 Ga0495680_0628749_241_621 119
74 3300050507 nmdc:mga05p37_394321_c1 nmdc:mga05p37_394321_c1_1235_1594 119
75 3300050514 nmdc:mga08x19_433968_c1 nmdc:mga08x19_433968_c1_110_469 119
76 3300053077 Ga0495601_0163809 Ga0495601_0163809_167_526 119
77 3300053085 Ga0495619_0038106 Ga0495619_0038106_1302_1682 119
78 3300004800 Ga0058861_11649032 Ga0058861_116490321 120
79 3300005289 Ga0065704_10328300 Ga0065704_103283002 120
80 3300005289 Ga0065704_10395349 Ga0065704_103953492 120
81 3300005290 Ga0065712_10658778 Ga0065712_106587782 120
82 3300005290 Ga0065712_10695200 Ga0065712_106952001 120
83 3300005293 Ga0065715_10235948 Ga0065715_102359482 120
84 3300005295 Ga0065707_10466030 Ga0065707_104660302 120
85 3300005295 Ga0065707_10494391 Ga0065707_104943911 120
86 3300005329 Ga0070683_100307220 Ga0070683_1003072202 120
87 3300005330 Ga0070690_100004756 Ga0070690_1000047563 120
88 3300005334 Ga0068869_100110925 Ga0068869_1001109252 120
89 3300005334 Ga0068869_100683740 Ga0068869_1006837402 120
90 3300005335 Ga0070666_10004274 Ga0070666_100042745 120
91 3300005335 Ga0070666_10048991 Ga0070666_100489912 120
92 3300005335 Ga0070666_10105043 Ga0070666_101050432 120
93 3300005335 Ga0070666_10991708 Ga0070666_109917081 120
94 3300005336 Ga0070680_100118471 Ga0070680_1001184712 120
95 3300005337 Ga0070682_101117536 Ga0070682_1011175362 120
96 3300005337 Ga0070682_102014643 Ga0070682_1020146431 120
97 3300005338 Ga0068868_100094450 Ga0068868_1000944502 120
98 3300005338 Ga0068868_100183193 Ga0068868_1001831933 120
99 3300005338 Ga0068868_100495622 Ga0068868_1004956221 120
100 3300005338 Ga0068868_100738452 Ga0068868_1007384522 120
101 3300005339 Ga0070660_100001966 Ga0070660_10000196610 120
102 3300005343 Ga0070687_100060442 Ga0070687_1000604422 120
103 3300005344 Ga0070661_100481554 Ga0070661_1004815542 120
104 3300005345 Ga0070692_10681153 Ga0070692_106811532 120
105 3300005347 Ga0070668_102079994 Ga0070668_1020799941 120
106 3300005353 Ga0070669_100709900 Ga0070669_1007099001 120
107 3300005354 Ga0070675_100004466 Ga0070675_10000446611 120
108 3300005354 Ga0070675_100887743 Ga0070675_1008877432 120
109 3300005354 Ga0070675_101697430 Ga0070675_1016974302 120
110 3300005355 Ga0070671_100166308 Ga0070671_1001663082 120
111 3300005356 Ga0070674_100108602 Ga0070674_1001086022 120
112 3300005356 Ga0070674_101002357 Ga0070674_1010023571 120
113 3300005365 Ga0070688_100006201 Ga0070688_1000062015 120
114 3300005366 Ga0070659_100268227 Ga0070659_1002682272 120
115 3300005366 Ga0070659_100899169 Ga0070659_1008991692 120
116 3300005434 Ga0070709_10020183 Ga0070709_100201832 120
117 3300005434 Ga0070709_10673838 Ga0070709_106738381 120
118 3300005435 Ga0070714_100019930 Ga0070714_1000199305 120
119 3300005435 Ga0070714_101783007 Ga0070714_1017830071 120
120 3300005436 Ga0070713_100033773 Ga0070713_1000337734 120
121 3300005436 Ga0070713_100343239 Ga0070713_1003432392 120
122 3300005436 Ga0070713_101089000 Ga0070713_1010890002 120
123 3300005439 Ga0070711_100044962 Ga0070711_1000449622 120
124 3300005444 Ga0070694_100049881 Ga0070694_1000498812 120
125 3300005445 Ga0070708_100026937 Ga0070708_1000269372 120
126 3300005456 Ga0070678_102081469 Ga0070678_1020814691 120
127 3300005458 Ga0070681_10144591 Ga0070681_101445912 120
128 3300005458 Ga0070681_11097231 Ga0070681_110972312 120
129 3300005459 Ga0068867_100017018 Ga0068867_1000170186 120
130 3300005459 Ga0068867_100028224 Ga0068867_1000282242 120
131 3300005459 Ga0068867_100043691 Ga0068867_1000436913 120
132 3300005459 Ga0068867_101669451 Ga0068867_1016694511 120
133 3300005467 Ga0070706_101532776 Ga0070706_1015327761 120
134 3300005468 Ga0070707_100023046 Ga0070707_1000230464 120
135 3300005468 Ga0070707_100259994 Ga0070707_1002599942 120
136 3300005471 Ga0070698_100621810 Ga0070698_1006218102 120
137 3300005471 Ga0070698_100970267 Ga0070698_1009702671 120
138 3300005471 Ga0070698_101409392 Ga0070698_1014093922 120
139 3300005530 Ga0070679_100033161 Ga0070679_1000331617 120
140 3300005539 Ga0068853_100260879 Ga0068853_1002608792 120
141 3300005544 Ga0070686_100000963 Ga0070686_1000009639 120
142 3300005544 Ga0070686_100100421 Ga0070686_1001004212 120
143 3300005544 Ga0070686_101097380 Ga0070686_1010973802 120
144 3300005545 Ga0070695_100001340 Ga0070695_10000134011 120
145 3300005545 Ga0070695_100592642 Ga0070695_1005926422 120
146 3300005546 Ga0070696_101338727 Ga0070696_1013387271 120
147 3300005547 Ga0070693_100251819 Ga0070693_1002518192 120
148 3300005547 Ga0070693_100491826 Ga0070693_1004918262 120
149 3300005548 Ga0070665_100015811 Ga0070665_1000158113 120
150 3300005548 Ga0070665_100040249 Ga0070665_1000402492 120
151 3300005548 Ga0070665_101038174 Ga0070665_1010381742 120
152 3300005549 Ga0070704_100008143 Ga0070704_1000081436 120
153 3300005549 Ga0070704_101593994 Ga0070704_1015939941 120
154 3300005563 Ga0068855_100050305 Ga0068855_1000503054 120
155 3300005564 Ga0070664_100735849 Ga0070664_1007358491 120
156 3300005616 Ga0068852_100884282 Ga0068852_1008842822 120
157 3300005617 Ga0068859_100086643 Ga0068859_1000866433 120
158 3300005617 Ga0068859_100172071 Ga0068859_1001720712 120
159 3300005617 Ga0068859_100181838 Ga0068859_1001818382 120
160 3300005617 Ga0068859_101156897 Ga0068859_1011568972 120
161 3300005618 Ga0068864_100047469 Ga0068864_1000474693 120
162 3300005618 Ga0068864_100178013 Ga0068864_1001780131 120
163 3300005618 Ga0068864_100426667 Ga0068864_1004266671 120
164 3300005718 Ga0068866_10522585 Ga0068866_105225852 120
165 3300005719 Ga0068861_100674299 Ga0068861_1006742992 120
166 3300005719 Ga0068861_100888633 Ga0068861_1008886332 120
167 3300005834 Ga0068851_10918967 Ga0068851_109189671 120
168 3300005840 Ga0068870_10289554 Ga0068870_102895542 120
169 3300005840 Ga0068870_10353257 Ga0068870_103532571 120
170 3300005841 Ga0068863_100196799 Ga0068863_1001967992 120
171 3300005841 Ga0068863_101710232 Ga0068863_1017102321 120
172 3300005842 Ga0068858_100074465 Ga0068858_1000744652 120
173 3300005842 Ga0068858_100239411 Ga0068858_1002394111 120
174 3300005842 Ga0068858_100301885 Ga0068858_1003018851 120
175 3300005842 Ga0068858_100564256 Ga0068858_1005642562 120
176 3300005842 Ga0068858_101275742 Ga0068858_1012757422 120
177 3300005843 Ga0068860_100070798 Ga0068860_1000707983 120
178 3300005843 Ga0068860_100083516 Ga0068860_1000835161 120
179 3300005843 Ga0068860_100432237 Ga0068860_1004322372 120
180 3300005843 Ga0068860_101142541 Ga0068860_1011425412 120
181 3300005843 Ga0068860_101539996 Ga0068860_1015399962 120
182 3300005937 Ga0081455_10050866 Ga0081455_100508662 120
183 3300005985 Ga0081539_10005884 Ga0081539_100058846 120
184 3300005985 Ga0081539_10203790 Ga0081539_102037902 120
185 3300005985 Ga0081539_10255204 Ga0081539_102552042 120
186 3300006028 Ga0070717_10379540 Ga0070717_103795402 120
187 3300006195 Ga0075366_10080458 Ga0075366_100804581 120
188 3300006237 Ga0097621_100024756 Ga0097621_1000247564 120
189 3300006237 Ga0097621_100029071 Ga0097621_1000290712 120
190 3300006237 Ga0097621_100037069 Ga0097621_1000370695 120
191 3300006237 Ga0097621_100065556 Ga0097621_1000655562 120
192 3300006237 Ga0097621_100288417 Ga0097621_1002884172 120
193 3300006358 Ga0068871_100005117 Ga0068871_1000051176 120
194 3300006358 Ga0068871_100016282 Ga0068871_1000162822 120
195 3300006358 Ga0068871_100020872 Ga0068871_1000208722 120
196 3300006358 Ga0068871_100023236 Ga0068871_1000232362 120
197 3300006358 Ga0068871_100489376 Ga0068871_1004893762 120
198 3300006847 Ga0075431_102072731 Ga0075431_1020727311 120
199 3300006852 Ga0075433_10016223 Ga0075433_100162235 120
200 3300006852 Ga0075433_10047304 Ga0075433_100473041 120
201 3300006852 Ga0075433_10153870 Ga0075433_101538702 120
202 3300006852 Ga0075433_10691655 Ga0075433_106916552 120
203 3300006852 Ga0075433_11264287 Ga0075433_112642871 120
204 3300006871 Ga0075434_100000465 Ga0075434_10000046521 120
205 3300006871 Ga0075434_100000731 Ga0075434_10000073122 120
206 3300006871 Ga0075434_100042170 Ga0075434_1000421702 120
207 3300006871 Ga0075434_100477466 Ga0075434_1004774662 120
208 3300006871 Ga0075434_101121466 Ga0075434_1011214662 120
209 3300006871 Ga0075434_101136582 Ga0075434_1011365822 120
210 3300006880 Ga0075429_100295406 Ga0075429_1002954062 120
211 3300006881 Ga0068865_100046494 Ga0068865_1000464943 120
212 3300006881 Ga0068865_100499957 Ga0068865_1004999572 120
213 3300006914 Ga0075436_100004025 Ga0075436_1000040254 120
214 3300006914 Ga0075436_100005802 Ga0075436_1000058024 120
215 3300006914 Ga0075436_100040865 Ga0075436_1000408652 120
216 3300006914 Ga0075436_100149756 Ga0075436_1001497562 120
217 3300006931 Ga0097620_100086637 Ga0097620_1000866373 120
218 3300006931 Ga0097620_100172064 Ga0097620_1001720643 120
219 3300006931 Ga0097620_100181832 Ga0097620_1001818323 120
220 3300006931 Ga0097620_101156948 Ga0097620_1011569482 120
221 3300007076 Ga0075435_100000052 Ga0075435_10000005240 120
222 3300007076 Ga0075435_100013121 Ga0075435_1000131212 120
223 3300007076 Ga0075435_100015063 Ga0075435_1000150632 120
224 3300007076 Ga0075435_100082108 Ga0075435_1000821085 120
225 3300007076 Ga0075435_100208908 Ga0075435_1002089082 120
226 3300007076 Ga0075435_100970603 Ga0075435_1009706032 120
227 3300007788 Ga0099795_10171720 Ga0099795_101717202 120
228 3300009011 Ga0105251_10146622 Ga0105251_101466222 120
229 3300009093 Ga0105240_10018398 Ga0105240_100183983 120
230 3300009093 Ga0105240_10035708 Ga0105240_100357085 120
231 3300009093 Ga0105240_10171280 Ga0105240_101712802 120
232 3300009093 Ga0105240_10241064 Ga0105240_102410642 120
233 3300009093 Ga0105240_10755916 Ga0105240_107559162 120
234 3300009093 Ga0105240_12201075 Ga0105240_122010751 120
235 3300009094 Ga0111539_12102096 Ga0111539_121020962 120
236 3300009098 Ga0105245_10005875 Ga0105245_100058754 120
237 3300009098 Ga0105245_10187510 Ga0105245_101875102 120
238 3300009098 Ga0105245_10307596 Ga0105245_103075962 120
239 3300009098 Ga0105245_10717186 Ga0105245_107171862 120
240 3300009098 Ga0105245_10726059 Ga0105245_107260592 120
241 3300009101 Ga0105247_10026511 Ga0105247_100265114 120
242 3300009101 Ga0105247_10080714 Ga0105247_100807142 120
243 3300009147 Ga0114129_10000307 Ga0114129_1000030727 120
244 3300009147 Ga0114129_10017851 Ga0114129_100178512 120
245 3300009147 Ga0114129_10032741 Ga0114129_100327413 120
246 3300009147 Ga0114129_10098585 Ga0114129_100985852 120
247 3300009147 Ga0114129_10195912 Ga0114129_101959123 120
248 3300009147 Ga0114129_10418381 Ga0114129_104183812 120
249 3300009148 Ga0105243_11562486 Ga0105243_115624862 120
250 3300009174 Ga0105241_10146136 Ga0105241_101461361 120
251 3300009174 Ga0105241_12185013 Ga0105241_121850131 120
252 3300009176 Ga0105242_10009949 Ga0105242_100099496 120
253 3300009176 Ga0105242_10056866 Ga0105242_100568663 120
254 3300009177 Ga0105248_10000664 Ga0105248_1000066426 120
255 3300009177 Ga0105248_10173442 Ga0105248_101734422 120
256 3300009177 Ga0105248_10325558 Ga0105248_103255583 120
257 3300009177 Ga0105248_10846000 Ga0105248_108460002 120
258 3300009177 Ga0105248_10873281 Ga0105248_108732812 120
259 3300009177 Ga0105248_10958174 Ga0105248_109581741 120
260 3300009177 Ga0105248_11272525 Ga0105248_112725252 120
261 3300009177 Ga0105248_13122015 Ga0105248_131220151 120
262 3300009545 Ga0105237_10712622 Ga0105237_107126222 120
263 3300009551 Ga0105238_10213283 Ga0105238_102132832 120
264 3300009551 Ga0105238_10317501 Ga0105238_103175011 120
265 3300009551 Ga0105238_10450712 Ga0105238_104507122 120
266 3300009551 Ga0105238_10906446 Ga0105238_109064462 120
267 3300009551 Ga0105238_11388531 Ga0105238_113885311 120
268 3300009551 Ga0105238_11887019 Ga0105238_118870192 120
269 3300009551 Ga0105238_12150919 Ga0105238_121509192 120
270 3300009553 Ga0105249_10781604 Ga0105249_107816041 120
271 3300009553 Ga0105249_12164565 Ga0105249_121645652 120
272 3300010159 Ga0099796_10477380 Ga0099796_104773801 120
273 3300010375 Ga0105239_11984086 Ga0105239_119840862 120
274 3300013104 Ga0157370_10269569 Ga0157370_102695692 120
275 3300013104 Ga0157370_10865933 Ga0157370_108659332 120
276 3300013105 Ga0157369_10942880 Ga0157369_109428802 120
277 3300013296 Ga0157374_10042917 Ga0157374_100429172 120
278 3300013296 Ga0157374_10349483 Ga0157374_103494832 120
279 3300013296 Ga0157374_10446677 Ga0157374_104466772 120
280 3300013297 Ga0157378_10032763 Ga0157378_100327635 120
281 3300013297 Ga0157378_10711969 Ga0157378_107119691 120
282 3300013297 Ga0157378_11837605 Ga0157378_118376052 120
283 3300013306 Ga0163162_12136000 Ga0163162_121360002 120
284 3300013307 Ga0157372_10444709 Ga0157372_104447092 120
285 3300013308 Ga0157375_10627147 Ga0157375_106271472 120
286 3300013308 Ga0157375_10840218 Ga0157375_108402182 120
287 3300013308 Ga0157375_10920154 Ga0157375_109201542 120
288 3300013308 Ga0157375_11390617 Ga0157375_113906171 120
289 3300013308 Ga0157375_12339288 Ga0157375_123392882 120
290 3300013308 Ga0157375_13291409 Ga0157375_132914091 120
291 3300014325 Ga0163163_10059736 Ga0163163_100597362 120
292 3300014325 Ga0163163_10097589 Ga0163163_100975891 120
293 3300014325 Ga0163163_10177830 Ga0163163_101778303 120
294 3300014325 Ga0163163_10270754 Ga0163163_102707542 120
295 3300014325 Ga0163163_11556175 Ga0163163_115561752 120
296 3300014325 Ga0163163_11959106 Ga0163163_119591061 120
297 3300014326 Ga0157380_10186270 Ga0157380_101862702 120
298 3300014326 Ga0157380_11094899 Ga0157380_110948991 120
299 3300014745 Ga0157377_10027736 Ga0157377_100277362 120
300 3300014745 Ga0157377_10046866 Ga0157377_100468663 120
301 3300014968 Ga0157379_10298700 Ga0157379_102987003 120
302 3300014968 Ga0157379_10585140 Ga0157379_105851401 120
303 3300014968 Ga0157379_12472712 Ga0157379_124727122 120
304 3300014969 Ga0157376_10030645 Ga0157376_100306452 120
305 3300014969 Ga0157376_10102220 Ga0157376_101022202 120
306 3300014969 Ga0157376_10136327 Ga0157376_101363272 120
307 3300014969 Ga0157376_10502484 Ga0157376_105024842 120
308 3300017792 Ga0163161_10678193 Ga0163161_106781932 120
309 3300021384 Ga0213876_10266514 Ga0213876_102665142 120
310 3300025899 Ga0207642_10294954 Ga0207642_102949542 120
311 3300025899 Ga0207642_10486661 Ga0207642_104866612 120
312 3300025900 Ga0207710_10516206 Ga0207710_105162061 120
313 3300025901 Ga0207688_10189823 Ga0207688_101898233 120
314 3300025903 Ga0207680_10005662 Ga0207680_100056622 120
315 3300025903 Ga0207680_10381011 Ga0207680_103810112 120
316 3300025903 Ga0207680_10673572 Ga0207680_106735722 120
317 3300025905 Ga0207685_10492460 Ga0207685_104924601 120
318 3300025906 Ga0207699_10063158 Ga0207699_100631582 120
319 3300025906 Ga0207699_10622881 Ga0207699_106228812 120
320 3300025906 Ga0207699_10647623 Ga0207699_106476232 120
321 3300025908 Ga0207643_10036108 Ga0207643_100361083 120
322 3300025910 Ga0207684_11515052 Ga0207684_115150521 120
323 3300025911 Ga0207654_10843416 Ga0207654_108434162 120
324 3300025913 Ga0207695_10037979 Ga0207695_100379792 120
325 3300025913 Ga0207695_10069607 Ga0207695_100696073 120
326 3300025913 Ga0207695_10386824 Ga0207695_103868242 120
327 3300025913 Ga0207695_10720729 Ga0207695_107207292 120
328 3300025916 Ga0207663_10293064 Ga0207663_102930642 120
329 3300025916 Ga0207663_10593727 Ga0207663_105937272 120
330 3300025917 Ga0207660_10098191 Ga0207660_100981912 120
331 3300025917 Ga0207660_10708224 Ga0207660_107082242 120
332 3300025918 Ga0207662_10029144 Ga0207662_100291442 120
333 3300025919 Ga0207657_10006060 Ga0207657_100060605 120
334 3300025922 Ga0207646_10025638 Ga0207646_100256384 120
335 3300025922 Ga0207646_10036451 Ga0207646_100364512 120
336 3300025923 Ga0207681_10243895 Ga0207681_102438952 120
337 3300025924 Ga0207694_10701703 Ga0207694_107017032 120
338 3300025924 Ga0207694_10947711 Ga0207694_109477112 120
339 3300025925 Ga0207650_10049437 Ga0207650_100494374 120
340 3300025926 Ga0207659_10000076 Ga0207659_1000007647 120
341 3300025926 Ga0207659_10143105 Ga0207659_101431052 120
342 3300025926 Ga0207659_10670628 Ga0207659_106706281 120
343 3300025927 Ga0207687_10014551 Ga0207687_100145514 120
344 3300025927 Ga0207687_10296212 Ga0207687_102962122 120
345 3300025928 Ga0207700_10365812 Ga0207700_103658122 120
346 3300025928 Ga0207700_10462617 Ga0207700_104626172 120
347 3300025929 Ga0207664_10329407 Ga0207664_103294072 120
348 3300025931 Ga0207644_10250904 Ga0207644_102509042 120
349 3300025934 Ga0207686_10041427 Ga0207686_100414272 120
350 3300025934 Ga0207686_11389063 Ga0207686_113890631 120
351 3300025936 Ga0207670_10143021 Ga0207670_101430212 120
352 3300025937 Ga0207669_10168297 Ga0207669_101682972 120
353 3300025938 Ga0207704_10007732 Ga0207704_100077323 120
354 3300025938 Ga0207704_10081580 Ga0207704_100815802 120
355 3300025938 Ga0207704_10310713 Ga0207704_103107132 120
356 3300025940 Ga0207691_10214543 Ga0207691_102145432 120
357 3300025941 Ga0207711_10040961 Ga0207711_100409613 120
358 3300025941 Ga0207711_10159348 Ga0207711_101593482 120
359 3300025941 Ga0207711_10374663 Ga0207711_103746632 120
360 3300025942 Ga0207689_10098427 Ga0207689_100984272 120
361 3300025945 Ga0207679_10194034 Ga0207679_101940342 120
362 3300025949 Ga0207667_10268444 Ga0207667_102684443 120
363 3300025949 Ga0207667_10885614 Ga0207667_108856142 120
364 3300025961 Ga0207712_10989956 Ga0207712_109899562 120
365 3300025981 Ga0207640_10432542 Ga0207640_104325422 120
366 3300025986 Ga0207658_10064302 Ga0207658_100643022 120
367 3300025986 Ga0207658_10411429 Ga0207658_104114292 120
368 3300026023 Ga0207677_10377699 Ga0207677_103776992 120
369 3300026035 Ga0207703_10122717 Ga0207703_101227172 120
370 3300026035 Ga0207703_10158273 Ga0207703_101582732 120
371 3300026035 Ga0207703_10754259 Ga0207703_107542591 120
372 3300026035 Ga0207703_11866391 Ga0207703_118663911 120
373 3300026041 Ga0207639_10083971 Ga0207639_100839713 120
374 3300026075 Ga0207708_11763004 Ga0207708_117630041 120
375 3300026088 Ga0207641_10380237 Ga0207641_103802372 120
376 3300026089 Ga0207648_10012695 Ga0207648_100126956 120
377 3300026089 Ga0207648_10054166 Ga0207648_100541662 120
378 3300026089 Ga0207648_10065690 Ga0207648_100656902 120
379 3300026095 Ga0207676_10630959 Ga0207676_106309592 120
380 3300026118 Ga0207675_102747059 Ga0207675_1027470591 120
381 3300026121 Ga0207683_10141097 Ga0207683_101410973 120
382 3300026121 Ga0207683_10337631 Ga0207683_103376311 120
383 3300026121 Ga0207683_11456658 Ga0207683_114566581 120
384 3300026142 Ga0207698_10790683 Ga0207698_107906832 120
385 3300027614 Ga0209970_1024966 Ga0209970_10249662 120
386 3300027907 Ga0207428_10063031 Ga0207428_100630313 120
387 3300028379 Ga0268266_10289770 Ga0268266_102897702 120
388 3300028379 Ga0268266_10363307 Ga0268266_103633071 120
389 3300028380 Ga0268265_11173954 Ga0268265_111739542 120
390 3300028380 Ga0268265_11315812 Ga0268265_113158122 120
391 3300028381 Ga0268264_10043052 Ga0268264_100430522 120
392 3300028381 Ga0268264_10543639 Ga0268264_105436392 120
393 3300028381 Ga0268264_10553742 Ga0268264_105537422 120
394 3300028381 Ga0268264_10830879 Ga0268264_108308792 120
395 3300028577 Ga0265318_10052387 Ga0265318_100523872 120
396 3300031238 Ga0265332_10058893 Ga0265332_100588933 120
397 3300031239 Ga0265328_10040050 Ga0265328_100400502 120
398 3300031250 Ga0265331_10103158 Ga0265331_101031582 120
399 3300031548 Ga0307408_101111270 Ga0307408_1011112701 120
400 3300031711 Ga0265314_10032861 Ga0265314_100328612 120
401 3300031711 Ga0265314_10068592 Ga0265314_100685923 120
402 3300035083 Ga0373926_0319512 Ga0373926_0319512_196_558 120
403 3300035083 Ga0373926_0434521 Ga0373926_0434521_58_423 120
404 3300035086 Ga0373934_0104806 Ga0373934_0104806_622_987 120
405 3300035089 Ga0373944_0075842 Ga0373944_0075842_377_742 120
406 3300035090 Ga0373949_0123742 Ga0373949_0123742_29_400 120
407 3300035111 Ga0373923_0049670 Ga0373923_0049670_496_858 120
408 3300035113 Ga0373936_0024719 Ga0373936_0024719_1036_1398 120
409 3300035113 Ga0373936_0290056 Ga0373936_0290056_191_553 120
410 3300035114 Ga0373939_0358109 Ga0373939_0358109_19_381 120
411 3300035115 Ga0373941_0010605 Ga0373941_0010605_1926_2288 120
412 3300035117 Ga0373953_0338135 Ga0373953_0338135_10_381 120
413 3300035118 Ga0373954_0196748 Ga0373954_0196748_97_459 120
414 3300035119 Ga0373956_0037425 Ga0373956_0037425_1599_1961 120
415 3300035119 Ga0373956_0080661 Ga0373956_0080661_543_905 120
416 3300035119 Ga0373956_0193749 Ga0373956_0193749_116_481 120
417 3300035120 Ga0373957_0188163 Ga0373957_0188163_92_454 120
418 3300035120 Ga0373957_0362922 Ga0373957_0362922_163_525 120
419 3300035120 Ga0373957_0524369 Ga0373957_0524369_65_430 120
420 3300035170 Ga0373943_0145689 Ga0373943_0145689_873_1235 120
421 3300035170 Ga0373943_0278047 Ga0373943_0278047_367_729 120
422 3300035171 Ga0373946_0331851 Ga0373946_0331851_144_521 120
423 3300035172 Ga0373955_0120510 Ga0373955_0120510_821_1186 120
424 3300035172 Ga0373955_0198675 Ga0373955_0198675_89_451 120
425 3300035172 Ga0373955_1046582 Ga0373955_1046582_35_397 120
426 3300035242 Ga0373962_0204772 Ga0373962_0204772_69_440 120
427 3300035410 Ga0373924_0018573 Ga0373924_0018573_352_714 120
428 3300035410 Ga0373924_0425610 Ga0373924_0425610_79_444 120
429 3300035691 Ga0373931_0532974 Ga0373931_0532974_341_712 120
430 3300035691 Ga0373931_1167015 Ga0373931_1167015_31_393 120
431 3300035692 Ga0373935_0002120 Ga0373935_0002120_3177_3539 120
432 3300035692 Ga0373935_0599482 Ga0373935_0599482_227_589 120
433 3300035692 Ga0373935_0979983 Ga0373935_0979983_239_604 120
434 3300035695 Ga0373927_0137642 Ga0373927_0137642_1191_1553 120
435 3300035695 Ga0373927_0223478 Ga0373927_0223478_484_846 120
436 3300035695 Ga0373927_0383435 Ga0373927_0383435_375_740 120
437 3300035724 Ga0373933_0158599 Ga0373933_0158599_979_1341 120
438 3300035724 Ga0373933_0253833 Ga0373933_0253833_188_550 120
439 3300035725 Ga0373947_0010402 Ga0373947_0010402_1858_2220 120
440 3300035725 Ga0373947_0100540 Ga0373947_0100540_313_675 120
441 3300035725 Ga0373947_0174108 Ga0373947_0174108_126_488 120
442 3300036401 Ga0373937_0118403 Ga0373937_0118403_1449_1811 120
443 3300036401 Ga0373937_0289541 Ga0373937_0289541_777_1139 120
444 3300036401 Ga0373937_0361132 Ga0373937_0361132_739_1104 120
445 3300037068 Ga0373925_0000666 Ga0373925_0000666_4022_4384 120
446 3300037068 Ga0373925_0178785 Ga0373925_0178785_1241_1606 120
447 3300037068 Ga0373925_0387939 Ga0373925_0387939_271_633 120
448 3300037068 Ga0373925_0409993 Ga0373925_0409993_112_474 120
449 3300037068 Ga0373925_0826990 Ga0373925_0826990_373_735 120
450 3300037068 Ga0373925_1049565 Ga0373925_1049565_11_373 120
451 3300037471 Ga0395905_1390457 Ga0395905_1390457_187_549 120
452 3300039437 Ga0436365_0339417 Ga0436365_0339417_679_1053 120
453 3300039437 Ga0436365_1264879 Ga0436365_1264879_27_389 120
454 3300039450 Ga0436363_0101575 Ga0436363_0101575_26_388 120
455 3300039450 Ga0436363_1065876 Ga0436363_1065876_276_638 120
456 3300042118 Ga0450914_001439 Ga0450914_001439_161_523 120
457 3300042435 Ga0439434_0075346 Ga0439434_0075346_19_399 120
458 3300042876 Ga0451577_1128659 Ga0451577_1128659_124_486 120
459 3300044694 Ga0466963_0005646 Ga0466963_0005646_1976_2338 120
460 3300044694 Ga0466963_0193269 Ga0466963_0193269_620_982 120
461 3300045051 Ga0451576_0259704 Ga0451576_0259704_1122_1484 120
462 3300045051 Ga0451576_1530717 Ga0451576_1530717_162_524 120
463 3300045836 Ga0466958_0405566 Ga0466958_0405566_400_762 120
464 3300045976 Ga0466967_1853515 Ga0466967_1853515_54_428 120
465 3300046454 Ga0495592_0491643 Ga0495592_0491643_225_587 120
466 3300046457 Ga0495590_0218433 Ga0495590_0218433_75_440 120
467 3300046459 Ga0495629_0151595 Ga0495629_0151595_431_796 120
468 3300046459 Ga0495629_0911994 Ga0495629_0911994_181_543 120
469 3300046462 Ga0495651_0246386 Ga0495651_0246386_549_911 120
470 3300046463 Ga0495653_0187500 Ga0495653_0187500_890_1252 120
471 3300046463 Ga0495653_0305177 Ga0495653_0305177_311_673 120
472 3300046472 Ga0495580_0453694 Ga0495580_0453694_61_423 120
473 3300046472 Ga0495580_0521995 Ga0495580_0521995_298_660 120
474 3300046473 Ga0495582_0027014 Ga0495582_0027014_1099_1461 120
475 3300046473 Ga0495582_0279381 Ga0495582_0279381_425_787 120
476 3300046473 Ga0495582_0300638 Ga0495582_0300638_541_906 120
477 3300046475 Ga0495639_0233651 Ga0495639_0233651_441_812 120
478 3300046476 Ga0495662_0129442 Ga0495662_0129442_510_875 120
479 3300046476 Ga0495662_0195613 Ga0495662_0195613_594_956 120
480 3300046476 Ga0495662_0288200 Ga0495662_0288200_300_662 120
481 3300046491 Ga0495584_0378858 Ga0495584_0378858_232_594 120
482 3300046514 Ga0495618_0200308 Ga0495618_0200308_100_462 120
483 3300046516 Ga0495628_0023497 Ga0495628_0023497_4266_4628 120
484 3300046516 Ga0495628_0609843 Ga0495628_0609843_371_733 120
485 3300046517 Ga0495630_0037113 Ga0495630_0037113_717_1079 120
486 3300046517 Ga0495630_0038450 Ga0495630_0038450_131_496 120
487 3300046517 Ga0495630_0474884 Ga0495630_0474884_354_719 120
488 3300046517 Ga0495630_1013747 Ga0495630_1013747_64_429 120
489 3300046526 Ga0495666_0463440 Ga0495666_0463440_92_463 120
490 3300046529 Ga0495652_0168834 Ga0495652_0168834_971_1333 120
491 3300046531 Ga0495665_0233554 Ga0495665_0233554_239_601 120
492 3300046531 Ga0495665_0637733 Ga0495665_0637733_113_475 120
493 3300046533 Ga0495640_0175705 Ga0495640_0175705_296_658 120
494 3300046533 Ga0495640_0248295 Ga0495640_0248295_457_822 120
495 3300046535 Ga0495586_0050044 Ga0495586_0050044_1745_2110 120
496 3300046535 Ga0495586_0154001 Ga0495586_0154001_87_449 120
497 3300046535 Ga0495586_0319195 Ga0495586_0319195_88_453 120
498 3300046536 Ga0495587_0138998 Ga0495587_0138998_91_453 120
499 3300046539 Ga0495621_0249567 Ga0495621_0249567_11_376 120
500 3300046543 Ga0495645_0000493 Ga0495645_0000493_20574_20939 120
501 3300046543 Ga0495645_0063124 Ga0495645_0063124_1478_1840 120
502 3300046558 Ga0495633_0160913 Ga0495633_0160913_634_996 120
503 3300046558 Ga0495633_0194498 Ga0495633_0194498_171_533 120
504 3300046558 Ga0495633_0589421 Ga0495633_0589421_39_416 120
505 3300046559 Ga0495667_0190383 Ga0495667_0190383_207_569 120
506 3300046559 Ga0495667_0367011 Ga0495667_0367011_320_685 120
507 3300046642 Ga0495634_0113784 Ga0495634_0113784_810_1175 120
508 3300046642 Ga0495634_0167559 Ga0495634_0167559_393_755 120
509 3300046642 Ga0495634_0237252 Ga0495634_0237252_579_950 120
510 3300046642 Ga0495634_0371073 Ga0495634_0371073_397_759 120
511 3300046664 Ga0495659_0081917 Ga0495659_0081917_656_1018 120
512 3300046664 Ga0495659_0239510 Ga0495659_0239510_214_576 120
513 3300046664 Ga0495659_0440473 Ga0495659_0440473_152_514 120
514 3300046675 Ga0495657_0560655 Ga0495657_0560655_61_423 120
515 3300046678 Ga0495599_0028045 Ga0495599_0028045_1677_2039 120
516 3300046679 Ga0495623_0091596 Ga0495623_0091596_1168_1530 120
517 3300046680 Ga0495646_0536960 Ga0495646_0536960_137_499 120
518 3300046681 Ga0495647_0081654 Ga0495647_0081654_890_1252 120
519 3300046681 Ga0495647_0127702 Ga0495647_0127702_299_664 120
520 3300046681 Ga0495647_0303317 Ga0495647_0303317_76_441 120
521 3300046683 Ga0495658_0033050 Ga0495658_0033050_1549_1914 120
522 3300046683 Ga0495658_0161678 Ga0495658_0161678_961_1326 120
523 3300046683 Ga0495658_0174394 Ga0495658_0174394_783_1145 120
524 3300046683 Ga0495658_0340359 Ga0495658_0340359_215_577 120
525 3300046683 Ga0495658_0377457 Ga0495658_0377457_101_463 120
526 3300046684 Ga0495669_0004735 Ga0495669_0004735_5165_5527 120
527 3300046684 Ga0495669_0016913 Ga0495669_0016913_925_1287 120
528 3300046689 Ga0495613_0001719 Ga0495613_0001719_6528_6890 120
529 3300046689 Ga0495613_0388712 Ga0495613_0388712_159_521 120
530 3300046689 Ga0495613_0457580 Ga0495613_0457580_429_794 120
531 3300046689 Ga0495613_0624141 Ga0495613_0624141_221_586 120
532 3300046690 Ga0495624_0666624 Ga0495624_0666624_236_598 120
533 3300046691 Ga0495670_0216473 Ga0495670_0216473_543_905 120
534 3300046809 Ga0495600_0021713 Ga0495600_0021713_1859_2224 120
535 3300046809 Ga0495600_0100542 Ga0495600_0100542_912_1274 120
536 3300047317 Ga0495604_0037955 Ga0495604_0037955_1786_2148 120
537 3300047317 Ga0495604_0305644 Ga0495604_0305644_312_677 120
538 3300047317 Ga0495604_0982907 Ga0495604_0982907_127_492 120
539 3300047319 Ga0495674_0268586 Ga0495674_0268586_873_1235 120
540 3300047319 Ga0495674_0902644 Ga0495674_0902644_143_505 120
541 3300047321 Ga0495676_0168169 Ga0495676_0168169_582_947 120
542 3300047322 Ga0495680_0166691 Ga0495680_0166691_456_821 120
543 3300047444 Ga0495675_0715304 Ga0495675_0715304_170_532 120
544 3300047471 Ga0495684_0002104 Ga0495684_0002104_11538_11900 120
545 3300048903 Ga0496100_0002378 Ga0496100_0002378_3905_4291 120
546 3300048903 Ga0496100_1342712 Ga0496100_1342712_171_533 120
547 3300048904 Ga0496101_0002831 Ga0496101_0002831_4564_4950 120
548 3300048905 Ga0496102_0027881 Ga0496102_0027881_2479_2841 120
549 3300048905 Ga0496102_0105822 Ga0496102_0105822_1856_2218 120
550 3300048906 Ga0496103_0832047 Ga0496103_0832047_178_564 120
551 3300048906 Ga0496103_0965930 Ga0496103_0965930_151_513 120
552 3300048906 Ga0496103_0983213 Ga0496103_0983213_55_417 120
553 3300048907 Ga0496104_0001613 Ga0496104_0001613_6431_6817 120
554 3300048907 Ga0496104_0062944 Ga0496104_0062944_1266_1631 120
555 3300048907 Ga0496104_0905168 Ga0496104_0905168_185_547 120
556 3300048907 Ga0496104_1134616 Ga0496104_1134616_118_483 120
557 3300048907 Ga0496104_1796485 Ga0496104_1796485_13_390 120
558 3300048908 Ga0496105_0035337 Ga0496105_0035337_2646_3032 120
559 3300048908 Ga0496105_0322977 Ga0496105_0322977_493_858 120
560 3300048909 Ga0496106_0070873 Ga0496106_0070873_866_1228 120
561 3300048909 Ga0496106_0083036 Ga0496106_0083036_1490_1876 120
562 3300048909 Ga0496106_0193359 Ga0496106_0193359_1118_1480 120
563 3300048909 Ga0496106_1579622 Ga0496106_1579622_50_427 120
564 3300048911 Ga0496108_0012522 Ga0496108_0012522_2454_2819 120
565 3300048912 Ga0496109_0170381 Ga0496109_0170381_1207_1572 120
566 3300048912 Ga0496109_0221537 Ga0496109_0221537_52_414 120
567 3300048914 Ga0496111_0079422 Ga0496111_0079422_198_563 120
568 3300048915 Ga0496112_0091866 Ga0496112_0091866_1534_1899 120
569 3300048915 Ga0496112_0156768 Ga0496112_0156768_659_1033 120
570 3300048915 Ga0496112_0713764 Ga0496112_0713764_219_581 120
571 3300048915 Ga0496112_1002025 Ga0496112_1002025_215_580 120
572 3300048915 Ga0496112_1847479 Ga0496112_1847479_32_394 120
573 3300048917 Ga0496114_0002181 Ga0496114_0002181_1446_1832 120
574 3300048917 Ga0496114_0097030 Ga0496114_0097030_439_804 120
575 3300048917 Ga0496114_0110368 Ga0496114_0110368_1622_1999 120
576 3300048917 Ga0496114_0366796 Ga0496114_0366796_391_753 120
577 3300048917 Ga0496114_0385263 Ga0496114_0385263_468_830 120
578 3300048917 Ga0496114_0417936 Ga0496114_0417936_787_1149 120
579 3300048917 Ga0496114_0773843 Ga0496114_0773843_223_600 120
580 3300048917 Ga0496114_0919991 Ga0496114_0919991_354_716 120
581 3300049591 Ga0501075_0225635 Ga0501075_0225635_475_843 120
582 3300049592 Ga0501076_0154693 Ga0501076_0154693_900_1268 120
583 3300049592 Ga0501076_0383983 Ga0501076_0383983_90_491 120
584 3300049824 Ga0501045_0118396 Ga0501045_0118396_1460_1828 120
585 3300050493 nmdc:mga0k408_77305_c1 nmdc:mga0k408_77305_c1_65_433 120
586 3300050507 nmdc:mga05p37_194416_c1 nmdc:mga05p37_194416_c1_2039_2401 120
587 3300050507 nmdc:mga05p37_233602_c1 nmdc:mga05p37_233602_c1_119_481 120
588 3300050507 nmdc:mga05p37_36152_c1 nmdc:mga05p37_36152_c1_3629_3991 120
589 3300050507 nmdc:mga05p37_6700_c1 nmdc:mga05p37_6700_c1_5440_5802 120
590 3300050507 nmdc:mga05p37_736914_c1 nmdc:mga05p37_736914_c1_64_426 120
591 3300050508 nmdc:mga09592_289520_c1 nmdc:mga09592_289520_c1_522_884 120
592 3300050508 nmdc:mga09592_84843_c1 nmdc:mga09592_84843_c1_1502_1864 120
593 3300050509 nmdc:mga0qj67_1422857_c1 nmdc:mga0qj67_1422857_c1_141_518 120
594 3300050511 nmdc:mga08y16_52740_c1 nmdc:mga08y16_52740_c1_2430_2792 120
595 3300050512 nmdc:mga0n895_16356_c1 nmdc:mga0n895_16356_c1_1959_2321 120
596 3300050512 nmdc:mga0n895_380594_c1 nmdc:mga0n895_380594_c1_587_949 120
597 3300050512 nmdc:mga0n895_4910_c1 nmdc:mga0n895_4910_c1_6727_7107 120
598 3300050512 nmdc:mga0n895_613748_c1 nmdc:mga0n895_613748_c1_278_640 120
599 3300050512 nmdc:mga0n895_844_c1 nmdc:mga0n895_844_c1_1251_1613 120
600 3300050513 nmdc:mga0rr50_1058059_c1 nmdc:mga0rr50_1058059_c1_278_640 120
601 3300050513 nmdc:mga0rr50_156161_c1 nmdc:mga0rr50_156161_c1_900_1262 120
602 3300050513 nmdc:mga0rr50_23_c1 nmdc:mga0rr50_23_c1_20384_20746 120
603 3300050513 nmdc:mga0rr50_521877_c1 nmdc:mga0rr50_521877_c1_358_720 120
604 3300050513 nmdc:mga0rr50_5303_c1 nmdc:mga0rr50_5303_c1_2698_3060 120
605 3300050513 nmdc:mga0rr50_994191_c1 nmdc:mga0rr50_994191_c1_224_586 120
606 3300050514 nmdc:mga08x19_11103_c1 nmdc:mga08x19_11103_c1_3581_3943 120
607 3300050514 nmdc:mga08x19_165_c1 nmdc:mga08x19_165_c1_34246_34608 120
608 3300050514 nmdc:mga08x19_58847_c1 nmdc:mga08x19_58847_c1_505_867 120
609 3300050514 nmdc:mga08x19_646_c1 nmdc:mga08x19_646_c1_18692_19054 120
610 3300050515 nmdc:mga0a205_100953_c1 nmdc:mga0a205_100953_c1_1958_2320 120
611 3300050515 nmdc:mga0a205_1041612_c1 nmdc:mga0a205_1041612_c1_259_621 120
612 3300050515 nmdc:mga0a205_32836_c1 nmdc:mga0a205_32836_c1_1239_1619 120
613 3300050515 nmdc:mga0a205_33620_c1 nmdc:mga0a205_33620_c1_23_385 120
614 3300050515 nmdc:mga0a205_790721_c1 nmdc:mga0a205_790721_c1_31_393 120
615 3300050515 nmdc:mga0a205_85338_c1 nmdc:mga0a205_85338_c1_752_1114 120
616 3300053077 Ga0495601_0035194 Ga0495601_0035194_2446_2811 120
617 3300053077 Ga0495601_0627515 Ga0495601_0627515_304_666 120
618 3300053084 Ga0495595_0030566 Ga0495595_0030566_29_391 120
619 3300053084 Ga0495595_0180905 Ga0495595_0180905_379_741 120
620 3300053084 Ga0495595_0643268 Ga0495595_0643268_115_480 120
621 3300053085 Ga0495619_0014250 Ga0495619_0014250_3097_3459 120
622 3300053085 Ga0495619_0062093 Ga0495619_0062093_1325_1687 120
623 3300053085 Ga0495619_0095003 Ga0495619_0095003_321_686 120
624 3300053085 Ga0495619_0108509 Ga0495619_0108509_151_513 120
625 3300053085 Ga0495619_0886140 Ga0495619_0886140_196_558 120
626 3300053727 Ga0500611_108964 Ga0500611_108964_81_449 120
627 3300054114 Ga0501084_1515995 Ga0501084_1515995_161_529 120
628 3300061734 Ga0530510_0009173 Ga0530510_0009173_1708_2076 120
629 3300061734 Ga0530510_1259188 Ga0530510_1259188_19_420 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

58

135

0.89

PF07883

Cupin_2

Cupin domain

61

128

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kv9-assembly1.cif.gz_A structure of kiaa1718 jumonji domain 0.9717 35 104
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9489 10 112
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9444 25 106
1vrb-assembly1.cif.gz_A crystal structure of putative asparaginyl hydroxylase (2636534) from bacillus subtilis at 2.60 a resolution 0.9392 33 106
2y0o-assembly1.cif.gz_A-2 the structure of a d-lyxose isomerase from the sigmab regulon of bacillus subtilis 0.9279 23 107
ID Description Score Start End Superfamily
af_O13977_7_331_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9498 35 101 2.60.120.650
af_Q17765_350_577_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9496 33 103 2.60.120.650
af_A0A0P0V3U4_1_196_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9467 35 101 2.60.120.650
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9403 25 106 2.60.120.10
af_Q5RHD1_1_363_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9401 35 107 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A1Q7AI81-F1-model_v4 Cupin 1.001 22 120
AF-A0A7R8B007-F1-model_v4 deleted 0.9992 6 107
AF-A0A2E9NQR5-F1-model_v4 Cupin 0.9984 22 111
AF-A0A356IDE1-F1-model_v4 Cupin domain-containing protein 0.9977 22 110
AF-A0A7C7LMA4-F1-model_v4 Cupin domain-containing protein 0.9967 6 111

Feature Viewer

pLDDT pTM Quality
94.13 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map