F470663

General Info

Members Datasets Scaffolds Average Seq Length
628 312 1256 399

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0054536|Ga0466965_0054536_146_1414
Length 422
Sequence MRKFENPWKQNPWFESVAVTQERARKRLPQPVYGALVAGSERGQSIADNETAFAELGLAPHVVGQPPERSQATTVFGQQIGLPVIISPTGVQAVHPDGEVAVARAAAARGTIMGLSNFASKSVEDVTATGATTFFQMYWTGDRDTMIQRMQRAHAAGVKGLIATLDWSFSMGRDWGSPEIPEKVDLKAMVRLAPKVATKGRWMWQFGKEFRATGKLPDLTAPNLAPPGGKAPTFFGAYFEWMTTPPPTWDDVAWMRETWTQISGTPFVLKGVCRIDDALRAVDAGVAGISVSNHGGNNLDGTPAAIRMVRPIAEAVDRASAGQVDVVMDGGVRRGSDVVKALAMGAKAVMIGRAYLWGLAANGQAGVENVLDVLSGGVDSALRGLAVAATADLRPDHLLVPEGFDRALGVPAAAAAPVGVGS

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
295 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
296 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
297 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
298 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
302 2643221696 Nocardioides sp. Root140 Isolate Unclassified
303 2738541305 Nocardioides sp. CF167 Isolate Unclassified
304 2739367898 Nocardioides sp. CF479 Isolate Unclassified
305 2773857922 Frankia sp. CcI49 Isolate Nodule
306 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
307 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
308 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
309 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
310 2891562705 Microbispora tritici MT50 Isolate Unclassified
311 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
312 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 0.16
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 3.82
Nodule 0.16
Rhizoplane 9.87
Rhizosphere 78.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0054536 3300044683 Bacteria 1988
2 JGI24745J21846_1000078 3300002073 Bacteria 6918
3 JGI25407J50210_10002883 3300003373 Bacteria 4093
4 Ga0055540_1001748 3300003792 Bacteria 12441
5 Ga0070658_10006940 3300005327 Bacteria 9148
6 Ga0070658_10048174 3300005327 Bacteria 3449
7 Ga0070676_10011340 3300005328 Bacteria 4845
8 Ga0070676_10088126 3300005328 Bacteria 1896
9 Ga0070683_100003228 3300005329 Bacteria 13163
10 Ga0070683_100029777 3300005329 Bacteria 4947
11 Ga0070683_100131674 3300005329 Bacteria 2367
12 Ga0070690_100004542 3300005330 Bacteria 7718
13 Ga0070670_100035746 3300005331 Bacteria 4277
14 Ga0070670_100096926 3300005331 Bacteria 2537
15 Ga0068869_100008063 3300005334 Bacteria 6770
16 Ga0070666_10030348 3300005335 Bacteria 3561
17 Ga0070682_100000998 3300005337 Bacteria 16369
18 Ga0070682_100026032 3300005337 Bacteria 3497
19 Ga0070682_100046721 3300005337 Bacteria 2688
20 Ga0068868_100001405 3300005338 Bacteria 16590
21 Ga0068868_100001415 3300005338 Bacteria 16532
22 Ga0068868_100002096 3300005338 Bacteria 13740
23 Ga0070660_100060398 3300005339 Bacteria 2942
24 Ga0070689_100012826 3300005340 Bacteria 6051
25 Ga0070689_100024282 3300005340 Bacteria 4545
26 Ga0070691_10000993 3300005341 Bacteria 11610
27 Ga0070691_10019055 3300005341 Bacteria 3164
28 Ga0070661_100015786 3300005344 Bacteria 5330
29 Ga0070692_10008795 3300005345 Bacteria 4519
30 Ga0070692_10025837 3300005345 Bacteria 2898
31 Ga0070668_100005227 3300005347 Bacteria 9629
32 Ga0070669_100023633 3300005353 Bacteria 4402
33 Ga0070669_100029444 3300005353 Bacteria 3957
34 Ga0070675_100095177 3300005354 Bacteria 2500
35 Ga0070671_100002004 3300005355 Bacteria 15647
36 Ga0070671_100035299 3300005355 Bacteria 4142
37 Ga0070671_100223049 3300005355 Bacteria 1599
38 Ga0070674_100001396 3300005356 Bacteria 12780
39 Ga0070674_100005578 3300005356 Bacteria 7283
40 Ga0070674_100028357 3300005356 Bacteria 3677
41 Ga0070688_100001220 3300005365 Bacteria 12811
42 Ga0070688_100013838 3300005365 Bacteria 4563
43 Ga0070659_100001761 3300005366 Bacteria 15557
44 Ga0070659_100007902 3300005366 Bacteria 7747
45 Ga0070667_100000182 3300005367 Bacteria 75588
46 Ga0070667_100004112 3300005367 Bacteria 12317
47 Ga0070667_100024085 3300005367 Bacteria 5055
48 Ga0070667_100045692 3300005367 Bacteria 3683
49 Ga0070709_10016888 3300005434 Bacteria 4176
50 Ga0070709_10038368 3300005434 Bacteria 2933
51 Ga0070714_100188129 3300005435 Bacteria 1882
52 Ga0070713_100005790 3300005436 Bacteria 8494
53 Ga0070713_100212915 3300005436 Bacteria 1750
54 Ga0070710_10000235 3300005437 Bacteria 25937
55 Ga0070710_10000511 3300005437 Bacteria 18263
56 Ga0070710_10000625 3300005437 Bacteria 16827
57 Ga0070701_10004084 3300005438 Bacteria 5858
58 Ga0070701_10060140 3300005438 Bacteria 2000
59 Ga0070711_100000182 3300005439 Bacteria 33179
60 Ga0070711_100000720 3300005439 Bacteria 17291
61 Ga0070711_100000779 3300005439 Bacteria 16650
62 Ga0070711_100005823 3300005439 Bacteria 7400
63 Ga0070700_100007135 3300005441 Bacteria 6014
64 Ga0070700_100010725 3300005441 Bacteria 5062
65 Ga0070700_100057829 3300005441 Bacteria 2434
66 Ga0070708_100115678 3300005445 Bacteria 2469
67 Ga0070663_100000566 3300005455 Bacteria 19741
68 Ga0070663_100021600 3300005455 Bacteria 4285
69 Ga0070678_100000293 3300005456 Bacteria 23160
70 Ga0070678_100001082 3300005456 Bacteria 14263
71 Ga0070662_100003260 3300005457 Bacteria 10096
72 Ga0070662_100004369 3300005457 Bacteria 8934
73 Ga0070681_10028305 3300005458 Bacteria 5633
74 Ga0068867_100002834 3300005459 Bacteria 12189
75 Ga0068867_100009081 3300005459 Bacteria 7013
76 Ga0070685_10006466 3300005466 Bacteria 5976
77 Ga0070707_100008914 3300005468 Bacteria 9305
78 Ga0070698_100005293 3300005471 Bacteria 14121
79 Ga0070698_100043201 3300005471 Bacteria 4622
80 Ga0070698_100121750 3300005471 Bacteria 2568
81 Ga0070698_100249335 3300005471 Bacteria 1708
82 Ga0070699_100005288 3300005518 Bacteria 11325
83 Ga0070679_100187299 3300005530 Bacteria 2039
84 Ga0070684_100003542 3300005535 Bacteria 11736
85 Ga0070684_100053947 3300005535 Bacteria 3501
86 Ga0070684_100089203 3300005535 Bacteria 2740
87 Ga0070697_100377716 3300005536 Bacteria 1227
88 Ga0068853_100013771 3300005539 Bacteria 6608
89 Ga0068853_100103653 3300005539 Bacteria 2518
90 Ga0068853_100180844 3300005539 Bacteria 1912
91 Ga0068853_100247328 3300005539 Bacteria 1636
92 Ga0070672_100035258 3300005543 Bacteria 3803
93 Ga0070695_100004961 3300005545 Bacteria 7847
94 Ga0070695_100025141 3300005545 Bacteria 3675
95 Ga0070696_100006373 3300005546 Bacteria 7894
96 Ga0070696_100011371 3300005546 Bacteria 5961
97 Ga0070693_100186191 3300005547 Bacteria 1340
98 Ga0070665_100002208 3300005548 Bacteria 21719
99 Ga0070665_100006765 3300005548 Bacteria 11653
100 Ga0070665_100027121 3300005548 Bacteria 5769
101 Ga0070665_100051458 3300005548 Bacteria 4131
102 Ga0070665_100116231 3300005548 Bacteria 2678
103 Ga0070665_100224052 3300005548 Bacteria 1881
104 Ga0070704_100001023 3300005549 Bacteria 14381
105 Ga0070704_100001025 3300005549 Bacteria 14379
106 Ga0070704_100108868 3300005549 Bacteria 2104
107 Ga0068855_100007302 3300005563 Bacteria 13383
108 Ga0068855_100112846 3300005563 Bacteria 3119
109 Ga0068855_100259678 3300005563 Bacteria 1935
110 Ga0070664_100004085 3300005564 Bacteria 11727
111 Ga0068857_100004211 3300005577 Bacteria 12118
112 Ga0068857_100253202 3300005577 Bacteria 1615
113 Ga0068854_100001282 3300005578 Bacteria 15123
114 Ga0068854_100001634 3300005578 Bacteria 13644
115 Ga0068854_100012303 3300005578 Bacteria 5600
116 Ga0068854_100022125 3300005578 Bacteria 4325
117 Ga0068854_100188357 3300005578 Bacteria 1615
118 Ga0068856_100029093 3300005614 Bacteria 5397
119 Ga0068856_100119741 3300005614 Bacteria 2634
120 Ga0068856_100301600 3300005614 Bacteria 1620
121 Ga0070702_100000902 3300005615 Bacteria 11574
122 Ga0070702_100001632 3300005615 Bacteria 9286
123 Ga0070702_100008706 3300005615 Bacteria 4929
124 Ga0068852_100002700 3300005616 Bacteria 12257
125 Ga0068852_100048756 3300005616 Bacteria 3620
126 Ga0068852_100249329 3300005616 Bacteria 1700
127 Ga0068859_100000583 3300005617 Bacteria 36437
128 Ga0068859_100008871 3300005617 Bacteria 10152
129 Ga0068859_100030488 3300005617 Bacteria 5412
130 Ga0068864_100001228 3300005618 Bacteria 21306
131 Ga0068864_100030889 3300005618 Bacteria 4542
132 Ga0068866_10000145 3300005718 Bacteria 32025
133 Ga0068866_10000713 3300005718 Bacteria 15113
134 Ga0068866_10008599 3300005718 Bacteria 4310
135 Ga0068861_100000446 3300005719 Bacteria 23999
136 Ga0068861_100001091 3300005719 Bacteria 16779
137 Ga0068861_100193667 3300005719 Bacteria 1701
138 Ga0068851_10099908 3300005834 Bacteria 1538
139 Ga0068870_10001244 3300005840 Bacteria 10215
140 Ga0068863_100003806 3300005841 Bacteria 14917
141 Ga0068858_100003437 3300005842 Bacteria 15731
142 Ga0068858_100016577 3300005842 Bacteria 6921
143 Ga0068858_100017506 3300005842 Bacteria 6721
144 Ga0068858_100018489 3300005842 Bacteria 6524
145 Ga0068858_100060934 3300005842 Bacteria 3488
146 Ga0068858_100284818 3300005842 Bacteria 1574
147 Ga0068860_100000374 3300005843 Bacteria 58635
148 Ga0068860_100002734 3300005843 Bacteria 18350
149 Ga0068860_100013066 3300005843 Bacteria 8149
150 Ga0068862_100000276 3300005844 Bacteria 57404
151 Ga0068862_100001047 3300005844 Bacteria 26535
152 Ga0068862_100001732 3300005844 Bacteria 19723
153 Ga0068862_100005999 3300005844 Bacteria 10115
154 Ga0081455_10014625 3300005937 Bacteria 7678
155 Ga0081455_10103977 3300005937 Bacteria 2273
156 Ga0081538_10009757 3300005981 Bacteria 7955
157 Ga0081538_10016065 3300005981 Bacteria 5758
158 Ga0070717_10009221 3300006028 Bacteria 7416
159 Ga0070717_10020607 3300006028 Bacteria 5189
160 Ga0070717_10071840 3300006028 Bacteria 2888
161 Ga0070717_10197967 3300006028 Bacteria 1758
162 Ga0075365_10040800 3300006038 Bacteria 3028
163 Ga0075365_10102072 3300006038 Bacteria 1965
164 Ga0075368_10010263 3300006042 Bacteria 3384
165 Ga0075363_100000367 3300006048 Bacteria 13620
166 Ga0075363_100001733 3300006048 Bacteria 8484
167 Ga0075364_10001045 3300006051 Bacteria 14742
168 Ga0075364_10021644 3300006051 Bacteria 4053
169 Ga0075364_10027591 3300006051 Bacteria 3628
170 Ga0075364_10047760 3300006051 Bacteria 2789
171 Ga0070716_100000192 3300006173 Bacteria 24137
172 Ga0070716_100000340 3300006173 Bacteria 18909
173 Ga0070716_100031795 3300006173 Bacteria 2874
174 Ga0070712_100000548 3300006175 Bacteria 21728
175 Ga0070712_100000676 3300006175 Bacteria 20159
176 Ga0070712_100024543 3300006175 Bacteria 3997
177 Ga0070712_100039006 3300006175 Bacteria 3248
178 Ga0070712_100076200 3300006175 Bacteria 2414
179 Ga0075362_10009868 3300006177 Bacteria 3709
180 Ga0075367_10014909 3300006178 Bacteria 4212
181 Ga0075367_10043822 3300006178 Bacteria 2620
182 Ga0075369_10000284 3300006186 Bacteria 15139
183 Ga0097621_100014125 3300006237 Bacteria 5970
184 Ga0097621_100118258 3300006237 Bacteria 2246
185 Ga0075370_10010963 3300006353 Bacteria 4752
186 Ga0068871_100011028 3300006358 Bacteria 6623
187 Ga0075430_100007265 3300006846 Bacteria 9353
188 Ga0075431_100030529 3300006847 Bacteria 5552
189 Ga0075431_100065729 3300006847 Bacteria 3745
190 Ga0075429_100011501 3300006880 Bacteria 7673
191 Ga0068865_100000408 3300006881 Bacteria 23882
192 Ga0068865_100001202 3300006881 Bacteria 15069
193 Ga0068865_100053530 3300006881 Bacteria 2800
194 Ga0068865_100110023 3300006881 Bacteria 2031
195 Ga0097620_100000583 3300006931 Bacteria 36437
196 Ga0097620_100008871 3300006931 Bacteria 10152
197 Ga0097620_100030488 3300006931 Bacteria 5412
198 Ga0075435_100122966 3300007076 Bacteria 2167
199 Ga0105245_10001412 3300009098 Bacteria 21790
200 Ga0105245_10001413 3300009098 Bacteria 21776
201 Ga0105245_10003271 3300009098 Bacteria 14538
202 Ga0105245_10023368 3300009098 Bacteria 5425
203 Ga0105245_10162080 3300009098 Bacteria 2123
204 Ga0105247_10000181 3300009101 Bacteria 61066
205 Ga0105247_10000969 3300009101 Bacteria 21671
206 Ga0105247_10001090 3300009101 Bacteria 20246
207 Ga0105247_10011874 3300009101 Bacteria 5236
208 Ga0105247_10099043 3300009101 Bacteria 1861
209 Ga0114129_10000657 3300009147 Bacteria 43267
210 Ga0114129_10054219 3300009147 Bacteria 5622
211 Ga0105243_10002081 3300009148 Bacteria 16945
212 Ga0105243_10004082 3300009148 Bacteria 11628
213 Ga0105243_10019698 3300009148 Bacteria 5116
214 Ga0105243_10020942 3300009148 Bacteria 4962
215 Ga0105241_10031730 3300009174 Bacteria 3956
216 Ga0105242_10000452 3300009176 Bacteria 32668
217 Ga0105242_10001916 3300009176 Bacteria 16354
218 Ga0105248_10000652 3300009177 Bacteria 39387
219 Ga0105248_10002935 3300009177 Bacteria 18923
220 Ga0105248_10003236 3300009177 Bacteria 18064
221 Ga0105248_10128732 3300009177 Bacteria 2856
222 Ga0105248_10198262 3300009177 Bacteria 2262
223 Ga0105248_10198522 3300009177 Bacteria 2260
224 Ga0105237_10003090 3300009545 Bacteria 20059
225 Ga0105237_10112219 3300009545 Bacteria 2718
226 Ga0105238_10004273 3300009551 Bacteria 14196
227 Ga0105249_10000022 3300009553 Bacteria 258377
228 Ga0105249_10001553 3300009553 Bacteria 20153
229 Ga0105249_10006559 3300009553 Bacteria 10127
230 Ga0105249_10010291 3300009553 Bacteria 8215
231 Ga0105249_10020728 3300009553 Bacteria 5878
232 Ga0105249_10021384 3300009553 Bacteria 5791
233 Ga0105249_10150490 3300009553 Bacteria 2240
234 Ga0105249_10200995 3300009553 Bacteria 1950
235 Ga0105239_10001222 3300010375 Bacteria 35019
236 Ga0105239_10007225 3300010375 Bacteria 12758
237 Ga0105239_10008593 3300010375 Bacteria 11582
238 Ga0105239_10040450 3300010375 Bacteria 5108
239 Ga0105239_10457653 3300010375 Bacteria 1448
240 Ga0157369_10017331 3300013105 Bacteria 8096
241 Ga0157369_10145073 3300013105 Bacteria 2510
242 Ga0157369_10207388 3300013105 Bacteria 2055
243 Ga0157374_10053252 3300013296 Bacteria 3772
244 Ga0157378_10001002 3300013297 Bacteria 25865
245 Ga0157378_10014553 3300013297 Bacteria 6888
246 Ga0157378_10054723 3300013297 Bacteria 3553
247 Ga0163162_10043568 3300013306 Bacteria 4494
248 Ga0163162_10043597 3300013306 Bacteria 4492
249 Ga0163162_10051122 3300013306 Bacteria 4146
250 Ga0163162_10111143 3300013306 Bacteria 2838
251 Ga0163162_10191840 3300013306 Bacteria 2171
252 Ga0157372_10046874 3300013307 Bacteria 4799
253 Ga0157372_10143796 3300013307 Bacteria 2750
254 Ga0157375_10004204 3300013308 Bacteria 12496
255 Ga0157375_10007528 3300013308 Bacteria 9519
256 Ga0157375_10013266 3300013308 Bacteria 7328
257 Ga0163163_10004534 3300014325 Bacteria 11860
258 Ga0163163_10019839 3300014325 Bacteria 6323
259 Ga0163163_10046292 3300014325 Bacteria 4273
260 Ga0163163_10053687 3300014325 Bacteria 3979
261 Ga0157380_10004810 3300014326 Bacteria 9411
262 Ga0157380_10125297 3300014326 Bacteria 2182
263 Ga0157377_10002992 3300014745 Bacteria 7572
264 Ga0157377_10029974 3300014745 Bacteria 2943
265 Ga0157379_10007368 3300014968 Bacteria 9526
266 Ga0157379_10045265 3300014968 Bacteria 3928
267 Ga0157379_10107795 3300014968 Bacteria 2501
268 Ga0157379_10129102 3300014968 Bacteria 2274
269 Ga0157376_10015478 3300014969 Bacteria 5762
270 Ga0157376_10297737 3300014969 Bacteria 1526
271 Ga0163161_10000334 3300017792 Bacteria 40142
272 Ga0163161_10027878 3300017792 Bacteria 4007
273 Ga0206353_11271249 3300020082 Bacteria 6275
274 Ga0213874_10001035 3300021377 Bacteria 5682
275 Ga0213875_10016447 3300021388 Bacteria 3586
276 Ga0213875_10041361 3300021388 Bacteria 2168
277 Ga0209051_1001329 3300025303 Bacteria 21504
278 Ga0209051_1003146 3300025303 Bacteria 11092
279 Ga0207692_10000152 3300025898 Bacteria 21921
280 Ga0207692_10000462 3300025898 Bacteria 14350
281 Ga0207710_10000091 3300025900 Bacteria 121330
282 Ga0207688_10000430 3300025901 Bacteria 19798
283 Ga0207688_10000757 3300025901 Bacteria 16071
284 Ga0207688_10012870 3300025901 Bacteria 4548
285 Ga0207680_10008223 3300025903 Bacteria 5114
286 Ga0207685_10047462 3300025905 Bacteria 1639
287 Ga0207699_10003441 3300025906 Bacteria 7544
288 Ga0207645_10097051 3300025907 Bacteria 1899
289 Ga0207643_10031784 3300025908 Bacteria 2945
290 Ga0207705_10064801 3300025909 Bacteria 2641
291 Ga0207654_10101292 3300025911 Bacteria 1775
292 Ga0207707_10126115 3300025912 Bacteria 2238
293 Ga0207695_10053647 3300025913 Bacteria 4215
294 Ga0207671_10012380 3300025914 Bacteria 6862
295 Ga0207671_10171164 3300025914 Bacteria 1687
296 Ga0207693_10000354 3300025915 Bacteria 42162
297 Ga0207693_10000392 3300025915 Bacteria 40246
298 Ga0207693_10025348 3300025915 Bacteria 4702
299 Ga0207663_10083834 3300025916 Bacteria 2095
300 Ga0207663_10111700 3300025916 Bacteria 1855
301 Ga0207663_10219632 3300025916 Bacteria 1382
302 Ga0207660_10026816 3300025917 Bacteria 3927
303 Ga0207662_10158285 3300025918 Bacteria 1445
304 Ga0207657_10071277 3300025919 Bacteria 2943
305 Ga0207649_10012236 3300025920 Bacteria 4754
306 Ga0207649_10026646 3300025920 Bacteria 3384
307 Ga0207652_10159733 3300025921 Bacteria 2020
308 Ga0207646_10006640 3300025922 Bacteria 11928
309 Ga0207681_10001711 3300025923 Bacteria 14112
310 Ga0207681_10081923 3300025923 Bacteria 2280
311 Ga0207659_10082923 3300025926 Bacteria 2375
312 Ga0207687_10002409 3300025927 Bacteria 12681
313 Ga0207687_10051339 3300025927 Bacteria 2874
314 Ga0207700_10001688 3300025928 Bacteria 12531
315 Ga0207700_10063073 3300025928 Bacteria 2817
316 Ga0207700_10119630 3300025928 Bacteria 2133
317 Ga0207700_10178410 3300025928 Bacteria 1777
318 Ga0207664_10002322 3300025929 Bacteria 12570
319 Ga0207664_10007903 3300025929 Bacteria 7388
320 Ga0207664_10011346 3300025929 Bacteria 6326
321 Ga0207664_10183016 3300025929 Bacteria 1800
322 Ga0207644_10008570 3300025931 Bacteria 6690
323 Ga0207644_10032068 3300025931 Bacteria 3664
324 Ga0207644_10179050 3300025931 Bacteria 1660
325 Ga0207690_10008582 3300025932 Bacteria 6065
326 Ga0207706_10001671 3300025933 Bacteria 21918
327 Ga0207706_10019606 3300025933 Bacteria 6084
328 Ga0207706_10028065 3300025933 Bacteria 5028
329 Ga0207706_10032114 3300025933 Bacteria 4675
330 Ga0207686_10099134 3300025934 Bacteria 1942
331 Ga0207709_10018505 3300025935 Bacteria 3903
332 Ga0207709_10033455 3300025935 Bacteria 3019
333 Ga0207670_10005624 3300025936 Bacteria 6892
334 Ga0207670_10019433 3300025936 Bacteria 4150
335 Ga0207669_10000319 3300025937 Bacteria 22002
336 Ga0207704_10000426 3300025938 Bacteria 18900
337 Ga0207704_10052046 3300025938 Bacteria 2480
338 Ga0207665_10000042 3300025939 Bacteria 82783
339 Ga0207665_10000570 3300025939 Bacteria 24835
340 Ga0207665_10004901 3300025939 Bacteria 8922
341 Ga0207711_10000713 3300025941 Bacteria 32689
342 Ga0207711_10021850 3300025941 Bacteria 5345
343 Ga0207711_10031852 3300025941 Bacteria 4455
344 Ga0207689_10110898 3300025942 Bacteria 2255
345 Ga0207661_10005202 3300025944 Bacteria 9149
346 Ga0207661_10013995 3300025944 Bacteria 5867
347 Ga0207667_10039521 3300025949 Bacteria 5028
348 Ga0207667_10262965 3300025949 Bacteria 1764
349 Ga0207712_10000005 3300025961 Bacteria 608697
350 Ga0207712_10066040 3300025961 Bacteria 2585
351 Ga0207712_10075786 3300025961 Bacteria 2433
352 Ga0207668_10068793 3300025972 Bacteria 2519
353 Ga0207668_10258303 3300025972 Bacteria 1418
354 Ga0207658_10000316 3300025986 Bacteria 48662
355 Ga0207658_10101408 3300025986 Bacteria 2255
356 Ga0207677_10000864 3300026023 Bacteria 17266
357 Ga0207677_10021590 3300026023 Bacteria 3937
358 Ga0207703_10002968 3300026035 Bacteria 14374
359 Ga0207703_10075863 3300026035 Bacteria 2787
360 Ga0207703_10094069 3300026035 Bacteria 2526
361 Ga0207703_10107821 3300026035 Bacteria 2371
362 Ga0207703_10416362 3300026035 Bacteria 1249
363 Ga0207639_10016512 3300026041 Bacteria 5226
364 Ga0207678_10001855 3300026067 Bacteria 19312
365 Ga0207678_10006875 3300026067 Bacteria 10090
366 Ga0207678_10010538 3300026067 Bacteria 8118
367 Ga0207678_10052486 3300026067 Bacteria 3517
368 Ga0207708_10046031 3300026075 Bacteria 3323
369 Ga0207708_10083552 3300026075 Bacteria 2455
370 Ga0207702_10006081 3300026078 Bacteria 10470
371 Ga0207702_10141304 3300026078 Bacteria 2179
372 Ga0207702_10161885 3300026078 Bacteria 2044
373 Ga0207702_10187111 3300026078 Bacteria 1910
374 Ga0207641_10018215 3300026088 Bacteria 5756
375 Ga0207641_10066141 3300026088 Bacteria 3094
376 Ga0207641_10070710 3300026088 Bacteria 2999
377 Ga0207648_10000969 3300026089 Bacteria 32351
378 Ga0207676_10002464 3300026095 Bacteria 13207
379 Ga0207676_10022082 3300026095 Bacteria 4678
380 Ga0207676_10105842 3300026095 Bacteria 2343
381 Ga0207674_10007852 3300026116 Bacteria 12402
382 Ga0207675_100000436 3300026118 Bacteria 40555
383 Ga0207675_100043444 3300026118 Bacteria 4197
384 Ga0207675_100088075 3300026118 Bacteria 2916
385 Ga0207675_100134270 3300026118 Bacteria 2347
386 Ga0207683_10000406 3300026121 Bacteria 39673
387 Ga0207683_10018212 3300026121 Bacteria 5991
388 Ga0207683_10118443 3300026121 Bacteria 2375
389 Ga0207698_10006388 3300026142 Bacteria 7349
390 Ga0268266_10003404 3300028379 Bacteria 15924
391 Ga0268266_10004670 3300028379 Bacteria 13049
392 Ga0268266_10018891 3300028379 Bacteria 5872
393 Ga0268266_10037722 3300028379 Bacteria 4115
394 Ga0268266_10055373 3300028379 Bacteria 3409
395 Ga0268265_10000005 3300028380 Bacteria 535350
396 Ga0268264_10000005 3300028381 Bacteria 934972
397 Ga0268264_10002064 3300028381 Bacteria 17922
398 Ga0307512_10010669 3300030522 Bacteria 8742
399 Ga0307512_10035101 3300030522 Bacteria 4280
400 Ga0307513_10004357 3300031456 Bacteria 18910
401 Ga0307408_100176900 3300031548 Bacteria 1708
402 Ga0307508_10059010 3300031616 Bacteria 3394
403 Ga0307516_10014621 3300031730 Bacteria 8294
404 Ga0307516_10019203 3300031730 Bacteria 7083
405 Ga0307516_10074957 3300031730 Bacteria 3238
406 Ga0307413_10064562 3300031824 Bacteria 2276
407 Ga0307406_10018464 3300031901 Bacteria 4076
408 Ga0307416_100042142 3300032002 Bacteria 3561
409 Ga0307411_10148096 3300032005 Bacteria 1741
410 Ga0307510_10066957 3300033180 Bacteria 3622
411 Ga0373939_0005764 3300035114 Bacteria 2957
412 Ga0373943_0060923 3300035170 Bacteria 1885
413 Ga0373946_0075044 3300035171 Bacteria 1469
414 Ga0373931_0007047 3300035691 Bacteria 5287
415 Ga0373927_0003586 3300035695 Bacteria 11072
416 Ga0373933_0038403 3300035724 Bacteria 2813
417 Ga0373937_0017082 3300036401 Bacteria 6453
418 Ga0373925_0001551 3300037068 Bacteria 19545
419 Ga0395899_0024120 3300037312 Bacteria 4601
420 Ga0395899_0165506 3300037312 Bacteria 1560
421 Ga0395900_0309769 3300037418 Bacteria 1562
422 Ga0395898_0009553 3300037466 Bacteria 10188
423 Ga0395905_0079410 3300037471 Bacteria 3076
424 Ga0436364_0071837 3300037853 Bacteria 4313
425 Ga0436364_0084809 3300037853 Bacteria 8998
426 Ga0436364_1106446 3300037853 Bacteria 4979
427 Ga0436364_1184375 3300037853 Bacteria 65712
428 Ga0436364_1328102 3300037853 Bacteria 2406
429 Ga0436364_1513210 3300037853 Bacteria 3636
430 Ga0436364_1514008 3300037853 Bacteria 5601
431 Ga0395901_0171540 3300038443 Bacteria 2276
432 Ga0395901_0384663 3300038443 Bacteria 1444
433 Ga0436365_0221083 3300039437 Bacteria 43105
434 Ga0436365_0892160 3300039437 Bacteria 4857
435 Ga0436363_0357285 3300039450 Bacteria 20380
436 Ga0436362_1196443 3300039453 Bacteria 1974
437 Ga0451806_069845 3300041462 Bacteria 1912
438 Ga0466965_0013672 3300044683 Bacteria 3832
439 Ga0466965_0015960 3300044683 Bacteria 3568
440 Ga0466966_0019451 3300044684 Bacteria 4467
441 Ga0466966_0053488 3300044684 Bacteria 2561
442 Ga0466961_0006153 3300044693 Bacteria 7617
443 Ga0466961_0008524 3300044693 Bacteria 6531
444 Ga0466963_0051409 3300044694 Bacteria 2732
445 Ga0466968_0003078 3300044735 Bacteria 6158
446 Ga0466968_0023705 3300044735 Bacteria 2503
447 Ga0466957_0001382 3300044842 Bacteria 12661
448 Ga0466957_0144942 3300044842 Bacteria 1532
449 Ga0466960_0000351 3300044901 Bacteria 15754
450 Ga0466960_0000838 3300044901 Bacteria 10855
451 Ga0466960_0058166 3300044901 Bacteria 1888
452 Ga0466959_0001193 3300045049 Bacteria 15686
453 Ga0466959_0014769 3300045049 Bacteria 5684
454 Ga0466967_0017515 3300045976 Bacteria 5691
455 Ga0466967_0184615 3300045976 Bacteria 1969
456 Ga0495592_0164015 3300046454 Bacteria 1527
457 Ga0495641_0030719 3300046461 Bacteria 2573
458 Ga0495651_0002829 3300046462 Bacteria 13443
459 Ga0495653_0036380 3300046463 Bacteria 3878
460 Ga0495662_0049131 3300046476 Bacteria 2037
461 Ga0495608_0025418 3300046511 Bacteria 4042
462 Ga0495628_0083249 3300046516 Bacteria 2484
463 Ga0495631_0022773 3300046518 Bacteria 2912
464 Ga0495640_0056215 3300046533 Bacteria 2689
465 Ga0495668_0025588 3300046616 Bacteria 3353
466 Ga0495668_0062814 3300046616 Bacteria 2046
467 Ga0495668_0097972 3300046616 Bacteria 1605
468 Ga0495635_0163381 3300046663 Bacteria 1515
469 Ga0495623_0069201 3300046679 Bacteria 2200
470 Ga0495646_0019804 3300046680 Bacteria 4256
471 Ga0495600_0008063 3300046809 Bacteria 6458
472 Ga0495604_0095869 3300047317 Bacteria 2190
473 Ga0495672_0006892 3300047320 Bacteria 8666
474 Ga0495676_0040086 3300047321 Bacteria 3870
475 Ga0495680_0091055 3300047322 Bacteria 2286
476 Ga0495673_0000805 3300047469 Bacteria 29466
477 Ga0495593_0012442 3300047673 Bacteria 4864
478 Ga0495602_0027158 3300048088 Bacteria 5509
479 Ga0496100_0000142 3300048903 Bacteria 39816
480 Ga0496100_0000557 3300048903 Bacteria 17700
481 Ga0496100_0025589 3300048903 Bacteria 3611
482 Ga0496100_0047584 3300048903 Bacteria 2765
483 Ga0496101_0000075 3300048904 Bacteria 112785
484 Ga0496101_0000262 3300048904 Bacteria 37343
485 Ga0496101_0008147 3300048904 Bacteria 6841
486 Ga0496101_0067111 3300048904 Bacteria 2618
487 Ga0496102_0000003 3300048905 Bacteria 592263
488 Ga0496102_0000050 3300048905 Bacteria 179469
489 Ga0496102_0003725 3300048905 Bacteria 12884
490 Ga0496102_0004890 3300048905 Bacteria 11344
491 Ga0496102_0068865 3300048905 Bacteria 3248
492 Ga0496102_0105078 3300048905 Bacteria 2627
493 Ga0496102_0149967 3300048905 Bacteria 2190
494 Ga0496102_0351205 3300048905 Bacteria 1388
495 Ga0496103_0000014 3300048906 Bacteria 290397
496 Ga0496103_0000609 3300048906 Bacteria 27908
497 Ga0496103_0000822 3300048906 Bacteria 22777
498 Ga0496103_0063985 3300048906 Bacteria 2292
499 Ga0496103_0066922 3300048906 Bacteria 2243
500 Ga0496103_0088808 3300048906 Bacteria 1949
501 Ga0496104_0006206 3300048907 Bacteria 10501
502 Ga0496105_0005157 3300048908 Bacteria 9908
503 Ga0496105_0043386 3300048908 Bacteria 3709
504 Ga0496106_0001848 3300048909 Bacteria 15843
505 Ga0496106_0002602 3300048909 Bacteria 13433
506 Ga0496106_0008432 3300048909 Bacteria 7624
507 Ga0496106_0011473 3300048909 Bacteria 6553
508 Ga0496106_0032794 3300048909 Bacteria 3873
509 Ga0496106_0043752 3300048909 Bacteria 3361
510 Ga0496107_0000244 3300048910 Bacteria 28613
511 Ga0496107_0004976 3300048910 Bacteria 9046
512 Ga0496107_0008052 3300048910 Bacteria 7278
513 Ga0496108_0000394 3300048911 Bacteria 36076
514 Ga0496108_0005483 3300048911 Bacteria 10262
515 Ga0496108_0032823 3300048911 Bacteria 4311
516 Ga0496108_0038358 3300048911 Bacteria 3991
517 Ga0496109_0001985 3300048912 Bacteria 16959
518 Ga0496109_0023418 3300048912 Bacteria 5482
519 Ga0496109_0076265 3300048912 Bacteria 3083
520 Ga0496109_0197278 3300048912 Bacteria 1892
521 Ga0496109_0300235 3300048912 Bacteria 1514
522 Ga0496110_0017048 3300048913 Bacteria 6071
523 Ga0496110_0034403 3300048913 Bacteria 4389
524 Ga0496111_0012736 3300048914 Bacteria 5702
525 Ga0496111_0023698 3300048914 Bacteria 4311
526 Ga0496111_0023829 3300048914 Bacteria 4300
527 Ga0496111_0063746 3300048914 Bacteria 2673
528 Ga0496112_0004967 3300048915 Bacteria 11400
529 Ga0496112_0006388 3300048915 Bacteria 10346
530 Ga0496112_0096684 3300048915 Bacteria 2923
531 Ga0496113_0016291 3300048916 Bacteria 5132
532 Ga0496113_0024764 3300048916 Bacteria 4271
533 Ga0496114_0000365 3300048917 Bacteria 33197
534 Ga0496114_0005619 3300048917 Bacteria 9836
535 Ga0496114_0036653 3300048917 Bacteria 4055
536 Ga0496114_0092310 3300048917 Bacteria 2572
537 Ga0496115_0002410 3300048918 Bacteria 13422
538 Ga0496115_0003044 3300048918 Bacteria 12030
539 Ga0496115_0163566 3300048918 Bacteria 1840
540 Ga0496116_0000071 3300048919 Bacteria 244521
541 Ga0496116_0036370 3300048919 Bacteria 3446
542 Ga0496117_0000003 3300048920 Bacteria 1881097
543 Ga0496117_0006545 3300048920 Bacteria 11728
544 Ga0496117_0069166 3300048920 Bacteria 2379
545 Ga0496118_0000001 3300048921 Bacteria 1881100
546 Ga0496118_0000029 3300048921 Bacteria 340978
547 Ga0496118_0001032 3300048921 Bacteria 43337
548 Ga0496119_0000527 3300048922 Bacteria 52100
549 Ga0496119_0097251 3300048922 Bacteria 1660
550 Ga0496120_0000235 3300048923 Bacteria 94653
551 Ga0496120_0010885 3300048923 Bacteria 6294
552 Ga0496121_0000019 3300048924 Bacteria 499976
553 Ga0496121_0010829 3300048924 Bacteria 10201
554 Ga0496125_0033073 3300048928 Bacteria 4583
555 Ga0496126_0000951 3300048929 Bacteria 49637
556 Ga0496126_0006705 3300048929 Bacteria 12786
557 Ga0501032_0003076 3300049569 Bacteria 12889
558 Ga0501032_0004598 3300049569 Bacteria 10383
559 Ga0501032_0139076 3300049569 Bacteria 1599
560 Ga0501033_0130420 3300049570 Bacteria 1821
561 Ga0501034_0010184 3300049571 Bacteria 9808
562 Ga0501034_0168376 3300049571 Bacteria 2159
563 Ga0501034_0184054 3300049571 Bacteria 2053
564 Ga0501036_0003035 3300049572 Bacteria 13371
565 Ga0501036_0011187 3300049572 Bacteria 7425
566 Ga0501036_0053964 3300049572 Bacteria 3403
567 Ga0501037_0000454 3300049573 Bacteria 33411
568 Ga0501037_0068017 3300049573 Bacteria 2593
569 Ga0501038_0050466 3300049574 Bacteria 3594
570 Ga0501039_0033407 3300049575 Bacteria 3966
571 Ga0501039_0039748 3300049575 Bacteria 3632
572 Ga0501040_0003090 3300049576 Bacteria 10796
573 Ga0501041_0010180 3300049577 Bacteria 5542
574 Ga0501042_0179686 3300049578 Bacteria 1526
575 Ga0501043_0000402 3300049579 Bacteria 38918
576 Ga0501043_0009971 3300049579 Bacteria 7450
577 Ga0501046_0002180 3300049580 Bacteria 18472
578 Ga0501047_0029499 3300049581 Bacteria 5288
579 Ga0501068_0074355 3300049584 Bacteria 2077
580 Ga0501070_0024924 3300049586 Bacteria 5016
581 Ga0501070_0042662 3300049586 Bacteria 3778
582 Ga0501071_0188944 3300049587 Bacteria 1544
583 Ga0501072_0003384 3300049588 Bacteria 11997
584 Ga0501073_0022007 3300049589 Bacteria 4594
585 Ga0501073_0198611 3300049589 Bacteria 1387
586 Ga0501074_0010816 3300049590 Bacteria 6626
587 Ga0501076_0001504 3300049592 Bacteria 15617
588 Ga0501077_0002322 3300049593 Bacteria 11453
589 Ga0501079_0010148 3300049741 Bacteria 7150
590 Ga0501080_0004322 3300049742 Bacteria 12620
591 Ga0501080_0125823 3300049742 Bacteria 2374
592 Ga0501080_0239864 3300049742 Bacteria 1655
593 Ga0501083_0167018 3300049744 Bacteria 1438
594 Ga0501035_0009420 3300049822 Bacteria 9080
595 Ga0501035_0149243 3300049822 Bacteria 2029
596 Ga0501044_0001781 3300049823 Bacteria 25182
597 Ga0501044_0120116 3300049823 Bacteria 2630
598 Ga0501045_0001500 3300049824 Bacteria 15552
599 nmdc:mga03n38_83921_c1 3300050490 Bacteria 1503
600 nmdc:mga06z11_1393_c1 3300050494 Bacteria 8972
601 nmdc:mga05p37_2348_c1 3300050507 Bacteria 22012
602 nmdc:mga05p37_7245_c1 3300050507 Bacteria 13084
603 nmdc:mga09592_31_c1 3300050508 Bacteria 79922
604 nmdc:mga0qj67_43_c1 3300050509 Bacteria 88150
605 nmdc:mga06r32_162300_c1 3300050510 Bacteria 2217
606 nmdc:mga06r32_57_c2 3300050510 Bacteria 51506
607 Ga0495601_0037072 3300053077 Bacteria 3048
608 Ga0495595_0008518 3300053084 Bacteria 4213
609 Ga0495619_0032892 3300053085 Bacteria 3366
610 Ga0500643_005872 3300053087 Bacteria 5215
611 Ga0500556_0001720 3300053104 Bacteria 8290
612 Ga0500562_003126 3300053108 Bacteria 4136
613 Ga0500652_000187 3300053131 Bacteria 23997
614 Ga0500616_0011119 3300053153 Bacteria 5343
615 Ga0501084_0004362 3300054114 Bacteria 11528
616 Ga0501082_0013873 3300060353 Bacteria 6927
617 Ga0530510_0001537 3300061734 Bacteria 15565
618 2644532942 2643221696 Bacteria 5431823
619 2738869547 2738541305 Bacteria 4910150
620 2740165373 2739367898 Bacteria 4367674
621 2774852570 2773857922 Bacteria 9757215
622 2809198542 2808606439 Bacteria 5952208
623 2812330773 2811994874 Bacteria 5367947
624 2812352878 2811994878 Bacteria 5992952
625 2816507417 2816332139 Bacteria 9138787
626 2891567507 2891562705 Bacteria 8039471
627 2984577848 2984576629 Bacteria 4248407
628 2990260181 2990256926 Bacteria 4252839
629 Ga0466965_0054536
630 JGI24745J21846_1000078
631 JGI25407J50210_10002883
632 Ga0055540_1001748
633 Ga0070658_10006940
634 Ga0070658_10048174
635 Ga0070676_10011340
636 Ga0070676_10088126
637 Ga0070683_100003228
638 Ga0070683_100029777
639 Ga0070683_100131674
640 Ga0070690_100004542
641 Ga0070670_100035746
642 Ga0070670_100096926
643 Ga0068869_100008063
644 Ga0070666_10030348
645 Ga0070682_100000998
646 Ga0070682_100026032
647 Ga0070682_100046721
648 Ga0068868_100001405
649 Ga0068868_100001415
650 Ga0068868_100002096
651 Ga0070660_100060398
652 Ga0070689_100012826
653 Ga0070689_100024282
654 Ga0070691_10000993
655 Ga0070691_10019055
656 Ga0070661_100015786
657 Ga0070692_10008795
658 Ga0070692_10025837
659 Ga0070668_100005227
660 Ga0070669_100023633
661 Ga0070669_100029444
662 Ga0070675_100095177
663 Ga0070671_100002004
664 Ga0070671_100035299
665 Ga0070671_100223049
666 Ga0070674_100001396
667 Ga0070674_100005578
668 Ga0070674_100028357
669 Ga0070688_100001220
670 Ga0070688_100013838
671 Ga0070659_100001761
672 Ga0070659_100007902
673 Ga0070667_100000182
674 Ga0070667_100004112
675 Ga0070667_100024085
676 Ga0070667_100045692
677 Ga0070709_10016888
678 Ga0070709_10038368
679 Ga0070714_100188129
680 Ga0070713_100005790
681 Ga0070713_100212915
682 Ga0070710_10000235
683 Ga0070710_10000511
684 Ga0070710_10000625
685 Ga0070701_10004084
686 Ga0070701_10060140
687 Ga0070711_100000182
688 Ga0070711_100000720
689 Ga0070711_100000779
690 Ga0070711_100005823
691 Ga0070700_100007135
692 Ga0070700_100010725
693 Ga0070700_100057829
694 Ga0070708_100115678
695 Ga0070663_100000566
696 Ga0070663_100021600
697 Ga0070678_100000293
698 Ga0070678_100001082
699 Ga0070662_100003260
700 Ga0070662_100004369
701 Ga0070681_10028305
702 Ga0068867_100002834
703 Ga0068867_100009081
704 Ga0070685_10006466
705 Ga0070707_100008914
706 Ga0070698_100005293
707 Ga0070698_100043201
708 Ga0070698_100121750
709 Ga0070698_100249335
710 Ga0070699_100005288
711 Ga0070679_100187299
712 Ga0070684_100003542
713 Ga0070684_100053947
714 Ga0070684_100089203
715 Ga0070697_100377716
716 Ga0068853_100013771
717 Ga0068853_100103653
718 Ga0068853_100180844
719 Ga0068853_100247328
720 Ga0070672_100035258
721 Ga0070695_100004961
722 Ga0070695_100025141
723 Ga0070696_100006373
724 Ga0070696_100011371
725 Ga0070693_100186191
726 Ga0070665_100002208
727 Ga0070665_100006765
728 Ga0070665_100027121
729 Ga0070665_100051458
730 Ga0070665_100116231
731 Ga0070665_100224052
732 Ga0070704_100001023
733 Ga0070704_100001025
734 Ga0070704_100108868
735 Ga0068855_100007302
736 Ga0068855_100112846
737 Ga0068855_100259678
738 Ga0070664_100004085
739 Ga0068857_100004211
740 Ga0068857_100253202
741 Ga0068854_100001282
742 Ga0068854_100001634
743 Ga0068854_100012303
744 Ga0068854_100022125
745 Ga0068854_100188357
746 Ga0068856_100029093
747 Ga0068856_100119741
748 Ga0068856_100301600
749 Ga0070702_100000902
750 Ga0070702_100001632
751 Ga0070702_100008706
752 Ga0068852_100002700
753 Ga0068852_100048756
754 Ga0068852_100249329
755 Ga0068859_100000583
756 Ga0068859_100008871
757 Ga0068859_100030488
758 Ga0068864_100001228
759 Ga0068864_100030889
760 Ga0068866_10000145
761 Ga0068866_10000713
762 Ga0068866_10008599
763 Ga0068861_100000446
764 Ga0068861_100001091
765 Ga0068861_100193667
766 Ga0068851_10099908
767 Ga0068870_10001244
768 Ga0068863_100003806
769 Ga0068858_100003437
770 Ga0068858_100016577
771 Ga0068858_100017506
772 Ga0068858_100018489
773 Ga0068858_100060934
774 Ga0068858_100284818
775 Ga0068860_100000374
776 Ga0068860_100002734
777 Ga0068860_100013066
778 Ga0068862_100000276
779 Ga0068862_100001047
780 Ga0068862_100001732
781 Ga0068862_100005999
782 Ga0081455_10014625
783 Ga0081455_10103977
784 Ga0081538_10009757
785 Ga0081538_10016065
786 Ga0070717_10009221
787 Ga0070717_10020607
788 Ga0070717_10071840
789 Ga0070717_10197967
790 Ga0075365_10040800
791 Ga0075365_10102072
792 Ga0075368_10010263
793 Ga0075363_100000367
794 Ga0075363_100001733
795 Ga0075364_10001045
796 Ga0075364_10021644
797 Ga0075364_10027591
798 Ga0075364_10047760
799 Ga0070716_100000192
800 Ga0070716_100000340
801 Ga0070716_100031795
802 Ga0070712_100000548
803 Ga0070712_100000676
804 Ga0070712_100024543
805 Ga0070712_100039006
806 Ga0070712_100076200
807 Ga0075362_10009868
808 Ga0075367_10014909
809 Ga0075367_10043822
810 Ga0075369_10000284
811 Ga0097621_100014125
812 Ga0097621_100118258
813 Ga0075370_10010963
814 Ga0068871_100011028
815 Ga0075430_100007265
816 Ga0075431_100030529
817 Ga0075431_100065729
818 Ga0075429_100011501
819 Ga0068865_100000408
820 Ga0068865_100001202
821 Ga0068865_100053530
822 Ga0068865_100110023
823 Ga0097620_100000583
824 Ga0097620_100008871
825 Ga0097620_100030488
826 Ga0075435_100122966
827 Ga0105245_10001412
828 Ga0105245_10001413
829 Ga0105245_10003271
830 Ga0105245_10023368
831 Ga0105245_10162080
832 Ga0105247_10000181
833 Ga0105247_10000969
834 Ga0105247_10001090
835 Ga0105247_10011874
836 Ga0105247_10099043
837 Ga0114129_10000657
838 Ga0114129_10054219
839 Ga0105243_10002081
840 Ga0105243_10004082
841 Ga0105243_10019698
842 Ga0105243_10020942
843 Ga0105241_10031730
844 Ga0105242_10000452
845 Ga0105242_10001916
846 Ga0105248_10000652
847 Ga0105248_10002935
848 Ga0105248_10003236
849 Ga0105248_10128732
850 Ga0105248_10198262
851 Ga0105248_10198522
852 Ga0105237_10003090
853 Ga0105237_10112219
854 Ga0105238_10004273
855 Ga0105249_10000022
856 Ga0105249_10001553
857 Ga0105249_10006559
858 Ga0105249_10010291
859 Ga0105249_10020728
860 Ga0105249_10021384
861 Ga0105249_10150490
862 Ga0105249_10200995
863 Ga0105239_10001222
864 Ga0105239_10007225
865 Ga0105239_10008593
866 Ga0105239_10040450
867 Ga0105239_10457653
868 Ga0157369_10017331
869 Ga0157369_10145073
870 Ga0157369_10207388
871 Ga0157374_10053252
872 Ga0157378_10001002
873 Ga0157378_10014553
874 Ga0157378_10054723
875 Ga0163162_10043568
876 Ga0163162_10043597
877 Ga0163162_10051122
878 Ga0163162_10111143
879 Ga0163162_10191840
880 Ga0157372_10046874
881 Ga0157372_10143796
882 Ga0157375_10004204
883 Ga0157375_10007528
884 Ga0157375_10013266
885 Ga0163163_10004534
886 Ga0163163_10019839
887 Ga0163163_10046292
888 Ga0163163_10053687
889 Ga0157380_10004810
890 Ga0157380_10125297
891 Ga0157377_10002992
892 Ga0157377_10029974
893 Ga0157379_10007368
894 Ga0157379_10045265
895 Ga0157379_10107795
896 Ga0157379_10129102
897 Ga0157376_10015478
898 Ga0157376_10297737
899 Ga0163161_10000334
900 Ga0163161_10027878
901 Ga0206353_11271249
902 Ga0213874_10001035
903 Ga0213875_10016447
904 Ga0213875_10041361
905 Ga0209051_1001329
906 Ga0209051_1003146
907 Ga0207692_10000152
908 Ga0207692_10000462
909 Ga0207710_10000091
910 Ga0207688_10000430
911 Ga0207688_10000757
912 Ga0207688_10012870
913 Ga0207680_10008223
914 Ga0207685_10047462
915 Ga0207699_10003441
916 Ga0207645_10097051
917 Ga0207643_10031784
918 Ga0207705_10064801
919 Ga0207654_10101292
920 Ga0207707_10126115
921 Ga0207695_10053647
922 Ga0207671_10012380
923 Ga0207671_10171164
924 Ga0207693_10000354
925 Ga0207693_10000392
926 Ga0207693_10025348
927 Ga0207663_10083834
928 Ga0207663_10111700
929 Ga0207663_10219632
930 Ga0207660_10026816
931 Ga0207662_10158285
932 Ga0207657_10071277
933 Ga0207649_10012236
934 Ga0207649_10026646
935 Ga0207652_10159733
936 Ga0207646_10006640
937 Ga0207681_10001711
938 Ga0207681_10081923
939 Ga0207659_10082923
940 Ga0207687_10002409
941 Ga0207687_10051339
942 Ga0207700_10001688
943 Ga0207700_10063073
944 Ga0207700_10119630
945 Ga0207700_10178410
946 Ga0207664_10002322
947 Ga0207664_10007903
948 Ga0207664_10011346
949 Ga0207664_10183016
950 Ga0207644_10008570
951 Ga0207644_10032068
952 Ga0207644_10179050
953 Ga0207690_10008582
954 Ga0207706_10001671
955 Ga0207706_10019606
956 Ga0207706_10028065
957 Ga0207706_10032114
958 Ga0207686_10099134
959 Ga0207709_10018505
960 Ga0207709_10033455
961 Ga0207670_10005624
962 Ga0207670_10019433
963 Ga0207669_10000319
964 Ga0207704_10000426
965 Ga0207704_10052046
966 Ga0207665_10000042
967 Ga0207665_10000570
968 Ga0207665_10004901
969 Ga0207711_10000713
970 Ga0207711_10021850
971 Ga0207711_10031852
972 Ga0207689_10110898
973 Ga0207661_10005202
974 Ga0207661_10013995
975 Ga0207667_10039521
976 Ga0207667_10262965
977 Ga0207712_10000005
978 Ga0207712_10066040
979 Ga0207712_10075786
980 Ga0207668_10068793
981 Ga0207668_10258303
982 Ga0207658_10000316
983 Ga0207658_10101408
984 Ga0207677_10000864
985 Ga0207677_10021590
986 Ga0207703_10002968
987 Ga0207703_10075863
988 Ga0207703_10094069
989 Ga0207703_10107821
990 Ga0207703_10416362
991 Ga0207639_10016512
992 Ga0207678_10001855
993 Ga0207678_10006875
994 Ga0207678_10010538
995 Ga0207678_10052486
996 Ga0207708_10046031
997 Ga0207708_10083552
998 Ga0207702_10006081
999 Ga0207702_10141304
1000 Ga0207702_10161885
1001 Ga0207702_10187111
1002 Ga0207641_10018215
1003 Ga0207641_10066141
1004 Ga0207641_10070710
1005 Ga0207648_10000969
1006 Ga0207676_10002464
1007 Ga0207676_10022082
1008 Ga0207676_10105842
1009 Ga0207674_10007852
1010 Ga0207675_100000436
1011 Ga0207675_100043444
1012 Ga0207675_100088075
1013 Ga0207675_100134270
1014 Ga0207683_10000406
1015 Ga0207683_10018212
1016 Ga0207683_10118443
1017 Ga0207698_10006388
1018 Ga0268266_10003404
1019 Ga0268266_10004670
1020 Ga0268266_10018891
1021 Ga0268266_10037722
1022 Ga0268266_10055373
1023 Ga0268265_10000005
1024 Ga0268264_10000005
1025 Ga0268264_10002064
1026 Ga0307512_10010669
1027 Ga0307512_10035101
1028 Ga0307513_10004357
1029 Ga0307408_100176900
1030 Ga0307508_10059010
1031 Ga0307516_10014621
1032 Ga0307516_10019203
1033 Ga0307516_10074957
1034 Ga0307413_10064562
1035 Ga0307406_10018464
1036 Ga0307416_100042142
1037 Ga0307411_10148096
1038 Ga0307510_10066957
1039 Ga0373939_0005764
1040 Ga0373943_0060923
1041 Ga0373946_0075044
1042 Ga0373931_0007047
1043 Ga0373927_0003586
1044 Ga0373933_0038403
1045 Ga0373937_0017082
1046 Ga0373925_0001551
1047 Ga0395899_0024120
1048 Ga0395899_0165506
1049 Ga0395900_0309769
1050 Ga0395898_0009553
1051 Ga0395905_0079410
1052 Ga0436364_0071837
1053 Ga0436364_0084809
1054 Ga0436364_1106446
1055 Ga0436364_1184375
1056 Ga0436364_1328102
1057 Ga0436364_1513210
1058 Ga0436364_1514008
1059 Ga0395901_0171540
1060 Ga0395901_0384663
1061 Ga0436365_0221083
1062 Ga0436365_0892160
1063 Ga0436363_0357285
1064 Ga0436362_1196443
1065 Ga0451806_069845
1066 Ga0466965_0013672
1067 Ga0466965_0015960
1068 Ga0466966_0019451
1069 Ga0466966_0053488
1070 Ga0466961_0006153
1071 Ga0466961_0008524
1072 Ga0466963_0051409
1073 Ga0466968_0003078
1074 Ga0466968_0023705
1075 Ga0466957_0001382
1076 Ga0466957_0144942
1077 Ga0466960_0000351
1078 Ga0466960_0000838
1079 Ga0466960_0058166
1080 Ga0466959_0001193
1081 Ga0466959_0014769
1082 Ga0466967_0017515
1083 Ga0466967_0184615
1084 Ga0495592_0164015
1085 Ga0495641_0030719
1086 Ga0495651_0002829
1087 Ga0495653_0036380
1088 Ga0495662_0049131
1089 Ga0495608_0025418
1090 Ga0495628_0083249
1091 Ga0495631_0022773
1092 Ga0495640_0056215
1093 Ga0495668_0025588
1094 Ga0495668_0062814
1095 Ga0495668_0097972
1096 Ga0495635_0163381
1097 Ga0495623_0069201
1098 Ga0495646_0019804
1099 Ga0495600_0008063
1100 Ga0495604_0095869
1101 Ga0495672_0006892
1102 Ga0495676_0040086
1103 Ga0495680_0091055
1104 Ga0495673_0000805
1105 Ga0495593_0012442
1106 Ga0495602_0027158
1107 Ga0496100_0000142
1108 Ga0496100_0000557
1109 Ga0496100_0025589
1110 Ga0496100_0047584
1111 Ga0496101_0000075
1112 Ga0496101_0000262
1113 Ga0496101_0008147
1114 Ga0496101_0067111
1115 Ga0496102_0000003
1116 Ga0496102_0000050
1117 Ga0496102_0003725
1118 Ga0496102_0004890
1119 Ga0496102_0068865
1120 Ga0496102_0105078
1121 Ga0496102_0149967
1122 Ga0496102_0351205
1123 Ga0496103_0000014
1124 Ga0496103_0000609
1125 Ga0496103_0000822
1126 Ga0496103_0063985
1127 Ga0496103_0066922
1128 Ga0496103_0088808
1129 Ga0496104_0006206
1130 Ga0496105_0005157
1131 Ga0496105_0043386
1132 Ga0496106_0001848
1133 Ga0496106_0002602
1134 Ga0496106_0008432
1135 Ga0496106_0011473
1136 Ga0496106_0032794
1137 Ga0496106_0043752
1138 Ga0496107_0000244
1139 Ga0496107_0004976
1140 Ga0496107_0008052
1141 Ga0496108_0000394
1142 Ga0496108_0005483
1143 Ga0496108_0032823
1144 Ga0496108_0038358
1145 Ga0496109_0001985
1146 Ga0496109_0023418
1147 Ga0496109_0076265
1148 Ga0496109_0197278
1149 Ga0496109_0300235
1150 Ga0496110_0017048
1151 Ga0496110_0034403
1152 Ga0496111_0012736
1153 Ga0496111_0023698
1154 Ga0496111_0023829
1155 Ga0496111_0063746
1156 Ga0496112_0004967
1157 Ga0496112_0006388
1158 Ga0496112_0096684
1159 Ga0496113_0016291
1160 Ga0496113_0024764
1161 Ga0496114_0000365
1162 Ga0496114_0005619
1163 Ga0496114_0036653
1164 Ga0496114_0092310
1165 Ga0496115_0002410
1166 Ga0496115_0003044
1167 Ga0496115_0163566
1168 Ga0496116_0000071
1169 Ga0496116_0036370
1170 Ga0496117_0000003
1171 Ga0496117_0006545
1172 Ga0496117_0069166
1173 Ga0496118_0000001
1174 Ga0496118_0000029
1175 Ga0496118_0001032
1176 Ga0496119_0000527
1177 Ga0496119_0097251
1178 Ga0496120_0000235
1179 Ga0496120_0010885
1180 Ga0496121_0000019
1181 Ga0496121_0010829
1182 Ga0496125_0033073
1183 Ga0496126_0000951
1184 Ga0496126_0006705
1185 Ga0501032_0003076
1186 Ga0501032_0004598
1187 Ga0501032_0139076
1188 Ga0501033_0130420
1189 Ga0501034_0010184
1190 Ga0501034_0168376
1191 Ga0501034_0184054
1192 Ga0501036_0003035
1193 Ga0501036_0011187
1194 Ga0501036_0053964
1195 Ga0501037_0000454
1196 Ga0501037_0068017
1197 Ga0501038_0050466
1198 Ga0501039_0033407
1199 Ga0501039_0039748
1200 Ga0501040_0003090
1201 Ga0501041_0010180
1202 Ga0501042_0179686
1203 Ga0501043_0000402
1204 Ga0501043_0009971
1205 Ga0501046_0002180
1206 Ga0501047_0029499
1207 Ga0501068_0074355
1208 Ga0501070_0024924
1209 Ga0501070_0042662
1210 Ga0501071_0188944
1211 Ga0501072_0003384
1212 Ga0501073_0022007
1213 Ga0501073_0198611
1214 Ga0501074_0010816
1215 Ga0501076_0001504
1216 Ga0501077_0002322
1217 Ga0501079_0010148
1218 Ga0501080_0004322
1219 Ga0501080_0125823
1220 Ga0501080_0239864
1221 Ga0501083_0167018
1222 Ga0501035_0009420
1223 Ga0501035_0149243
1224 Ga0501044_0001781
1225 Ga0501044_0120116
1226 Ga0501045_0001500
1227 nmdc:mga03n38_83921_c1
1228 nmdc:mga06z11_1393_c1
1229 nmdc:mga05p37_2348_c1
1230 nmdc:mga05p37_7245_c1
1231 nmdc:mga09592_31_c1
1232 nmdc:mga0qj67_43_c1
1233 nmdc:mga06r32_162300_c1
1234 nmdc:mga06r32_57_c2
1235 Ga0495601_0037072
1236 Ga0495595_0008518
1237 Ga0495619_0032892
1238 Ga0500643_005872
1239 Ga0500556_0001720
1240 Ga0500562_003126
1241 Ga0500652_000187
1242 Ga0500616_0011119
1243 Ga0501084_0004362
1244 Ga0501082_0013873
1245 Ga0530510_0001537
1246 2644532942
1247 2738869547
1248 2740165373
1249 2774852570
1250 2809198542
1251 2812330773
1252 2812352878
1253 2816507417
1254 2891567507
1255 2984577848
1256 2990260181

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01070

FMN_dh

FMN-dependent dehydrogenase

24

400

0.94

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

276

380

0.91

PF01645

Glu_synthase

Conserved region in glutamate synthase

282

363

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cdh-assembly1.cif.gz_0 architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.952 69 364
2zfa-assembly1.cif.gz_B structure of lactate oxidase at ph4.5 from aerococcus viridans 0.929 12 387
2nli-assembly1.cif.gz_B crystal structure of the complex between l-lactate oxidase and a substrate analogue at 1.59 angstrom resolution 0.927 12 387
6a4g-assembly1.cif.gz_A mandelate oxidase mutant-y128f with the monooxide fmn adduct 0.9196 15 375
2cdh-assembly1.cif.gz_0 architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9192 69 364
ID Description Score Start End Superfamily
af_P9WND7_8_384_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9762 13 387 3.20.20.70
af_P9WND7_8_384_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9685 13 387 3.20.20.70
af_P33232_3_380_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.911 11 387 3.20.20.70
af_P33232_3_380_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9064 11 387 3.20.20.70
af_P9WND5_34_407_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8992 11 387 3.20.20.70
ID Description Score Start End GO Terms
AF-A4FCB5-F1-model_v4 L-Lactate dehydrogenase (Cytochrome) (EC 1.1.2.3) 0.9742 36 388 GO:0004460
GO:0010181
AF-A0A655NTX8-F1-model_v4 L-lactate dehydrogenase (EC 1.1.2.3) 0.9695 256 383 GO:0004459
GO:0004460
GO:0005886
GO:0009060
AF-A0A539DKW9-F1-model_v4 Glycolate oxidase 0.9692 239 385 GO:0016491
AF-A0A5C5RFD4-F1-model_v4 Alpha-hydroxy-acid oxidizing enzyme 0.9668 209 394 GO:0016491
AF-A0A3S1I2K6-F1-model_v4 L-lactate dehydrogenase 0.9662 256 380 GO:0005886
GO:0016491

Map