F470663
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 628 | 312 | 1256 | 399 |
Family's Representative Sequence
| Representative Sequence | 3300044683|Ga0466965_0054536|Ga0466965_0054536_146_1414 |
| Length | 422 |
| Sequence | MRKFENPWKQNPWFESVAVTQERARKRLPQPVYGALVAGSERGQSIADNETAFAELGLAPHVVGQPPERSQATTVFGQQIGLPVIISPTGVQAVHPDGEVAVARAAAARGTIMGLSNFASKSVEDVTATGATTFFQMYWTGDRDTMIQRMQRAHAAGVKGLIATLDWSFSMGRDWGSPEIPEKVDLKAMVRLAPKVATKGRWMWQFGKEFRATGKLPDLTAPNLAPPGGKAPTFFGAYFEWMTTPPPTWDDVAWMRETWTQISGTPFVLKGVCRIDDALRAVDAGVAGISVSNHGGNNLDGTPAAIRMVRPIAEAVDRASAGQVDVVMDGGVRRGSDVVKALAMGAKAVMIGRAYLWGLAANGQAGVENVLDVLSGGVDSALRGLAVAATADLRPDHLLVPEGFDRALGVPAAAAAPVGVGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 2 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 187 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 202 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 203 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 204 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 251 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 252 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 253 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 254 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 295 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 297 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 298 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 302 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 303 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 304 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 305 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 306 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 307 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 308 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 309 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 310 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 311 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 312 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.09 |
| Metatranscriptomes | 0.16 |
| Isolates | 1.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.32 |
| Bulb | 0 |
| Endosphere | 3.82 |
| Nodule | 0.16 |
| Rhizoplane | 9.87 |
| Rhizosphere | 78.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466965_0054536 | 3300044683 | Bacteria | 1988 |
| 2 | JGI24745J21846_1000078 | 3300002073 | Bacteria | 6918 |
| 3 | JGI25407J50210_10002883 | 3300003373 | Bacteria | 4093 |
| 4 | Ga0055540_1001748 | 3300003792 | Bacteria | 12441 |
| 5 | Ga0070658_10006940 | 3300005327 | Bacteria | 9148 |
| 6 | Ga0070658_10048174 | 3300005327 | Bacteria | 3449 |
| 7 | Ga0070676_10011340 | 3300005328 | Bacteria | 4845 |
| 8 | Ga0070676_10088126 | 3300005328 | Bacteria | 1896 |
| 9 | Ga0070683_100003228 | 3300005329 | Bacteria | 13163 |
| 10 | Ga0070683_100029777 | 3300005329 | Bacteria | 4947 |
| 11 | Ga0070683_100131674 | 3300005329 | Bacteria | 2367 |
| 12 | Ga0070690_100004542 | 3300005330 | Bacteria | 7718 |
| 13 | Ga0070670_100035746 | 3300005331 | Bacteria | 4277 |
| 14 | Ga0070670_100096926 | 3300005331 | Bacteria | 2537 |
| 15 | Ga0068869_100008063 | 3300005334 | Bacteria | 6770 |
| 16 | Ga0070666_10030348 | 3300005335 | Bacteria | 3561 |
| 17 | Ga0070682_100000998 | 3300005337 | Bacteria | 16369 |
| 18 | Ga0070682_100026032 | 3300005337 | Bacteria | 3497 |
| 19 | Ga0070682_100046721 | 3300005337 | Bacteria | 2688 |
| 20 | Ga0068868_100001405 | 3300005338 | Bacteria | 16590 |
| 21 | Ga0068868_100001415 | 3300005338 | Bacteria | 16532 |
| 22 | Ga0068868_100002096 | 3300005338 | Bacteria | 13740 |
| 23 | Ga0070660_100060398 | 3300005339 | Bacteria | 2942 |
| 24 | Ga0070689_100012826 | 3300005340 | Bacteria | 6051 |
| 25 | Ga0070689_100024282 | 3300005340 | Bacteria | 4545 |
| 26 | Ga0070691_10000993 | 3300005341 | Bacteria | 11610 |
| 27 | Ga0070691_10019055 | 3300005341 | Bacteria | 3164 |
| 28 | Ga0070661_100015786 | 3300005344 | Bacteria | 5330 |
| 29 | Ga0070692_10008795 | 3300005345 | Bacteria | 4519 |
| 30 | Ga0070692_10025837 | 3300005345 | Bacteria | 2898 |
| 31 | Ga0070668_100005227 | 3300005347 | Bacteria | 9629 |
| 32 | Ga0070669_100023633 | 3300005353 | Bacteria | 4402 |
| 33 | Ga0070669_100029444 | 3300005353 | Bacteria | 3957 |
| 34 | Ga0070675_100095177 | 3300005354 | Bacteria | 2500 |
| 35 | Ga0070671_100002004 | 3300005355 | Bacteria | 15647 |
| 36 | Ga0070671_100035299 | 3300005355 | Bacteria | 4142 |
| 37 | Ga0070671_100223049 | 3300005355 | Bacteria | 1599 |
| 38 | Ga0070674_100001396 | 3300005356 | Bacteria | 12780 |
| 39 | Ga0070674_100005578 | 3300005356 | Bacteria | 7283 |
| 40 | Ga0070674_100028357 | 3300005356 | Bacteria | 3677 |
| 41 | Ga0070688_100001220 | 3300005365 | Bacteria | 12811 |
| 42 | Ga0070688_100013838 | 3300005365 | Bacteria | 4563 |
| 43 | Ga0070659_100001761 | 3300005366 | Bacteria | 15557 |
| 44 | Ga0070659_100007902 | 3300005366 | Bacteria | 7747 |
| 45 | Ga0070667_100000182 | 3300005367 | Bacteria | 75588 |
| 46 | Ga0070667_100004112 | 3300005367 | Bacteria | 12317 |
| 47 | Ga0070667_100024085 | 3300005367 | Bacteria | 5055 |
| 48 | Ga0070667_100045692 | 3300005367 | Bacteria | 3683 |
| 49 | Ga0070709_10016888 | 3300005434 | Bacteria | 4176 |
| 50 | Ga0070709_10038368 | 3300005434 | Bacteria | 2933 |
| 51 | Ga0070714_100188129 | 3300005435 | Bacteria | 1882 |
| 52 | Ga0070713_100005790 | 3300005436 | Bacteria | 8494 |
| 53 | Ga0070713_100212915 | 3300005436 | Bacteria | 1750 |
| 54 | Ga0070710_10000235 | 3300005437 | Bacteria | 25937 |
| 55 | Ga0070710_10000511 | 3300005437 | Bacteria | 18263 |
| 56 | Ga0070710_10000625 | 3300005437 | Bacteria | 16827 |
| 57 | Ga0070701_10004084 | 3300005438 | Bacteria | 5858 |
| 58 | Ga0070701_10060140 | 3300005438 | Bacteria | 2000 |
| 59 | Ga0070711_100000182 | 3300005439 | Bacteria | 33179 |
| 60 | Ga0070711_100000720 | 3300005439 | Bacteria | 17291 |
| 61 | Ga0070711_100000779 | 3300005439 | Bacteria | 16650 |
| 62 | Ga0070711_100005823 | 3300005439 | Bacteria | 7400 |
| 63 | Ga0070700_100007135 | 3300005441 | Bacteria | 6014 |
| 64 | Ga0070700_100010725 | 3300005441 | Bacteria | 5062 |
| 65 | Ga0070700_100057829 | 3300005441 | Bacteria | 2434 |
| 66 | Ga0070708_100115678 | 3300005445 | Bacteria | 2469 |
| 67 | Ga0070663_100000566 | 3300005455 | Bacteria | 19741 |
| 68 | Ga0070663_100021600 | 3300005455 | Bacteria | 4285 |
| 69 | Ga0070678_100000293 | 3300005456 | Bacteria | 23160 |
| 70 | Ga0070678_100001082 | 3300005456 | Bacteria | 14263 |
| 71 | Ga0070662_100003260 | 3300005457 | Bacteria | 10096 |
| 72 | Ga0070662_100004369 | 3300005457 | Bacteria | 8934 |
| 73 | Ga0070681_10028305 | 3300005458 | Bacteria | 5633 |
| 74 | Ga0068867_100002834 | 3300005459 | Bacteria | 12189 |
| 75 | Ga0068867_100009081 | 3300005459 | Bacteria | 7013 |
| 76 | Ga0070685_10006466 | 3300005466 | Bacteria | 5976 |
| 77 | Ga0070707_100008914 | 3300005468 | Bacteria | 9305 |
| 78 | Ga0070698_100005293 | 3300005471 | Bacteria | 14121 |
| 79 | Ga0070698_100043201 | 3300005471 | Bacteria | 4622 |
| 80 | Ga0070698_100121750 | 3300005471 | Bacteria | 2568 |
| 81 | Ga0070698_100249335 | 3300005471 | Bacteria | 1708 |
| 82 | Ga0070699_100005288 | 3300005518 | Bacteria | 11325 |
| 83 | Ga0070679_100187299 | 3300005530 | Bacteria | 2039 |
| 84 | Ga0070684_100003542 | 3300005535 | Bacteria | 11736 |
| 85 | Ga0070684_100053947 | 3300005535 | Bacteria | 3501 |
| 86 | Ga0070684_100089203 | 3300005535 | Bacteria | 2740 |
| 87 | Ga0070697_100377716 | 3300005536 | Bacteria | 1227 |
| 88 | Ga0068853_100013771 | 3300005539 | Bacteria | 6608 |
| 89 | Ga0068853_100103653 | 3300005539 | Bacteria | 2518 |
| 90 | Ga0068853_100180844 | 3300005539 | Bacteria | 1912 |
| 91 | Ga0068853_100247328 | 3300005539 | Bacteria | 1636 |
| 92 | Ga0070672_100035258 | 3300005543 | Bacteria | 3803 |
| 93 | Ga0070695_100004961 | 3300005545 | Bacteria | 7847 |
| 94 | Ga0070695_100025141 | 3300005545 | Bacteria | 3675 |
| 95 | Ga0070696_100006373 | 3300005546 | Bacteria | 7894 |
| 96 | Ga0070696_100011371 | 3300005546 | Bacteria | 5961 |
| 97 | Ga0070693_100186191 | 3300005547 | Bacteria | 1340 |
| 98 | Ga0070665_100002208 | 3300005548 | Bacteria | 21719 |
| 99 | Ga0070665_100006765 | 3300005548 | Bacteria | 11653 |
| 100 | Ga0070665_100027121 | 3300005548 | Bacteria | 5769 |
| 101 | Ga0070665_100051458 | 3300005548 | Bacteria | 4131 |
| 102 | Ga0070665_100116231 | 3300005548 | Bacteria | 2678 |
| 103 | Ga0070665_100224052 | 3300005548 | Bacteria | 1881 |
| 104 | Ga0070704_100001023 | 3300005549 | Bacteria | 14381 |
| 105 | Ga0070704_100001025 | 3300005549 | Bacteria | 14379 |
| 106 | Ga0070704_100108868 | 3300005549 | Bacteria | 2104 |
| 107 | Ga0068855_100007302 | 3300005563 | Bacteria | 13383 |
| 108 | Ga0068855_100112846 | 3300005563 | Bacteria | 3119 |
| 109 | Ga0068855_100259678 | 3300005563 | Bacteria | 1935 |
| 110 | Ga0070664_100004085 | 3300005564 | Bacteria | 11727 |
| 111 | Ga0068857_100004211 | 3300005577 | Bacteria | 12118 |
| 112 | Ga0068857_100253202 | 3300005577 | Bacteria | 1615 |
| 113 | Ga0068854_100001282 | 3300005578 | Bacteria | 15123 |
| 114 | Ga0068854_100001634 | 3300005578 | Bacteria | 13644 |
| 115 | Ga0068854_100012303 | 3300005578 | Bacteria | 5600 |
| 116 | Ga0068854_100022125 | 3300005578 | Bacteria | 4325 |
| 117 | Ga0068854_100188357 | 3300005578 | Bacteria | 1615 |
| 118 | Ga0068856_100029093 | 3300005614 | Bacteria | 5397 |
| 119 | Ga0068856_100119741 | 3300005614 | Bacteria | 2634 |
| 120 | Ga0068856_100301600 | 3300005614 | Bacteria | 1620 |
| 121 | Ga0070702_100000902 | 3300005615 | Bacteria | 11574 |
| 122 | Ga0070702_100001632 | 3300005615 | Bacteria | 9286 |
| 123 | Ga0070702_100008706 | 3300005615 | Bacteria | 4929 |
| 124 | Ga0068852_100002700 | 3300005616 | Bacteria | 12257 |
| 125 | Ga0068852_100048756 | 3300005616 | Bacteria | 3620 |
| 126 | Ga0068852_100249329 | 3300005616 | Bacteria | 1700 |
| 127 | Ga0068859_100000583 | 3300005617 | Bacteria | 36437 |
| 128 | Ga0068859_100008871 | 3300005617 | Bacteria | 10152 |
| 129 | Ga0068859_100030488 | 3300005617 | Bacteria | 5412 |
| 130 | Ga0068864_100001228 | 3300005618 | Bacteria | 21306 |
| 131 | Ga0068864_100030889 | 3300005618 | Bacteria | 4542 |
| 132 | Ga0068866_10000145 | 3300005718 | Bacteria | 32025 |
| 133 | Ga0068866_10000713 | 3300005718 | Bacteria | 15113 |
| 134 | Ga0068866_10008599 | 3300005718 | Bacteria | 4310 |
| 135 | Ga0068861_100000446 | 3300005719 | Bacteria | 23999 |
| 136 | Ga0068861_100001091 | 3300005719 | Bacteria | 16779 |
| 137 | Ga0068861_100193667 | 3300005719 | Bacteria | 1701 |
| 138 | Ga0068851_10099908 | 3300005834 | Bacteria | 1538 |
| 139 | Ga0068870_10001244 | 3300005840 | Bacteria | 10215 |
| 140 | Ga0068863_100003806 | 3300005841 | Bacteria | 14917 |
| 141 | Ga0068858_100003437 | 3300005842 | Bacteria | 15731 |
| 142 | Ga0068858_100016577 | 3300005842 | Bacteria | 6921 |
| 143 | Ga0068858_100017506 | 3300005842 | Bacteria | 6721 |
| 144 | Ga0068858_100018489 | 3300005842 | Bacteria | 6524 |
| 145 | Ga0068858_100060934 | 3300005842 | Bacteria | 3488 |
| 146 | Ga0068858_100284818 | 3300005842 | Bacteria | 1574 |
| 147 | Ga0068860_100000374 | 3300005843 | Bacteria | 58635 |
| 148 | Ga0068860_100002734 | 3300005843 | Bacteria | 18350 |
| 149 | Ga0068860_100013066 | 3300005843 | Bacteria | 8149 |
| 150 | Ga0068862_100000276 | 3300005844 | Bacteria | 57404 |
| 151 | Ga0068862_100001047 | 3300005844 | Bacteria | 26535 |
| 152 | Ga0068862_100001732 | 3300005844 | Bacteria | 19723 |
| 153 | Ga0068862_100005999 | 3300005844 | Bacteria | 10115 |
| 154 | Ga0081455_10014625 | 3300005937 | Bacteria | 7678 |
| 155 | Ga0081455_10103977 | 3300005937 | Bacteria | 2273 |
| 156 | Ga0081538_10009757 | 3300005981 | Bacteria | 7955 |
| 157 | Ga0081538_10016065 | 3300005981 | Bacteria | 5758 |
| 158 | Ga0070717_10009221 | 3300006028 | Bacteria | 7416 |
| 159 | Ga0070717_10020607 | 3300006028 | Bacteria | 5189 |
| 160 | Ga0070717_10071840 | 3300006028 | Bacteria | 2888 |
| 161 | Ga0070717_10197967 | 3300006028 | Bacteria | 1758 |
| 162 | Ga0075365_10040800 | 3300006038 | Bacteria | 3028 |
| 163 | Ga0075365_10102072 | 3300006038 | Bacteria | 1965 |
| 164 | Ga0075368_10010263 | 3300006042 | Bacteria | 3384 |
| 165 | Ga0075363_100000367 | 3300006048 | Bacteria | 13620 |
| 166 | Ga0075363_100001733 | 3300006048 | Bacteria | 8484 |
| 167 | Ga0075364_10001045 | 3300006051 | Bacteria | 14742 |
| 168 | Ga0075364_10021644 | 3300006051 | Bacteria | 4053 |
| 169 | Ga0075364_10027591 | 3300006051 | Bacteria | 3628 |
| 170 | Ga0075364_10047760 | 3300006051 | Bacteria | 2789 |
| 171 | Ga0070716_100000192 | 3300006173 | Bacteria | 24137 |
| 172 | Ga0070716_100000340 | 3300006173 | Bacteria | 18909 |
| 173 | Ga0070716_100031795 | 3300006173 | Bacteria | 2874 |
| 174 | Ga0070712_100000548 | 3300006175 | Bacteria | 21728 |
| 175 | Ga0070712_100000676 | 3300006175 | Bacteria | 20159 |
| 176 | Ga0070712_100024543 | 3300006175 | Bacteria | 3997 |
| 177 | Ga0070712_100039006 | 3300006175 | Bacteria | 3248 |
| 178 | Ga0070712_100076200 | 3300006175 | Bacteria | 2414 |
| 179 | Ga0075362_10009868 | 3300006177 | Bacteria | 3709 |
| 180 | Ga0075367_10014909 | 3300006178 | Bacteria | 4212 |
| 181 | Ga0075367_10043822 | 3300006178 | Bacteria | 2620 |
| 182 | Ga0075369_10000284 | 3300006186 | Bacteria | 15139 |
| 183 | Ga0097621_100014125 | 3300006237 | Bacteria | 5970 |
| 184 | Ga0097621_100118258 | 3300006237 | Bacteria | 2246 |
| 185 | Ga0075370_10010963 | 3300006353 | Bacteria | 4752 |
| 186 | Ga0068871_100011028 | 3300006358 | Bacteria | 6623 |
| 187 | Ga0075430_100007265 | 3300006846 | Bacteria | 9353 |
| 188 | Ga0075431_100030529 | 3300006847 | Bacteria | 5552 |
| 189 | Ga0075431_100065729 | 3300006847 | Bacteria | 3745 |
| 190 | Ga0075429_100011501 | 3300006880 | Bacteria | 7673 |
| 191 | Ga0068865_100000408 | 3300006881 | Bacteria | 23882 |
| 192 | Ga0068865_100001202 | 3300006881 | Bacteria | 15069 |
| 193 | Ga0068865_100053530 | 3300006881 | Bacteria | 2800 |
| 194 | Ga0068865_100110023 | 3300006881 | Bacteria | 2031 |
| 195 | Ga0097620_100000583 | 3300006931 | Bacteria | 36437 |
| 196 | Ga0097620_100008871 | 3300006931 | Bacteria | 10152 |
| 197 | Ga0097620_100030488 | 3300006931 | Bacteria | 5412 |
| 198 | Ga0075435_100122966 | 3300007076 | Bacteria | 2167 |
| 199 | Ga0105245_10001412 | 3300009098 | Bacteria | 21790 |
| 200 | Ga0105245_10001413 | 3300009098 | Bacteria | 21776 |
| 201 | Ga0105245_10003271 | 3300009098 | Bacteria | 14538 |
| 202 | Ga0105245_10023368 | 3300009098 | Bacteria | 5425 |
| 203 | Ga0105245_10162080 | 3300009098 | Bacteria | 2123 |
| 204 | Ga0105247_10000181 | 3300009101 | Bacteria | 61066 |
| 205 | Ga0105247_10000969 | 3300009101 | Bacteria | 21671 |
| 206 | Ga0105247_10001090 | 3300009101 | Bacteria | 20246 |
| 207 | Ga0105247_10011874 | 3300009101 | Bacteria | 5236 |
| 208 | Ga0105247_10099043 | 3300009101 | Bacteria | 1861 |
| 209 | Ga0114129_10000657 | 3300009147 | Bacteria | 43267 |
| 210 | Ga0114129_10054219 | 3300009147 | Bacteria | 5622 |
| 211 | Ga0105243_10002081 | 3300009148 | Bacteria | 16945 |
| 212 | Ga0105243_10004082 | 3300009148 | Bacteria | 11628 |
| 213 | Ga0105243_10019698 | 3300009148 | Bacteria | 5116 |
| 214 | Ga0105243_10020942 | 3300009148 | Bacteria | 4962 |
| 215 | Ga0105241_10031730 | 3300009174 | Bacteria | 3956 |
| 216 | Ga0105242_10000452 | 3300009176 | Bacteria | 32668 |
| 217 | Ga0105242_10001916 | 3300009176 | Bacteria | 16354 |
| 218 | Ga0105248_10000652 | 3300009177 | Bacteria | 39387 |
| 219 | Ga0105248_10002935 | 3300009177 | Bacteria | 18923 |
| 220 | Ga0105248_10003236 | 3300009177 | Bacteria | 18064 |
| 221 | Ga0105248_10128732 | 3300009177 | Bacteria | 2856 |
| 222 | Ga0105248_10198262 | 3300009177 | Bacteria | 2262 |
| 223 | Ga0105248_10198522 | 3300009177 | Bacteria | 2260 |
| 224 | Ga0105237_10003090 | 3300009545 | Bacteria | 20059 |
| 225 | Ga0105237_10112219 | 3300009545 | Bacteria | 2718 |
| 226 | Ga0105238_10004273 | 3300009551 | Bacteria | 14196 |
| 227 | Ga0105249_10000022 | 3300009553 | Bacteria | 258377 |
| 228 | Ga0105249_10001553 | 3300009553 | Bacteria | 20153 |
| 229 | Ga0105249_10006559 | 3300009553 | Bacteria | 10127 |
| 230 | Ga0105249_10010291 | 3300009553 | Bacteria | 8215 |
| 231 | Ga0105249_10020728 | 3300009553 | Bacteria | 5878 |
| 232 | Ga0105249_10021384 | 3300009553 | Bacteria | 5791 |
| 233 | Ga0105249_10150490 | 3300009553 | Bacteria | 2240 |
| 234 | Ga0105249_10200995 | 3300009553 | Bacteria | 1950 |
| 235 | Ga0105239_10001222 | 3300010375 | Bacteria | 35019 |
| 236 | Ga0105239_10007225 | 3300010375 | Bacteria | 12758 |
| 237 | Ga0105239_10008593 | 3300010375 | Bacteria | 11582 |
| 238 | Ga0105239_10040450 | 3300010375 | Bacteria | 5108 |
| 239 | Ga0105239_10457653 | 3300010375 | Bacteria | 1448 |
| 240 | Ga0157369_10017331 | 3300013105 | Bacteria | 8096 |
| 241 | Ga0157369_10145073 | 3300013105 | Bacteria | 2510 |
| 242 | Ga0157369_10207388 | 3300013105 | Bacteria | 2055 |
| 243 | Ga0157374_10053252 | 3300013296 | Bacteria | 3772 |
| 244 | Ga0157378_10001002 | 3300013297 | Bacteria | 25865 |
| 245 | Ga0157378_10014553 | 3300013297 | Bacteria | 6888 |
| 246 | Ga0157378_10054723 | 3300013297 | Bacteria | 3553 |
| 247 | Ga0163162_10043568 | 3300013306 | Bacteria | 4494 |
| 248 | Ga0163162_10043597 | 3300013306 | Bacteria | 4492 |
| 249 | Ga0163162_10051122 | 3300013306 | Bacteria | 4146 |
| 250 | Ga0163162_10111143 | 3300013306 | Bacteria | 2838 |
| 251 | Ga0163162_10191840 | 3300013306 | Bacteria | 2171 |
| 252 | Ga0157372_10046874 | 3300013307 | Bacteria | 4799 |
| 253 | Ga0157372_10143796 | 3300013307 | Bacteria | 2750 |
| 254 | Ga0157375_10004204 | 3300013308 | Bacteria | 12496 |
| 255 | Ga0157375_10007528 | 3300013308 | Bacteria | 9519 |
| 256 | Ga0157375_10013266 | 3300013308 | Bacteria | 7328 |
| 257 | Ga0163163_10004534 | 3300014325 | Bacteria | 11860 |
| 258 | Ga0163163_10019839 | 3300014325 | Bacteria | 6323 |
| 259 | Ga0163163_10046292 | 3300014325 | Bacteria | 4273 |
| 260 | Ga0163163_10053687 | 3300014325 | Bacteria | 3979 |
| 261 | Ga0157380_10004810 | 3300014326 | Bacteria | 9411 |
| 262 | Ga0157380_10125297 | 3300014326 | Bacteria | 2182 |
| 263 | Ga0157377_10002992 | 3300014745 | Bacteria | 7572 |
| 264 | Ga0157377_10029974 | 3300014745 | Bacteria | 2943 |
| 265 | Ga0157379_10007368 | 3300014968 | Bacteria | 9526 |
| 266 | Ga0157379_10045265 | 3300014968 | Bacteria | 3928 |
| 267 | Ga0157379_10107795 | 3300014968 | Bacteria | 2501 |
| 268 | Ga0157379_10129102 | 3300014968 | Bacteria | 2274 |
| 269 | Ga0157376_10015478 | 3300014969 | Bacteria | 5762 |
| 270 | Ga0157376_10297737 | 3300014969 | Bacteria | 1526 |
| 271 | Ga0163161_10000334 | 3300017792 | Bacteria | 40142 |
| 272 | Ga0163161_10027878 | 3300017792 | Bacteria | 4007 |
| 273 | Ga0206353_11271249 | 3300020082 | Bacteria | 6275 |
| 274 | Ga0213874_10001035 | 3300021377 | Bacteria | 5682 |
| 275 | Ga0213875_10016447 | 3300021388 | Bacteria | 3586 |
| 276 | Ga0213875_10041361 | 3300021388 | Bacteria | 2168 |
| 277 | Ga0209051_1001329 | 3300025303 | Bacteria | 21504 |
| 278 | Ga0209051_1003146 | 3300025303 | Bacteria | 11092 |
| 279 | Ga0207692_10000152 | 3300025898 | Bacteria | 21921 |
| 280 | Ga0207692_10000462 | 3300025898 | Bacteria | 14350 |
| 281 | Ga0207710_10000091 | 3300025900 | Bacteria | 121330 |
| 282 | Ga0207688_10000430 | 3300025901 | Bacteria | 19798 |
| 283 | Ga0207688_10000757 | 3300025901 | Bacteria | 16071 |
| 284 | Ga0207688_10012870 | 3300025901 | Bacteria | 4548 |
| 285 | Ga0207680_10008223 | 3300025903 | Bacteria | 5114 |
| 286 | Ga0207685_10047462 | 3300025905 | Bacteria | 1639 |
| 287 | Ga0207699_10003441 | 3300025906 | Bacteria | 7544 |
| 288 | Ga0207645_10097051 | 3300025907 | Bacteria | 1899 |
| 289 | Ga0207643_10031784 | 3300025908 | Bacteria | 2945 |
| 290 | Ga0207705_10064801 | 3300025909 | Bacteria | 2641 |
| 291 | Ga0207654_10101292 | 3300025911 | Bacteria | 1775 |
| 292 | Ga0207707_10126115 | 3300025912 | Bacteria | 2238 |
| 293 | Ga0207695_10053647 | 3300025913 | Bacteria | 4215 |
| 294 | Ga0207671_10012380 | 3300025914 | Bacteria | 6862 |
| 295 | Ga0207671_10171164 | 3300025914 | Bacteria | 1687 |
| 296 | Ga0207693_10000354 | 3300025915 | Bacteria | 42162 |
| 297 | Ga0207693_10000392 | 3300025915 | Bacteria | 40246 |
| 298 | Ga0207693_10025348 | 3300025915 | Bacteria | 4702 |
| 299 | Ga0207663_10083834 | 3300025916 | Bacteria | 2095 |
| 300 | Ga0207663_10111700 | 3300025916 | Bacteria | 1855 |
| 301 | Ga0207663_10219632 | 3300025916 | Bacteria | 1382 |
| 302 | Ga0207660_10026816 | 3300025917 | Bacteria | 3927 |
| 303 | Ga0207662_10158285 | 3300025918 | Bacteria | 1445 |
| 304 | Ga0207657_10071277 | 3300025919 | Bacteria | 2943 |
| 305 | Ga0207649_10012236 | 3300025920 | Bacteria | 4754 |
| 306 | Ga0207649_10026646 | 3300025920 | Bacteria | 3384 |
| 307 | Ga0207652_10159733 | 3300025921 | Bacteria | 2020 |
| 308 | Ga0207646_10006640 | 3300025922 | Bacteria | 11928 |
| 309 | Ga0207681_10001711 | 3300025923 | Bacteria | 14112 |
| 310 | Ga0207681_10081923 | 3300025923 | Bacteria | 2280 |
| 311 | Ga0207659_10082923 | 3300025926 | Bacteria | 2375 |
| 312 | Ga0207687_10002409 | 3300025927 | Bacteria | 12681 |
| 313 | Ga0207687_10051339 | 3300025927 | Bacteria | 2874 |
| 314 | Ga0207700_10001688 | 3300025928 | Bacteria | 12531 |
| 315 | Ga0207700_10063073 | 3300025928 | Bacteria | 2817 |
| 316 | Ga0207700_10119630 | 3300025928 | Bacteria | 2133 |
| 317 | Ga0207700_10178410 | 3300025928 | Bacteria | 1777 |
| 318 | Ga0207664_10002322 | 3300025929 | Bacteria | 12570 |
| 319 | Ga0207664_10007903 | 3300025929 | Bacteria | 7388 |
| 320 | Ga0207664_10011346 | 3300025929 | Bacteria | 6326 |
| 321 | Ga0207664_10183016 | 3300025929 | Bacteria | 1800 |
| 322 | Ga0207644_10008570 | 3300025931 | Bacteria | 6690 |
| 323 | Ga0207644_10032068 | 3300025931 | Bacteria | 3664 |
| 324 | Ga0207644_10179050 | 3300025931 | Bacteria | 1660 |
| 325 | Ga0207690_10008582 | 3300025932 | Bacteria | 6065 |
| 326 | Ga0207706_10001671 | 3300025933 | Bacteria | 21918 |
| 327 | Ga0207706_10019606 | 3300025933 | Bacteria | 6084 |
| 328 | Ga0207706_10028065 | 3300025933 | Bacteria | 5028 |
| 329 | Ga0207706_10032114 | 3300025933 | Bacteria | 4675 |
| 330 | Ga0207686_10099134 | 3300025934 | Bacteria | 1942 |
| 331 | Ga0207709_10018505 | 3300025935 | Bacteria | 3903 |
| 332 | Ga0207709_10033455 | 3300025935 | Bacteria | 3019 |
| 333 | Ga0207670_10005624 | 3300025936 | Bacteria | 6892 |
| 334 | Ga0207670_10019433 | 3300025936 | Bacteria | 4150 |
| 335 | Ga0207669_10000319 | 3300025937 | Bacteria | 22002 |
| 336 | Ga0207704_10000426 | 3300025938 | Bacteria | 18900 |
| 337 | Ga0207704_10052046 | 3300025938 | Bacteria | 2480 |
| 338 | Ga0207665_10000042 | 3300025939 | Bacteria | 82783 |
| 339 | Ga0207665_10000570 | 3300025939 | Bacteria | 24835 |
| 340 | Ga0207665_10004901 | 3300025939 | Bacteria | 8922 |
| 341 | Ga0207711_10000713 | 3300025941 | Bacteria | 32689 |
| 342 | Ga0207711_10021850 | 3300025941 | Bacteria | 5345 |
| 343 | Ga0207711_10031852 | 3300025941 | Bacteria | 4455 |
| 344 | Ga0207689_10110898 | 3300025942 | Bacteria | 2255 |
| 345 | Ga0207661_10005202 | 3300025944 | Bacteria | 9149 |
| 346 | Ga0207661_10013995 | 3300025944 | Bacteria | 5867 |
| 347 | Ga0207667_10039521 | 3300025949 | Bacteria | 5028 |
| 348 | Ga0207667_10262965 | 3300025949 | Bacteria | 1764 |
| 349 | Ga0207712_10000005 | 3300025961 | Bacteria | 608697 |
| 350 | Ga0207712_10066040 | 3300025961 | Bacteria | 2585 |
| 351 | Ga0207712_10075786 | 3300025961 | Bacteria | 2433 |
| 352 | Ga0207668_10068793 | 3300025972 | Bacteria | 2519 |
| 353 | Ga0207668_10258303 | 3300025972 | Bacteria | 1418 |
| 354 | Ga0207658_10000316 | 3300025986 | Bacteria | 48662 |
| 355 | Ga0207658_10101408 | 3300025986 | Bacteria | 2255 |
| 356 | Ga0207677_10000864 | 3300026023 | Bacteria | 17266 |
| 357 | Ga0207677_10021590 | 3300026023 | Bacteria | 3937 |
| 358 | Ga0207703_10002968 | 3300026035 | Bacteria | 14374 |
| 359 | Ga0207703_10075863 | 3300026035 | Bacteria | 2787 |
| 360 | Ga0207703_10094069 | 3300026035 | Bacteria | 2526 |
| 361 | Ga0207703_10107821 | 3300026035 | Bacteria | 2371 |
| 362 | Ga0207703_10416362 | 3300026035 | Bacteria | 1249 |
| 363 | Ga0207639_10016512 | 3300026041 | Bacteria | 5226 |
| 364 | Ga0207678_10001855 | 3300026067 | Bacteria | 19312 |
| 365 | Ga0207678_10006875 | 3300026067 | Bacteria | 10090 |
| 366 | Ga0207678_10010538 | 3300026067 | Bacteria | 8118 |
| 367 | Ga0207678_10052486 | 3300026067 | Bacteria | 3517 |
| 368 | Ga0207708_10046031 | 3300026075 | Bacteria | 3323 |
| 369 | Ga0207708_10083552 | 3300026075 | Bacteria | 2455 |
| 370 | Ga0207702_10006081 | 3300026078 | Bacteria | 10470 |
| 371 | Ga0207702_10141304 | 3300026078 | Bacteria | 2179 |
| 372 | Ga0207702_10161885 | 3300026078 | Bacteria | 2044 |
| 373 | Ga0207702_10187111 | 3300026078 | Bacteria | 1910 |
| 374 | Ga0207641_10018215 | 3300026088 | Bacteria | 5756 |
| 375 | Ga0207641_10066141 | 3300026088 | Bacteria | 3094 |
| 376 | Ga0207641_10070710 | 3300026088 | Bacteria | 2999 |
| 377 | Ga0207648_10000969 | 3300026089 | Bacteria | 32351 |
| 378 | Ga0207676_10002464 | 3300026095 | Bacteria | 13207 |
| 379 | Ga0207676_10022082 | 3300026095 | Bacteria | 4678 |
| 380 | Ga0207676_10105842 | 3300026095 | Bacteria | 2343 |
| 381 | Ga0207674_10007852 | 3300026116 | Bacteria | 12402 |
| 382 | Ga0207675_100000436 | 3300026118 | Bacteria | 40555 |
| 383 | Ga0207675_100043444 | 3300026118 | Bacteria | 4197 |
| 384 | Ga0207675_100088075 | 3300026118 | Bacteria | 2916 |
| 385 | Ga0207675_100134270 | 3300026118 | Bacteria | 2347 |
| 386 | Ga0207683_10000406 | 3300026121 | Bacteria | 39673 |
| 387 | Ga0207683_10018212 | 3300026121 | Bacteria | 5991 |
| 388 | Ga0207683_10118443 | 3300026121 | Bacteria | 2375 |
| 389 | Ga0207698_10006388 | 3300026142 | Bacteria | 7349 |
| 390 | Ga0268266_10003404 | 3300028379 | Bacteria | 15924 |
| 391 | Ga0268266_10004670 | 3300028379 | Bacteria | 13049 |
| 392 | Ga0268266_10018891 | 3300028379 | Bacteria | 5872 |
| 393 | Ga0268266_10037722 | 3300028379 | Bacteria | 4115 |
| 394 | Ga0268266_10055373 | 3300028379 | Bacteria | 3409 |
| 395 | Ga0268265_10000005 | 3300028380 | Bacteria | 535350 |
| 396 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 397 | Ga0268264_10002064 | 3300028381 | Bacteria | 17922 |
| 398 | Ga0307512_10010669 | 3300030522 | Bacteria | 8742 |
| 399 | Ga0307512_10035101 | 3300030522 | Bacteria | 4280 |
| 400 | Ga0307513_10004357 | 3300031456 | Bacteria | 18910 |
| 401 | Ga0307408_100176900 | 3300031548 | Bacteria | 1708 |
| 402 | Ga0307508_10059010 | 3300031616 | Bacteria | 3394 |
| 403 | Ga0307516_10014621 | 3300031730 | Bacteria | 8294 |
| 404 | Ga0307516_10019203 | 3300031730 | Bacteria | 7083 |
| 405 | Ga0307516_10074957 | 3300031730 | Bacteria | 3238 |
| 406 | Ga0307413_10064562 | 3300031824 | Bacteria | 2276 |
| 407 | Ga0307406_10018464 | 3300031901 | Bacteria | 4076 |
| 408 | Ga0307416_100042142 | 3300032002 | Bacteria | 3561 |
| 409 | Ga0307411_10148096 | 3300032005 | Bacteria | 1741 |
| 410 | Ga0307510_10066957 | 3300033180 | Bacteria | 3622 |
| 411 | Ga0373939_0005764 | 3300035114 | Bacteria | 2957 |
| 412 | Ga0373943_0060923 | 3300035170 | Bacteria | 1885 |
| 413 | Ga0373946_0075044 | 3300035171 | Bacteria | 1469 |
| 414 | Ga0373931_0007047 | 3300035691 | Bacteria | 5287 |
| 415 | Ga0373927_0003586 | 3300035695 | Bacteria | 11072 |
| 416 | Ga0373933_0038403 | 3300035724 | Bacteria | 2813 |
| 417 | Ga0373937_0017082 | 3300036401 | Bacteria | 6453 |
| 418 | Ga0373925_0001551 | 3300037068 | Bacteria | 19545 |
| 419 | Ga0395899_0024120 | 3300037312 | Bacteria | 4601 |
| 420 | Ga0395899_0165506 | 3300037312 | Bacteria | 1560 |
| 421 | Ga0395900_0309769 | 3300037418 | Bacteria | 1562 |
| 422 | Ga0395898_0009553 | 3300037466 | Bacteria | 10188 |
| 423 | Ga0395905_0079410 | 3300037471 | Bacteria | 3076 |
| 424 | Ga0436364_0071837 | 3300037853 | Bacteria | 4313 |
| 425 | Ga0436364_0084809 | 3300037853 | Bacteria | 8998 |
| 426 | Ga0436364_1106446 | 3300037853 | Bacteria | 4979 |
| 427 | Ga0436364_1184375 | 3300037853 | Bacteria | 65712 |
| 428 | Ga0436364_1328102 | 3300037853 | Bacteria | 2406 |
| 429 | Ga0436364_1513210 | 3300037853 | Bacteria | 3636 |
| 430 | Ga0436364_1514008 | 3300037853 | Bacteria | 5601 |
| 431 | Ga0395901_0171540 | 3300038443 | Bacteria | 2276 |
| 432 | Ga0395901_0384663 | 3300038443 | Bacteria | 1444 |
| 433 | Ga0436365_0221083 | 3300039437 | Bacteria | 43105 |
| 434 | Ga0436365_0892160 | 3300039437 | Bacteria | 4857 |
| 435 | Ga0436363_0357285 | 3300039450 | Bacteria | 20380 |
| 436 | Ga0436362_1196443 | 3300039453 | Bacteria | 1974 |
| 437 | Ga0451806_069845 | 3300041462 | Bacteria | 1912 |
| 438 | Ga0466965_0013672 | 3300044683 | Bacteria | 3832 |
| 439 | Ga0466965_0015960 | 3300044683 | Bacteria | 3568 |
| 440 | Ga0466966_0019451 | 3300044684 | Bacteria | 4467 |
| 441 | Ga0466966_0053488 | 3300044684 | Bacteria | 2561 |
| 442 | Ga0466961_0006153 | 3300044693 | Bacteria | 7617 |
| 443 | Ga0466961_0008524 | 3300044693 | Bacteria | 6531 |
| 444 | Ga0466963_0051409 | 3300044694 | Bacteria | 2732 |
| 445 | Ga0466968_0003078 | 3300044735 | Bacteria | 6158 |
| 446 | Ga0466968_0023705 | 3300044735 | Bacteria | 2503 |
| 447 | Ga0466957_0001382 | 3300044842 | Bacteria | 12661 |
| 448 | Ga0466957_0144942 | 3300044842 | Bacteria | 1532 |
| 449 | Ga0466960_0000351 | 3300044901 | Bacteria | 15754 |
| 450 | Ga0466960_0000838 | 3300044901 | Bacteria | 10855 |
| 451 | Ga0466960_0058166 | 3300044901 | Bacteria | 1888 |
| 452 | Ga0466959_0001193 | 3300045049 | Bacteria | 15686 |
| 453 | Ga0466959_0014769 | 3300045049 | Bacteria | 5684 |
| 454 | Ga0466967_0017515 | 3300045976 | Bacteria | 5691 |
| 455 | Ga0466967_0184615 | 3300045976 | Bacteria | 1969 |
| 456 | Ga0495592_0164015 | 3300046454 | Bacteria | 1527 |
| 457 | Ga0495641_0030719 | 3300046461 | Bacteria | 2573 |
| 458 | Ga0495651_0002829 | 3300046462 | Bacteria | 13443 |
| 459 | Ga0495653_0036380 | 3300046463 | Bacteria | 3878 |
| 460 | Ga0495662_0049131 | 3300046476 | Bacteria | 2037 |
| 461 | Ga0495608_0025418 | 3300046511 | Bacteria | 4042 |
| 462 | Ga0495628_0083249 | 3300046516 | Bacteria | 2484 |
| 463 | Ga0495631_0022773 | 3300046518 | Bacteria | 2912 |
| 464 | Ga0495640_0056215 | 3300046533 | Bacteria | 2689 |
| 465 | Ga0495668_0025588 | 3300046616 | Bacteria | 3353 |
| 466 | Ga0495668_0062814 | 3300046616 | Bacteria | 2046 |
| 467 | Ga0495668_0097972 | 3300046616 | Bacteria | 1605 |
| 468 | Ga0495635_0163381 | 3300046663 | Bacteria | 1515 |
| 469 | Ga0495623_0069201 | 3300046679 | Bacteria | 2200 |
| 470 | Ga0495646_0019804 | 3300046680 | Bacteria | 4256 |
| 471 | Ga0495600_0008063 | 3300046809 | Bacteria | 6458 |
| 472 | Ga0495604_0095869 | 3300047317 | Bacteria | 2190 |
| 473 | Ga0495672_0006892 | 3300047320 | Bacteria | 8666 |
| 474 | Ga0495676_0040086 | 3300047321 | Bacteria | 3870 |
| 475 | Ga0495680_0091055 | 3300047322 | Bacteria | 2286 |
| 476 | Ga0495673_0000805 | 3300047469 | Bacteria | 29466 |
| 477 | Ga0495593_0012442 | 3300047673 | Bacteria | 4864 |
| 478 | Ga0495602_0027158 | 3300048088 | Bacteria | 5509 |
| 479 | Ga0496100_0000142 | 3300048903 | Bacteria | 39816 |
| 480 | Ga0496100_0000557 | 3300048903 | Bacteria | 17700 |
| 481 | Ga0496100_0025589 | 3300048903 | Bacteria | 3611 |
| 482 | Ga0496100_0047584 | 3300048903 | Bacteria | 2765 |
| 483 | Ga0496101_0000075 | 3300048904 | Bacteria | 112785 |
| 484 | Ga0496101_0000262 | 3300048904 | Bacteria | 37343 |
| 485 | Ga0496101_0008147 | 3300048904 | Bacteria | 6841 |
| 486 | Ga0496101_0067111 | 3300048904 | Bacteria | 2618 |
| 487 | Ga0496102_0000003 | 3300048905 | Bacteria | 592263 |
| 488 | Ga0496102_0000050 | 3300048905 | Bacteria | 179469 |
| 489 | Ga0496102_0003725 | 3300048905 | Bacteria | 12884 |
| 490 | Ga0496102_0004890 | 3300048905 | Bacteria | 11344 |
| 491 | Ga0496102_0068865 | 3300048905 | Bacteria | 3248 |
| 492 | Ga0496102_0105078 | 3300048905 | Bacteria | 2627 |
| 493 | Ga0496102_0149967 | 3300048905 | Bacteria | 2190 |
| 494 | Ga0496102_0351205 | 3300048905 | Bacteria | 1388 |
| 495 | Ga0496103_0000014 | 3300048906 | Bacteria | 290397 |
| 496 | Ga0496103_0000609 | 3300048906 | Bacteria | 27908 |
| 497 | Ga0496103_0000822 | 3300048906 | Bacteria | 22777 |
| 498 | Ga0496103_0063985 | 3300048906 | Bacteria | 2292 |
| 499 | Ga0496103_0066922 | 3300048906 | Bacteria | 2243 |
| 500 | Ga0496103_0088808 | 3300048906 | Bacteria | 1949 |
| 501 | Ga0496104_0006206 | 3300048907 | Bacteria | 10501 |
| 502 | Ga0496105_0005157 | 3300048908 | Bacteria | 9908 |
| 503 | Ga0496105_0043386 | 3300048908 | Bacteria | 3709 |
| 504 | Ga0496106_0001848 | 3300048909 | Bacteria | 15843 |
| 505 | Ga0496106_0002602 | 3300048909 | Bacteria | 13433 |
| 506 | Ga0496106_0008432 | 3300048909 | Bacteria | 7624 |
| 507 | Ga0496106_0011473 | 3300048909 | Bacteria | 6553 |
| 508 | Ga0496106_0032794 | 3300048909 | Bacteria | 3873 |
| 509 | Ga0496106_0043752 | 3300048909 | Bacteria | 3361 |
| 510 | Ga0496107_0000244 | 3300048910 | Bacteria | 28613 |
| 511 | Ga0496107_0004976 | 3300048910 | Bacteria | 9046 |
| 512 | Ga0496107_0008052 | 3300048910 | Bacteria | 7278 |
| 513 | Ga0496108_0000394 | 3300048911 | Bacteria | 36076 |
| 514 | Ga0496108_0005483 | 3300048911 | Bacteria | 10262 |
| 515 | Ga0496108_0032823 | 3300048911 | Bacteria | 4311 |
| 516 | Ga0496108_0038358 | 3300048911 | Bacteria | 3991 |
| 517 | Ga0496109_0001985 | 3300048912 | Bacteria | 16959 |
| 518 | Ga0496109_0023418 | 3300048912 | Bacteria | 5482 |
| 519 | Ga0496109_0076265 | 3300048912 | Bacteria | 3083 |
| 520 | Ga0496109_0197278 | 3300048912 | Bacteria | 1892 |
| 521 | Ga0496109_0300235 | 3300048912 | Bacteria | 1514 |
| 522 | Ga0496110_0017048 | 3300048913 | Bacteria | 6071 |
| 523 | Ga0496110_0034403 | 3300048913 | Bacteria | 4389 |
| 524 | Ga0496111_0012736 | 3300048914 | Bacteria | 5702 |
| 525 | Ga0496111_0023698 | 3300048914 | Bacteria | 4311 |
| 526 | Ga0496111_0023829 | 3300048914 | Bacteria | 4300 |
| 527 | Ga0496111_0063746 | 3300048914 | Bacteria | 2673 |
| 528 | Ga0496112_0004967 | 3300048915 | Bacteria | 11400 |
| 529 | Ga0496112_0006388 | 3300048915 | Bacteria | 10346 |
| 530 | Ga0496112_0096684 | 3300048915 | Bacteria | 2923 |
| 531 | Ga0496113_0016291 | 3300048916 | Bacteria | 5132 |
| 532 | Ga0496113_0024764 | 3300048916 | Bacteria | 4271 |
| 533 | Ga0496114_0000365 | 3300048917 | Bacteria | 33197 |
| 534 | Ga0496114_0005619 | 3300048917 | Bacteria | 9836 |
| 535 | Ga0496114_0036653 | 3300048917 | Bacteria | 4055 |
| 536 | Ga0496114_0092310 | 3300048917 | Bacteria | 2572 |
| 537 | Ga0496115_0002410 | 3300048918 | Bacteria | 13422 |
| 538 | Ga0496115_0003044 | 3300048918 | Bacteria | 12030 |
| 539 | Ga0496115_0163566 | 3300048918 | Bacteria | 1840 |
| 540 | Ga0496116_0000071 | 3300048919 | Bacteria | 244521 |
| 541 | Ga0496116_0036370 | 3300048919 | Bacteria | 3446 |
| 542 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 543 | Ga0496117_0006545 | 3300048920 | Bacteria | 11728 |
| 544 | Ga0496117_0069166 | 3300048920 | Bacteria | 2379 |
| 545 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 546 | Ga0496118_0000029 | 3300048921 | Bacteria | 340978 |
| 547 | Ga0496118_0001032 | 3300048921 | Bacteria | 43337 |
| 548 | Ga0496119_0000527 | 3300048922 | Bacteria | 52100 |
| 549 | Ga0496119_0097251 | 3300048922 | Bacteria | 1660 |
| 550 | Ga0496120_0000235 | 3300048923 | Bacteria | 94653 |
| 551 | Ga0496120_0010885 | 3300048923 | Bacteria | 6294 |
| 552 | Ga0496121_0000019 | 3300048924 | Bacteria | 499976 |
| 553 | Ga0496121_0010829 | 3300048924 | Bacteria | 10201 |
| 554 | Ga0496125_0033073 | 3300048928 | Bacteria | 4583 |
| 555 | Ga0496126_0000951 | 3300048929 | Bacteria | 49637 |
| 556 | Ga0496126_0006705 | 3300048929 | Bacteria | 12786 |
| 557 | Ga0501032_0003076 | 3300049569 | Bacteria | 12889 |
| 558 | Ga0501032_0004598 | 3300049569 | Bacteria | 10383 |
| 559 | Ga0501032_0139076 | 3300049569 | Bacteria | 1599 |
| 560 | Ga0501033_0130420 | 3300049570 | Bacteria | 1821 |
| 561 | Ga0501034_0010184 | 3300049571 | Bacteria | 9808 |
| 562 | Ga0501034_0168376 | 3300049571 | Bacteria | 2159 |
| 563 | Ga0501034_0184054 | 3300049571 | Bacteria | 2053 |
| 564 | Ga0501036_0003035 | 3300049572 | Bacteria | 13371 |
| 565 | Ga0501036_0011187 | 3300049572 | Bacteria | 7425 |
| 566 | Ga0501036_0053964 | 3300049572 | Bacteria | 3403 |
| 567 | Ga0501037_0000454 | 3300049573 | Bacteria | 33411 |
| 568 | Ga0501037_0068017 | 3300049573 | Bacteria | 2593 |
| 569 | Ga0501038_0050466 | 3300049574 | Bacteria | 3594 |
| 570 | Ga0501039_0033407 | 3300049575 | Bacteria | 3966 |
| 571 | Ga0501039_0039748 | 3300049575 | Bacteria | 3632 |
| 572 | Ga0501040_0003090 | 3300049576 | Bacteria | 10796 |
| 573 | Ga0501041_0010180 | 3300049577 | Bacteria | 5542 |
| 574 | Ga0501042_0179686 | 3300049578 | Bacteria | 1526 |
| 575 | Ga0501043_0000402 | 3300049579 | Bacteria | 38918 |
| 576 | Ga0501043_0009971 | 3300049579 | Bacteria | 7450 |
| 577 | Ga0501046_0002180 | 3300049580 | Bacteria | 18472 |
| 578 | Ga0501047_0029499 | 3300049581 | Bacteria | 5288 |
| 579 | Ga0501068_0074355 | 3300049584 | Bacteria | 2077 |
| 580 | Ga0501070_0024924 | 3300049586 | Bacteria | 5016 |
| 581 | Ga0501070_0042662 | 3300049586 | Bacteria | 3778 |
| 582 | Ga0501071_0188944 | 3300049587 | Bacteria | 1544 |
| 583 | Ga0501072_0003384 | 3300049588 | Bacteria | 11997 |
| 584 | Ga0501073_0022007 | 3300049589 | Bacteria | 4594 |
| 585 | Ga0501073_0198611 | 3300049589 | Bacteria | 1387 |
| 586 | Ga0501074_0010816 | 3300049590 | Bacteria | 6626 |
| 587 | Ga0501076_0001504 | 3300049592 | Bacteria | 15617 |
| 588 | Ga0501077_0002322 | 3300049593 | Bacteria | 11453 |
| 589 | Ga0501079_0010148 | 3300049741 | Bacteria | 7150 |
| 590 | Ga0501080_0004322 | 3300049742 | Bacteria | 12620 |
| 591 | Ga0501080_0125823 | 3300049742 | Bacteria | 2374 |
| 592 | Ga0501080_0239864 | 3300049742 | Bacteria | 1655 |
| 593 | Ga0501083_0167018 | 3300049744 | Bacteria | 1438 |
| 594 | Ga0501035_0009420 | 3300049822 | Bacteria | 9080 |
| 595 | Ga0501035_0149243 | 3300049822 | Bacteria | 2029 |
| 596 | Ga0501044_0001781 | 3300049823 | Bacteria | 25182 |
| 597 | Ga0501044_0120116 | 3300049823 | Bacteria | 2630 |
| 598 | Ga0501045_0001500 | 3300049824 | Bacteria | 15552 |
| 599 | nmdc:mga03n38_83921_c1 | 3300050490 | Bacteria | 1503 |
| 600 | nmdc:mga06z11_1393_c1 | 3300050494 | Bacteria | 8972 |
| 601 | nmdc:mga05p37_2348_c1 | 3300050507 | Bacteria | 22012 |
| 602 | nmdc:mga05p37_7245_c1 | 3300050507 | Bacteria | 13084 |
| 603 | nmdc:mga09592_31_c1 | 3300050508 | Bacteria | 79922 |
| 604 | nmdc:mga0qj67_43_c1 | 3300050509 | Bacteria | 88150 |
| 605 | nmdc:mga06r32_162300_c1 | 3300050510 | Bacteria | 2217 |
| 606 | nmdc:mga06r32_57_c2 | 3300050510 | Bacteria | 51506 |
| 607 | Ga0495601_0037072 | 3300053077 | Bacteria | 3048 |
| 608 | Ga0495595_0008518 | 3300053084 | Bacteria | 4213 |
| 609 | Ga0495619_0032892 | 3300053085 | Bacteria | 3366 |
| 610 | Ga0500643_005872 | 3300053087 | Bacteria | 5215 |
| 611 | Ga0500556_0001720 | 3300053104 | Bacteria | 8290 |
| 612 | Ga0500562_003126 | 3300053108 | Bacteria | 4136 |
| 613 | Ga0500652_000187 | 3300053131 | Bacteria | 23997 |
| 614 | Ga0500616_0011119 | 3300053153 | Bacteria | 5343 |
| 615 | Ga0501084_0004362 | 3300054114 | Bacteria | 11528 |
| 616 | Ga0501082_0013873 | 3300060353 | Bacteria | 6927 |
| 617 | Ga0530510_0001537 | 3300061734 | Bacteria | 15565 |
| 618 | 2644532942 | 2643221696 | Bacteria | 5431823 |
| 619 | 2738869547 | 2738541305 | Bacteria | 4910150 |
| 620 | 2740165373 | 2739367898 | Bacteria | 4367674 |
| 621 | 2774852570 | 2773857922 | Bacteria | 9757215 |
| 622 | 2809198542 | 2808606439 | Bacteria | 5952208 |
| 623 | 2812330773 | 2811994874 | Bacteria | 5367947 |
| 624 | 2812352878 | 2811994878 | Bacteria | 5992952 |
| 625 | 2816507417 | 2816332139 | Bacteria | 9138787 |
| 626 | 2891567507 | 2891562705 | Bacteria | 8039471 |
| 627 | 2984577848 | 2984576629 | Bacteria | 4248407 |
| 628 | 2990260181 | 2990256926 | Bacteria | 4252839 |
| 629 | Ga0466965_0054536 | |||
| 630 | JGI24745J21846_1000078 | |||
| 631 | JGI25407J50210_10002883 | |||
| 632 | Ga0055540_1001748 | |||
| 633 | Ga0070658_10006940 | |||
| 634 | Ga0070658_10048174 | |||
| 635 | Ga0070676_10011340 | |||
| 636 | Ga0070676_10088126 | |||
| 637 | Ga0070683_100003228 | |||
| 638 | Ga0070683_100029777 | |||
| 639 | Ga0070683_100131674 | |||
| 640 | Ga0070690_100004542 | |||
| 641 | Ga0070670_100035746 | |||
| 642 | Ga0070670_100096926 | |||
| 643 | Ga0068869_100008063 | |||
| 644 | Ga0070666_10030348 | |||
| 645 | Ga0070682_100000998 | |||
| 646 | Ga0070682_100026032 | |||
| 647 | Ga0070682_100046721 | |||
| 648 | Ga0068868_100001405 | |||
| 649 | Ga0068868_100001415 | |||
| 650 | Ga0068868_100002096 | |||
| 651 | Ga0070660_100060398 | |||
| 652 | Ga0070689_100012826 | |||
| 653 | Ga0070689_100024282 | |||
| 654 | Ga0070691_10000993 | |||
| 655 | Ga0070691_10019055 | |||
| 656 | Ga0070661_100015786 | |||
| 657 | Ga0070692_10008795 | |||
| 658 | Ga0070692_10025837 | |||
| 659 | Ga0070668_100005227 | |||
| 660 | Ga0070669_100023633 | |||
| 661 | Ga0070669_100029444 | |||
| 662 | Ga0070675_100095177 | |||
| 663 | Ga0070671_100002004 | |||
| 664 | Ga0070671_100035299 | |||
| 665 | Ga0070671_100223049 | |||
| 666 | Ga0070674_100001396 | |||
| 667 | Ga0070674_100005578 | |||
| 668 | Ga0070674_100028357 | |||
| 669 | Ga0070688_100001220 | |||
| 670 | Ga0070688_100013838 | |||
| 671 | Ga0070659_100001761 | |||
| 672 | Ga0070659_100007902 | |||
| 673 | Ga0070667_100000182 | |||
| 674 | Ga0070667_100004112 | |||
| 675 | Ga0070667_100024085 | |||
| 676 | Ga0070667_100045692 | |||
| 677 | Ga0070709_10016888 | |||
| 678 | Ga0070709_10038368 | |||
| 679 | Ga0070714_100188129 | |||
| 680 | Ga0070713_100005790 | |||
| 681 | Ga0070713_100212915 | |||
| 682 | Ga0070710_10000235 | |||
| 683 | Ga0070710_10000511 | |||
| 684 | Ga0070710_10000625 | |||
| 685 | Ga0070701_10004084 | |||
| 686 | Ga0070701_10060140 | |||
| 687 | Ga0070711_100000182 | |||
| 688 | Ga0070711_100000720 | |||
| 689 | Ga0070711_100000779 | |||
| 690 | Ga0070711_100005823 | |||
| 691 | Ga0070700_100007135 | |||
| 692 | Ga0070700_100010725 | |||
| 693 | Ga0070700_100057829 | |||
| 694 | Ga0070708_100115678 | |||
| 695 | Ga0070663_100000566 | |||
| 696 | Ga0070663_100021600 | |||
| 697 | Ga0070678_100000293 | |||
| 698 | Ga0070678_100001082 | |||
| 699 | Ga0070662_100003260 | |||
| 700 | Ga0070662_100004369 | |||
| 701 | Ga0070681_10028305 | |||
| 702 | Ga0068867_100002834 | |||
| 703 | Ga0068867_100009081 | |||
| 704 | Ga0070685_10006466 | |||
| 705 | Ga0070707_100008914 | |||
| 706 | Ga0070698_100005293 | |||
| 707 | Ga0070698_100043201 | |||
| 708 | Ga0070698_100121750 | |||
| 709 | Ga0070698_100249335 | |||
| 710 | Ga0070699_100005288 | |||
| 711 | Ga0070679_100187299 | |||
| 712 | Ga0070684_100003542 | |||
| 713 | Ga0070684_100053947 | |||
| 714 | Ga0070684_100089203 | |||
| 715 | Ga0070697_100377716 | |||
| 716 | Ga0068853_100013771 | |||
| 717 | Ga0068853_100103653 | |||
| 718 | Ga0068853_100180844 | |||
| 719 | Ga0068853_100247328 | |||
| 720 | Ga0070672_100035258 | |||
| 721 | Ga0070695_100004961 | |||
| 722 | Ga0070695_100025141 | |||
| 723 | Ga0070696_100006373 | |||
| 724 | Ga0070696_100011371 | |||
| 725 | Ga0070693_100186191 | |||
| 726 | Ga0070665_100002208 | |||
| 727 | Ga0070665_100006765 | |||
| 728 | Ga0070665_100027121 | |||
| 729 | Ga0070665_100051458 | |||
| 730 | Ga0070665_100116231 | |||
| 731 | Ga0070665_100224052 | |||
| 732 | Ga0070704_100001023 | |||
| 733 | Ga0070704_100001025 | |||
| 734 | Ga0070704_100108868 | |||
| 735 | Ga0068855_100007302 | |||
| 736 | Ga0068855_100112846 | |||
| 737 | Ga0068855_100259678 | |||
| 738 | Ga0070664_100004085 | |||
| 739 | Ga0068857_100004211 | |||
| 740 | Ga0068857_100253202 | |||
| 741 | Ga0068854_100001282 | |||
| 742 | Ga0068854_100001634 | |||
| 743 | Ga0068854_100012303 | |||
| 744 | Ga0068854_100022125 | |||
| 745 | Ga0068854_100188357 | |||
| 746 | Ga0068856_100029093 | |||
| 747 | Ga0068856_100119741 | |||
| 748 | Ga0068856_100301600 | |||
| 749 | Ga0070702_100000902 | |||
| 750 | Ga0070702_100001632 | |||
| 751 | Ga0070702_100008706 | |||
| 752 | Ga0068852_100002700 | |||
| 753 | Ga0068852_100048756 | |||
| 754 | Ga0068852_100249329 | |||
| 755 | Ga0068859_100000583 | |||
| 756 | Ga0068859_100008871 | |||
| 757 | Ga0068859_100030488 | |||
| 758 | Ga0068864_100001228 | |||
| 759 | Ga0068864_100030889 | |||
| 760 | Ga0068866_10000145 | |||
| 761 | Ga0068866_10000713 | |||
| 762 | Ga0068866_10008599 | |||
| 763 | Ga0068861_100000446 | |||
| 764 | Ga0068861_100001091 | |||
| 765 | Ga0068861_100193667 | |||
| 766 | Ga0068851_10099908 | |||
| 767 | Ga0068870_10001244 | |||
| 768 | Ga0068863_100003806 | |||
| 769 | Ga0068858_100003437 | |||
| 770 | Ga0068858_100016577 | |||
| 771 | Ga0068858_100017506 | |||
| 772 | Ga0068858_100018489 | |||
| 773 | Ga0068858_100060934 | |||
| 774 | Ga0068858_100284818 | |||
| 775 | Ga0068860_100000374 | |||
| 776 | Ga0068860_100002734 | |||
| 777 | Ga0068860_100013066 | |||
| 778 | Ga0068862_100000276 | |||
| 779 | Ga0068862_100001047 | |||
| 780 | Ga0068862_100001732 | |||
| 781 | Ga0068862_100005999 | |||
| 782 | Ga0081455_10014625 | |||
| 783 | Ga0081455_10103977 | |||
| 784 | Ga0081538_10009757 | |||
| 785 | Ga0081538_10016065 | |||
| 786 | Ga0070717_10009221 | |||
| 787 | Ga0070717_10020607 | |||
| 788 | Ga0070717_10071840 | |||
| 789 | Ga0070717_10197967 | |||
| 790 | Ga0075365_10040800 | |||
| 791 | Ga0075365_10102072 | |||
| 792 | Ga0075368_10010263 | |||
| 793 | Ga0075363_100000367 | |||
| 794 | Ga0075363_100001733 | |||
| 795 | Ga0075364_10001045 | |||
| 796 | Ga0075364_10021644 | |||
| 797 | Ga0075364_10027591 | |||
| 798 | Ga0075364_10047760 | |||
| 799 | Ga0070716_100000192 | |||
| 800 | Ga0070716_100000340 | |||
| 801 | Ga0070716_100031795 | |||
| 802 | Ga0070712_100000548 | |||
| 803 | Ga0070712_100000676 | |||
| 804 | Ga0070712_100024543 | |||
| 805 | Ga0070712_100039006 | |||
| 806 | Ga0070712_100076200 | |||
| 807 | Ga0075362_10009868 | |||
| 808 | Ga0075367_10014909 | |||
| 809 | Ga0075367_10043822 | |||
| 810 | Ga0075369_10000284 | |||
| 811 | Ga0097621_100014125 | |||
| 812 | Ga0097621_100118258 | |||
| 813 | Ga0075370_10010963 | |||
| 814 | Ga0068871_100011028 | |||
| 815 | Ga0075430_100007265 | |||
| 816 | Ga0075431_100030529 | |||
| 817 | Ga0075431_100065729 | |||
| 818 | Ga0075429_100011501 | |||
| 819 | Ga0068865_100000408 | |||
| 820 | Ga0068865_100001202 | |||
| 821 | Ga0068865_100053530 | |||
| 822 | Ga0068865_100110023 | |||
| 823 | Ga0097620_100000583 | |||
| 824 | Ga0097620_100008871 | |||
| 825 | Ga0097620_100030488 | |||
| 826 | Ga0075435_100122966 | |||
| 827 | Ga0105245_10001412 | |||
| 828 | Ga0105245_10001413 | |||
| 829 | Ga0105245_10003271 | |||
| 830 | Ga0105245_10023368 | |||
| 831 | Ga0105245_10162080 | |||
| 832 | Ga0105247_10000181 | |||
| 833 | Ga0105247_10000969 | |||
| 834 | Ga0105247_10001090 | |||
| 835 | Ga0105247_10011874 | |||
| 836 | Ga0105247_10099043 | |||
| 837 | Ga0114129_10000657 | |||
| 838 | Ga0114129_10054219 | |||
| 839 | Ga0105243_10002081 | |||
| 840 | Ga0105243_10004082 | |||
| 841 | Ga0105243_10019698 | |||
| 842 | Ga0105243_10020942 | |||
| 843 | Ga0105241_10031730 | |||
| 844 | Ga0105242_10000452 | |||
| 845 | Ga0105242_10001916 | |||
| 846 | Ga0105248_10000652 | |||
| 847 | Ga0105248_10002935 | |||
| 848 | Ga0105248_10003236 | |||
| 849 | Ga0105248_10128732 | |||
| 850 | Ga0105248_10198262 | |||
| 851 | Ga0105248_10198522 | |||
| 852 | Ga0105237_10003090 | |||
| 853 | Ga0105237_10112219 | |||
| 854 | Ga0105238_10004273 | |||
| 855 | Ga0105249_10000022 | |||
| 856 | Ga0105249_10001553 | |||
| 857 | Ga0105249_10006559 | |||
| 858 | Ga0105249_10010291 | |||
| 859 | Ga0105249_10020728 | |||
| 860 | Ga0105249_10021384 | |||
| 861 | Ga0105249_10150490 | |||
| 862 | Ga0105249_10200995 | |||
| 863 | Ga0105239_10001222 | |||
| 864 | Ga0105239_10007225 | |||
| 865 | Ga0105239_10008593 | |||
| 866 | Ga0105239_10040450 | |||
| 867 | Ga0105239_10457653 | |||
| 868 | Ga0157369_10017331 | |||
| 869 | Ga0157369_10145073 | |||
| 870 | Ga0157369_10207388 | |||
| 871 | Ga0157374_10053252 | |||
| 872 | Ga0157378_10001002 | |||
| 873 | Ga0157378_10014553 | |||
| 874 | Ga0157378_10054723 | |||
| 875 | Ga0163162_10043568 | |||
| 876 | Ga0163162_10043597 | |||
| 877 | Ga0163162_10051122 | |||
| 878 | Ga0163162_10111143 | |||
| 879 | Ga0163162_10191840 | |||
| 880 | Ga0157372_10046874 | |||
| 881 | Ga0157372_10143796 | |||
| 882 | Ga0157375_10004204 | |||
| 883 | Ga0157375_10007528 | |||
| 884 | Ga0157375_10013266 | |||
| 885 | Ga0163163_10004534 | |||
| 886 | Ga0163163_10019839 | |||
| 887 | Ga0163163_10046292 | |||
| 888 | Ga0163163_10053687 | |||
| 889 | Ga0157380_10004810 | |||
| 890 | Ga0157380_10125297 | |||
| 891 | Ga0157377_10002992 | |||
| 892 | Ga0157377_10029974 | |||
| 893 | Ga0157379_10007368 | |||
| 894 | Ga0157379_10045265 | |||
| 895 | Ga0157379_10107795 | |||
| 896 | Ga0157379_10129102 | |||
| 897 | Ga0157376_10015478 | |||
| 898 | Ga0157376_10297737 | |||
| 899 | Ga0163161_10000334 | |||
| 900 | Ga0163161_10027878 | |||
| 901 | Ga0206353_11271249 | |||
| 902 | Ga0213874_10001035 | |||
| 903 | Ga0213875_10016447 | |||
| 904 | Ga0213875_10041361 | |||
| 905 | Ga0209051_1001329 | |||
| 906 | Ga0209051_1003146 | |||
| 907 | Ga0207692_10000152 | |||
| 908 | Ga0207692_10000462 | |||
| 909 | Ga0207710_10000091 | |||
| 910 | Ga0207688_10000430 | |||
| 911 | Ga0207688_10000757 | |||
| 912 | Ga0207688_10012870 | |||
| 913 | Ga0207680_10008223 | |||
| 914 | Ga0207685_10047462 | |||
| 915 | Ga0207699_10003441 | |||
| 916 | Ga0207645_10097051 | |||
| 917 | Ga0207643_10031784 | |||
| 918 | Ga0207705_10064801 | |||
| 919 | Ga0207654_10101292 | |||
| 920 | Ga0207707_10126115 | |||
| 921 | Ga0207695_10053647 | |||
| 922 | Ga0207671_10012380 | |||
| 923 | Ga0207671_10171164 | |||
| 924 | Ga0207693_10000354 | |||
| 925 | Ga0207693_10000392 | |||
| 926 | Ga0207693_10025348 | |||
| 927 | Ga0207663_10083834 | |||
| 928 | Ga0207663_10111700 | |||
| 929 | Ga0207663_10219632 | |||
| 930 | Ga0207660_10026816 | |||
| 931 | Ga0207662_10158285 | |||
| 932 | Ga0207657_10071277 | |||
| 933 | Ga0207649_10012236 | |||
| 934 | Ga0207649_10026646 | |||
| 935 | Ga0207652_10159733 | |||
| 936 | Ga0207646_10006640 | |||
| 937 | Ga0207681_10001711 | |||
| 938 | Ga0207681_10081923 | |||
| 939 | Ga0207659_10082923 | |||
| 940 | Ga0207687_10002409 | |||
| 941 | Ga0207687_10051339 | |||
| 942 | Ga0207700_10001688 | |||
| 943 | Ga0207700_10063073 | |||
| 944 | Ga0207700_10119630 | |||
| 945 | Ga0207700_10178410 | |||
| 946 | Ga0207664_10002322 | |||
| 947 | Ga0207664_10007903 | |||
| 948 | Ga0207664_10011346 | |||
| 949 | Ga0207664_10183016 | |||
| 950 | Ga0207644_10008570 | |||
| 951 | Ga0207644_10032068 | |||
| 952 | Ga0207644_10179050 | |||
| 953 | Ga0207690_10008582 | |||
| 954 | Ga0207706_10001671 | |||
| 955 | Ga0207706_10019606 | |||
| 956 | Ga0207706_10028065 | |||
| 957 | Ga0207706_10032114 | |||
| 958 | Ga0207686_10099134 | |||
| 959 | Ga0207709_10018505 | |||
| 960 | Ga0207709_10033455 | |||
| 961 | Ga0207670_10005624 | |||
| 962 | Ga0207670_10019433 | |||
| 963 | Ga0207669_10000319 | |||
| 964 | Ga0207704_10000426 | |||
| 965 | Ga0207704_10052046 | |||
| 966 | Ga0207665_10000042 | |||
| 967 | Ga0207665_10000570 | |||
| 968 | Ga0207665_10004901 | |||
| 969 | Ga0207711_10000713 | |||
| 970 | Ga0207711_10021850 | |||
| 971 | Ga0207711_10031852 | |||
| 972 | Ga0207689_10110898 | |||
| 973 | Ga0207661_10005202 | |||
| 974 | Ga0207661_10013995 | |||
| 975 | Ga0207667_10039521 | |||
| 976 | Ga0207667_10262965 | |||
| 977 | Ga0207712_10000005 | |||
| 978 | Ga0207712_10066040 | |||
| 979 | Ga0207712_10075786 | |||
| 980 | Ga0207668_10068793 | |||
| 981 | Ga0207668_10258303 | |||
| 982 | Ga0207658_10000316 | |||
| 983 | Ga0207658_10101408 | |||
| 984 | Ga0207677_10000864 | |||
| 985 | Ga0207677_10021590 | |||
| 986 | Ga0207703_10002968 | |||
| 987 | Ga0207703_10075863 | |||
| 988 | Ga0207703_10094069 | |||
| 989 | Ga0207703_10107821 | |||
| 990 | Ga0207703_10416362 | |||
| 991 | Ga0207639_10016512 | |||
| 992 | Ga0207678_10001855 | |||
| 993 | Ga0207678_10006875 | |||
| 994 | Ga0207678_10010538 | |||
| 995 | Ga0207678_10052486 | |||
| 996 | Ga0207708_10046031 | |||
| 997 | Ga0207708_10083552 | |||
| 998 | Ga0207702_10006081 | |||
| 999 | Ga0207702_10141304 | |||
| 1000 | Ga0207702_10161885 | |||
| 1001 | Ga0207702_10187111 | |||
| 1002 | Ga0207641_10018215 | |||
| 1003 | Ga0207641_10066141 | |||
| 1004 | Ga0207641_10070710 | |||
| 1005 | Ga0207648_10000969 | |||
| 1006 | Ga0207676_10002464 | |||
| 1007 | Ga0207676_10022082 | |||
| 1008 | Ga0207676_10105842 | |||
| 1009 | Ga0207674_10007852 | |||
| 1010 | Ga0207675_100000436 | |||
| 1011 | Ga0207675_100043444 | |||
| 1012 | Ga0207675_100088075 | |||
| 1013 | Ga0207675_100134270 | |||
| 1014 | Ga0207683_10000406 | |||
| 1015 | Ga0207683_10018212 | |||
| 1016 | Ga0207683_10118443 | |||
| 1017 | Ga0207698_10006388 | |||
| 1018 | Ga0268266_10003404 | |||
| 1019 | Ga0268266_10004670 | |||
| 1020 | Ga0268266_10018891 | |||
| 1021 | Ga0268266_10037722 | |||
| 1022 | Ga0268266_10055373 | |||
| 1023 | Ga0268265_10000005 | |||
| 1024 | Ga0268264_10000005 | |||
| 1025 | Ga0268264_10002064 | |||
| 1026 | Ga0307512_10010669 | |||
| 1027 | Ga0307512_10035101 | |||
| 1028 | Ga0307513_10004357 | |||
| 1029 | Ga0307408_100176900 | |||
| 1030 | Ga0307508_10059010 | |||
| 1031 | Ga0307516_10014621 | |||
| 1032 | Ga0307516_10019203 | |||
| 1033 | Ga0307516_10074957 | |||
| 1034 | Ga0307413_10064562 | |||
| 1035 | Ga0307406_10018464 | |||
| 1036 | Ga0307416_100042142 | |||
| 1037 | Ga0307411_10148096 | |||
| 1038 | Ga0307510_10066957 | |||
| 1039 | Ga0373939_0005764 | |||
| 1040 | Ga0373943_0060923 | |||
| 1041 | Ga0373946_0075044 | |||
| 1042 | Ga0373931_0007047 | |||
| 1043 | Ga0373927_0003586 | |||
| 1044 | Ga0373933_0038403 | |||
| 1045 | Ga0373937_0017082 | |||
| 1046 | Ga0373925_0001551 | |||
| 1047 | Ga0395899_0024120 | |||
| 1048 | Ga0395899_0165506 | |||
| 1049 | Ga0395900_0309769 | |||
| 1050 | Ga0395898_0009553 | |||
| 1051 | Ga0395905_0079410 | |||
| 1052 | Ga0436364_0071837 | |||
| 1053 | Ga0436364_0084809 | |||
| 1054 | Ga0436364_1106446 | |||
| 1055 | Ga0436364_1184375 | |||
| 1056 | Ga0436364_1328102 | |||
| 1057 | Ga0436364_1513210 | |||
| 1058 | Ga0436364_1514008 | |||
| 1059 | Ga0395901_0171540 | |||
| 1060 | Ga0395901_0384663 | |||
| 1061 | Ga0436365_0221083 | |||
| 1062 | Ga0436365_0892160 | |||
| 1063 | Ga0436363_0357285 | |||
| 1064 | Ga0436362_1196443 | |||
| 1065 | Ga0451806_069845 | |||
| 1066 | Ga0466965_0013672 | |||
| 1067 | Ga0466965_0015960 | |||
| 1068 | Ga0466966_0019451 | |||
| 1069 | Ga0466966_0053488 | |||
| 1070 | Ga0466961_0006153 | |||
| 1071 | Ga0466961_0008524 | |||
| 1072 | Ga0466963_0051409 | |||
| 1073 | Ga0466968_0003078 | |||
| 1074 | Ga0466968_0023705 | |||
| 1075 | Ga0466957_0001382 | |||
| 1076 | Ga0466957_0144942 | |||
| 1077 | Ga0466960_0000351 | |||
| 1078 | Ga0466960_0000838 | |||
| 1079 | Ga0466960_0058166 | |||
| 1080 | Ga0466959_0001193 | |||
| 1081 | Ga0466959_0014769 | |||
| 1082 | Ga0466967_0017515 | |||
| 1083 | Ga0466967_0184615 | |||
| 1084 | Ga0495592_0164015 | |||
| 1085 | Ga0495641_0030719 | |||
| 1086 | Ga0495651_0002829 | |||
| 1087 | Ga0495653_0036380 | |||
| 1088 | Ga0495662_0049131 | |||
| 1089 | Ga0495608_0025418 | |||
| 1090 | Ga0495628_0083249 | |||
| 1091 | Ga0495631_0022773 | |||
| 1092 | Ga0495640_0056215 | |||
| 1093 | Ga0495668_0025588 | |||
| 1094 | Ga0495668_0062814 | |||
| 1095 | Ga0495668_0097972 | |||
| 1096 | Ga0495635_0163381 | |||
| 1097 | Ga0495623_0069201 | |||
| 1098 | Ga0495646_0019804 | |||
| 1099 | Ga0495600_0008063 | |||
| 1100 | Ga0495604_0095869 | |||
| 1101 | Ga0495672_0006892 | |||
| 1102 | Ga0495676_0040086 | |||
| 1103 | Ga0495680_0091055 | |||
| 1104 | Ga0495673_0000805 | |||
| 1105 | Ga0495593_0012442 | |||
| 1106 | Ga0495602_0027158 | |||
| 1107 | Ga0496100_0000142 | |||
| 1108 | Ga0496100_0000557 | |||
| 1109 | Ga0496100_0025589 | |||
| 1110 | Ga0496100_0047584 | |||
| 1111 | Ga0496101_0000075 | |||
| 1112 | Ga0496101_0000262 | |||
| 1113 | Ga0496101_0008147 | |||
| 1114 | Ga0496101_0067111 | |||
| 1115 | Ga0496102_0000003 | |||
| 1116 | Ga0496102_0000050 | |||
| 1117 | Ga0496102_0003725 | |||
| 1118 | Ga0496102_0004890 | |||
| 1119 | Ga0496102_0068865 | |||
| 1120 | Ga0496102_0105078 | |||
| 1121 | Ga0496102_0149967 | |||
| 1122 | Ga0496102_0351205 | |||
| 1123 | Ga0496103_0000014 | |||
| 1124 | Ga0496103_0000609 | |||
| 1125 | Ga0496103_0000822 | |||
| 1126 | Ga0496103_0063985 | |||
| 1127 | Ga0496103_0066922 | |||
| 1128 | Ga0496103_0088808 | |||
| 1129 | Ga0496104_0006206 | |||
| 1130 | Ga0496105_0005157 | |||
| 1131 | Ga0496105_0043386 | |||
| 1132 | Ga0496106_0001848 | |||
| 1133 | Ga0496106_0002602 | |||
| 1134 | Ga0496106_0008432 | |||
| 1135 | Ga0496106_0011473 | |||
| 1136 | Ga0496106_0032794 | |||
| 1137 | Ga0496106_0043752 | |||
| 1138 | Ga0496107_0000244 | |||
| 1139 | Ga0496107_0004976 | |||
| 1140 | Ga0496107_0008052 | |||
| 1141 | Ga0496108_0000394 | |||
| 1142 | Ga0496108_0005483 | |||
| 1143 | Ga0496108_0032823 | |||
| 1144 | Ga0496108_0038358 | |||
| 1145 | Ga0496109_0001985 | |||
| 1146 | Ga0496109_0023418 | |||
| 1147 | Ga0496109_0076265 | |||
| 1148 | Ga0496109_0197278 | |||
| 1149 | Ga0496109_0300235 | |||
| 1150 | Ga0496110_0017048 | |||
| 1151 | Ga0496110_0034403 | |||
| 1152 | Ga0496111_0012736 | |||
| 1153 | Ga0496111_0023698 | |||
| 1154 | Ga0496111_0023829 | |||
| 1155 | Ga0496111_0063746 | |||
| 1156 | Ga0496112_0004967 | |||
| 1157 | Ga0496112_0006388 | |||
| 1158 | Ga0496112_0096684 | |||
| 1159 | Ga0496113_0016291 | |||
| 1160 | Ga0496113_0024764 | |||
| 1161 | Ga0496114_0000365 | |||
| 1162 | Ga0496114_0005619 | |||
| 1163 | Ga0496114_0036653 | |||
| 1164 | Ga0496114_0092310 | |||
| 1165 | Ga0496115_0002410 | |||
| 1166 | Ga0496115_0003044 | |||
| 1167 | Ga0496115_0163566 | |||
| 1168 | Ga0496116_0000071 | |||
| 1169 | Ga0496116_0036370 | |||
| 1170 | Ga0496117_0000003 | |||
| 1171 | Ga0496117_0006545 | |||
| 1172 | Ga0496117_0069166 | |||
| 1173 | Ga0496118_0000001 | |||
| 1174 | Ga0496118_0000029 | |||
| 1175 | Ga0496118_0001032 | |||
| 1176 | Ga0496119_0000527 | |||
| 1177 | Ga0496119_0097251 | |||
| 1178 | Ga0496120_0000235 | |||
| 1179 | Ga0496120_0010885 | |||
| 1180 | Ga0496121_0000019 | |||
| 1181 | Ga0496121_0010829 | |||
| 1182 | Ga0496125_0033073 | |||
| 1183 | Ga0496126_0000951 | |||
| 1184 | Ga0496126_0006705 | |||
| 1185 | Ga0501032_0003076 | |||
| 1186 | Ga0501032_0004598 | |||
| 1187 | Ga0501032_0139076 | |||
| 1188 | Ga0501033_0130420 | |||
| 1189 | Ga0501034_0010184 | |||
| 1190 | Ga0501034_0168376 | |||
| 1191 | Ga0501034_0184054 | |||
| 1192 | Ga0501036_0003035 | |||
| 1193 | Ga0501036_0011187 | |||
| 1194 | Ga0501036_0053964 | |||
| 1195 | Ga0501037_0000454 | |||
| 1196 | Ga0501037_0068017 | |||
| 1197 | Ga0501038_0050466 | |||
| 1198 | Ga0501039_0033407 | |||
| 1199 | Ga0501039_0039748 | |||
| 1200 | Ga0501040_0003090 | |||
| 1201 | Ga0501041_0010180 | |||
| 1202 | Ga0501042_0179686 | |||
| 1203 | Ga0501043_0000402 | |||
| 1204 | Ga0501043_0009971 | |||
| 1205 | Ga0501046_0002180 | |||
| 1206 | Ga0501047_0029499 | |||
| 1207 | Ga0501068_0074355 | |||
| 1208 | Ga0501070_0024924 | |||
| 1209 | Ga0501070_0042662 | |||
| 1210 | Ga0501071_0188944 | |||
| 1211 | Ga0501072_0003384 | |||
| 1212 | Ga0501073_0022007 | |||
| 1213 | Ga0501073_0198611 | |||
| 1214 | Ga0501074_0010816 | |||
| 1215 | Ga0501076_0001504 | |||
| 1216 | Ga0501077_0002322 | |||
| 1217 | Ga0501079_0010148 | |||
| 1218 | Ga0501080_0004322 | |||
| 1219 | Ga0501080_0125823 | |||
| 1220 | Ga0501080_0239864 | |||
| 1221 | Ga0501083_0167018 | |||
| 1222 | Ga0501035_0009420 | |||
| 1223 | Ga0501035_0149243 | |||
| 1224 | Ga0501044_0001781 | |||
| 1225 | Ga0501044_0120116 | |||
| 1226 | Ga0501045_0001500 | |||
| 1227 | nmdc:mga03n38_83921_c1 | |||
| 1228 | nmdc:mga06z11_1393_c1 | |||
| 1229 | nmdc:mga05p37_2348_c1 | |||
| 1230 | nmdc:mga05p37_7245_c1 | |||
| 1231 | nmdc:mga09592_31_c1 | |||
| 1232 | nmdc:mga0qj67_43_c1 | |||
| 1233 | nmdc:mga06r32_162300_c1 | |||
| 1234 | nmdc:mga06r32_57_c2 | |||
| 1235 | Ga0495601_0037072 | |||
| 1236 | Ga0495595_0008518 | |||
| 1237 | Ga0495619_0032892 | |||
| 1238 | Ga0500643_005872 | |||
| 1239 | Ga0500556_0001720 | |||
| 1240 | Ga0500562_003126 | |||
| 1241 | Ga0500652_000187 | |||
| 1242 | Ga0500616_0011119 | |||
| 1243 | Ga0501084_0004362 | |||
| 1244 | Ga0501082_0013873 | |||
| 1245 | Ga0530510_0001537 | |||
| 1246 | 2644532942 | |||
| 1247 | 2738869547 | |||
| 1248 | 2740165373 | |||
| 1249 | 2774852570 | |||
| 1250 | 2809198542 | |||
| 1251 | 2812330773 | |||
| 1252 | 2812352878 | |||
| 1253 | 2816507417 | |||
| 1254 | 2891567507 | |||
| 1255 | 2984577848 | |||
| 1256 | 2990260181 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cdh-assembly1.cif.gz_0 | architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. | 0.952 | 69 | 364 |
| 2zfa-assembly1.cif.gz_B | structure of lactate oxidase at ph4.5 from aerococcus viridans | 0.929 | 12 | 387 |
| 2nli-assembly1.cif.gz_B | crystal structure of the complex between l-lactate oxidase and a substrate analogue at 1.59 angstrom resolution | 0.927 | 12 | 387 |
| 6a4g-assembly1.cif.gz_A | mandelate oxidase mutant-y128f with the monooxide fmn adduct | 0.9196 | 15 | 375 |
| 2cdh-assembly1.cif.gz_0 | architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. | 0.9192 | 69 | 364 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WND7_8_384_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9762 | 13 | 387 | 3.20.20.70 |
| af_P9WND7_8_384_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9685 | 13 | 387 | 3.20.20.70 |
| af_P33232_3_380_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.911 | 11 | 387 | 3.20.20.70 |
| af_P33232_3_380_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9064 | 11 | 387 | 3.20.20.70 |
| af_P9WND5_34_407_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8992 | 11 | 387 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A4FCB5-F1-model_v4 | L-Lactate dehydrogenase (Cytochrome) (EC 1.1.2.3) | 0.9742 | 36 | 388 |
GO:0004460
GO:0010181 |
| AF-A0A655NTX8-F1-model_v4 | L-lactate dehydrogenase (EC 1.1.2.3) | 0.9695 | 256 | 383 |
GO:0004459
GO:0004460 GO:0005886 GO:0009060 |
| AF-A0A539DKW9-F1-model_v4 | Glycolate oxidase | 0.9692 | 239 | 385 |
GO:0016491
|
| AF-A0A5C5RFD4-F1-model_v4 | Alpha-hydroxy-acid oxidizing enzyme | 0.9668 | 209 | 394 |
GO:0016491
|
| AF-A0A3S1I2K6-F1-model_v4 | L-lactate dehydrogenase | 0.9662 | 256 | 380 |
GO:0005886
GO:0016491 |