F470576

General Info

Members Datasets Scaffolds Average Seq Length
627 349 1254 100

Family's Representative Sequence

Representative Sequence 3300042002|Ga0439442_124768|Ga0439442_124768_202_543
Length 113
Sequence LTCPTRNASTRARRVTETPIELDKHRGMAAQKATDIRRVLADVEANAKLLRDKQGVVELQILAAPAASWPEAVAKARYVLNLYSASLAPTDTHHRDLVAAVIADLTRLAGEET

Samples

Sample ID Description Type Environment
1 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
105 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
204 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
205 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
210 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
317 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
320 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
321 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
328 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
329 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
335 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
336 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
337 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
338 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
339 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
342 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
343 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
346 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
347 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
348 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
349 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.29
Nodule 0.64
Rhizoplane 10.85
Rhizosphere 76.87
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439442_124768 3300042002 Bacteria 565
2 JGI24739J22299_10020547 3300001989 Bacteria 2359
3 JGI24737J22298_10009616 3300001990 Bacteria 3207
4 JGI24745J21846_1025685 3300002073 Bacteria 701
5 JGI24034J26672_10069249 3300002239 Bacteria 630
6 Ga0065715_10120325 3300005293 Bacteria 2261
7 Ga0070658_11863953 3300005327 Bacteria 520
8 Ga0070683_100281965 3300005329 Bacteria 1580
9 Ga0070683_100783139 3300005329 Bacteria 914
10 Ga0070670_100074830 3300005331 Bacteria 2910
11 Ga0070670_100756855 3300005331 Bacteria 876
12 Ga0068869_100240309 3300005334 Bacteria 1443
13 Ga0068869_100636811 3300005334 Bacteria 904
14 Ga0070682_100164668 3300005337 Bacteria 1535
15 Ga0070682_101767806 3300005337 Bacteria 539
16 Ga0068868_100416053 3300005338 Bacteria 1163
17 Ga0068868_100897588 3300005338 Bacteria 805
18 Ga0070660_100688696 3300005339 Bacteria 857
19 Ga0070661_100094178 3300005344 Bacteria 2219
20 Ga0070661_100160243 3300005344 Bacteria 1704
21 Ga0070661_100271222 3300005344 Bacteria 1314
22 Ga0070692_10153477 3300005345 Bacteria 1314
23 Ga0070668_100813781 3300005347 Bacteria 830
24 Ga0070668_101124822 3300005347 Bacteria 709
25 Ga0070668_101685823 3300005347 Bacteria 582
26 Ga0070675_100100097 3300005354 Bacteria 2441
27 Ga0070675_100601349 3300005354 Bacteria 997
28 Ga0070675_101083379 3300005354 Bacteria 736
29 Ga0070674_101369588 3300005356 Bacteria 633
30 Ga0070673_101618467 3300005364 Bacteria 612
31 Ga0070659_100197047 3300005366 Bacteria 1657
32 Ga0070659_100258064 3300005366 Bacteria 1446
33 Ga0070659_100573333 3300005366 Bacteria 968
34 Ga0070659_101560165 3300005366 Bacteria 589
35 Ga0070667_100418142 3300005367 Bacteria 1222
36 Ga0070667_101280147 3300005367 Bacteria 687
37 Ga0070667_101822804 3300005367 Bacteria 573
38 Ga0070709_10353795 3300005434 Bacteria 1086
39 Ga0070710_10706175 3300005437 Bacteria 712
40 Ga0070710_10899510 3300005437 Bacteria 639
41 Ga0070711_100595346 3300005439 Bacteria 922
42 Ga0070711_100783617 3300005439 Bacteria 807
43 Ga0070705_100286856 3300005440 Bacteria 1173
44 Ga0070700_100250617 3300005441 Bacteria 1270
45 Ga0070700_100489736 3300005441 Bacteria 944
46 Ga0070663_100017501 3300005455 Bacteria 4679
47 Ga0070663_100066054 3300005455 Bacteria 2620
48 Ga0070663_100095495 3300005455 Bacteria 2210
49 Ga0070663_100366664 3300005455 Bacteria 1170
50 Ga0070663_100564790 3300005455 Bacteria 953
51 Ga0070662_100368644 3300005457 Bacteria 1180
52 Ga0070681_11134016 3300005458 Bacteria 703
53 Ga0070684_100011985 3300005535 Bacteria 6927
54 Ga0070684_100766715 3300005535 Bacteria 901
55 Ga0068853_100058719 3300005539 Bacteria 3321
56 Ga0068853_100082269 3300005539 Bacteria 2820
57 Ga0068853_100354324 3300005539 Bacteria 1366
58 Ga0068853_100786433 3300005539 Bacteria 911
59 Ga0070686_100094482 3300005544 Bacteria 2007
60 Ga0070693_100235069 3300005547 Bacteria 1208
61 Ga0070693_100797145 3300005547 Bacteria 700
62 Ga0070665_100019830 3300005548 Bacteria 6751
63 Ga0070665_100764039 3300005548 Bacteria 979
64 Ga0070665_101460635 3300005548 Bacteria 692
65 Ga0070704_101396128 3300005549 Bacteria 642
66 Ga0070704_101878735 3300005549 Bacteria 555
67 Ga0068855_100024639 3300005563 Bacteria 7197
68 Ga0068855_100236668 3300005563 Bacteria 2042
69 Ga0068855_100648967 3300005563 Bacteria 1134
70 Ga0068855_102341363 3300005563 Bacteria 534
71 Ga0070664_100506861 3300005564 Bacteria 1113
72 Ga0068857_100018616 3300005577 Bacteria 6094
73 Ga0068857_101291419 3300005577 Bacteria 708
74 Ga0068857_101694306 3300005577 Bacteria 618
75 Ga0068854_100298448 3300005578 Bacteria 1302
76 Ga0068854_102168928 3300005578 Bacteria 514
77 Ga0068856_100021383 3300005614 Bacteria 6289
78 Ga0068856_100022581 3300005614 Bacteria 6117
79 Ga0068856_100085774 3300005614 Bacteria 3128
80 Ga0068856_100505044 3300005614 Bacteria 1230
81 Ga0068856_100865347 3300005614 Bacteria 923
82 Ga0068856_101753544 3300005614 Bacteria 633
83 Ga0070702_100116288 3300005615 Bacteria 1667
84 Ga0068852_100888571 3300005616 Bacteria 908
85 Ga0068852_101515357 3300005616 Bacteria 693
86 Ga0068852_101578066 3300005616 Bacteria 679
87 Ga0068859_100298992 3300005617 Bacteria 1703
88 Ga0068864_100012299 3300005618 Bacteria 7074
89 Ga0068864_100185353 3300005618 Bacteria 1905
90 Ga0068864_101065166 3300005618 Bacteria 804
91 Ga0068866_11228505 3300005718 Bacteria 542
92 Ga0068870_10076885 3300005840 Bacteria 1835
93 Ga0068870_11072214 3300005840 Bacteria 578
94 Ga0068863_100052926 3300005841 Bacteria 3847
95 Ga0068858_100048748 3300005842 Bacteria 3923
96 Ga0068858_100085262 3300005842 Bacteria 2939
97 Ga0068858_100226200 3300005842 Bacteria 1773
98 Ga0068860_100415503 3300005843 Bacteria 1333
99 Ga0068860_102104316 3300005843 Bacteria 586
100 Ga0068862_100046807 3300005844 Bacteria 3690
101 Ga0068862_100507817 3300005844 Bacteria 1145
102 Ga0068862_100931813 3300005844 Bacteria 855
103 Ga0068862_101949996 3300005844 Bacteria 598
104 Ga0070717_10180680 3300006028 Bacteria 1839
105 Ga0075365_10076458 3300006038 Bacteria 2260
106 Ga0075365_10078694 3300006038 Bacteria 2230
107 Ga0075365_11318967 3300006038 Bacteria 507
108 Ga0075368_10040615 3300006042 Bacteria 1827
109 Ga0075368_10480382 3300006042 Bacteria 553
110 Ga0075368_10567070 3300006042 Bacteria 511
111 Ga0075363_100010476 3300006048 Bacteria 4407
112 Ga0075363_100031746 3300006048 Bacteria 2740
113 Ga0075364_10255594 3300006051 Bacteria 1191
114 Ga0075432_10030102 3300006058 Bacteria 1876
115 Ga0070716_100455024 3300006173 Bacteria 934
116 Ga0070712_100405534 3300006175 Bacteria 1127
117 Ga0070712_100593822 3300006175 Bacteria 937
118 Ga0070712_101391786 3300006175 Bacteria 612
119 Ga0075362_10252251 3300006177 Bacteria 868
120 Ga0075367_10171676 3300006178 Bacteria 1351
121 Ga0075367_10369056 3300006178 Bacteria 906
122 Ga0075369_10006952 3300006186 Bacteria 4297
123 Ga0075366_10001399 3300006195 Bacteria 12083
124 Ga0075366_10198832 3300006195 Bacteria 1219
125 Ga0075366_10203266 3300006195 Bacteria 1205
126 Ga0097621_100099531 3300006237 Bacteria 2444
127 Ga0097621_101383928 3300006237 Bacteria 666
128 Ga0097621_101582645 3300006237 Bacteria 623
129 Ga0075370_10650705 3300006353 Bacteria 640
130 Ga0068871_100164259 3300006358 Bacteria 1900
131 Ga0068871_101100314 3300006358 Bacteria 743
132 Ga0075428_100322108 3300006844 Bacteria 1661
133 Ga0075434_100238705 3300006871 Bacteria 1838
134 Ga0068865_100256843 3300006881 Bacteria 1382
135 Ga0068865_100338136 3300006881 Bacteria 1216
136 Ga0068865_100625344 3300006881 Bacteria 912
137 Ga0097620_100298996 3300006931 Bacteria 1703
138 Ga0099794_10019338 3300007265 Bacteria 3066
139 Ga0099795_10006365 3300007788 Bacteria 3216
140 Ga0099795_10027813 3300007788 Bacteria 1916
141 Ga0099795_10532575 3300007788 Bacteria 551
142 Ga0105251_10412020 3300009011 Bacteria 622
143 Ga0105250_10156647 3300009092 Bacteria 949
144 Ga0105240_10041230 3300009093 Bacteria 5895
145 Ga0105240_10892688 3300009093 Bacteria 957
146 Ga0111539_10017732 3300009094 Bacteria 8815
147 Ga0111539_11867982 3300009094 Bacteria 696
148 Ga0105245_10364480 3300009098 Bacteria 1435
149 Ga0105245_12382794 3300009098 Bacteria 583
150 Ga0105247_10338552 3300009101 Bacteria 1055
151 Ga0105247_10448835 3300009101 Bacteria 929
152 Ga0105247_10694001 3300009101 Bacteria 765
153 Ga0105247_10779717 3300009101 Unclassified 727
154 Ga0105243_10370078 3300009148 Bacteria 1322
155 Ga0105243_11936631 3300009148 Bacteria 623
156 Ga0105241_10066436 3300009174 Bacteria 2789
157 Ga0105241_10070123 3300009174 Bacteria 2719
158 Ga0105241_10200352 3300009174 Bacteria 1667
159 Ga0105242_10535502 3300009176 Bacteria 1120
160 Ga0105248_10180259 3300009177 Bacteria 2380
161 Ga0105248_10305891 3300009177 Bacteria 1790
162 Ga0105248_10381319 3300009177 Bacteria 1587
163 Ga0105237_10009470 3300009545 Bacteria 10433
164 Ga0105237_10095551 3300009545 Bacteria 2961
165 Ga0105237_10160656 3300009545 Bacteria 2245
166 Ga0105237_10255007 3300009545 Bacteria 1756
167 Ga0105238_10079729 3300009551 Bacteria 3264
168 Ga0105238_10390752 3300009551 Bacteria 1383
169 Ga0105238_10871422 3300009551 Bacteria 918
170 Ga0105238_11795994 3300009551 Bacteria 645
171 Ga0105249_10219056 3300009553 Bacteria 1872
172 Ga0105249_11303130 3300009553 Bacteria 798
173 Ga0099796_10075009 3300010159 Bacteria 1229
174 Ga0099796_10132022 3300010159 Bacteria 969
175 Ga0105239_10015132 3300010375 Bacteria 8551
176 Ga0105239_10050419 3300010375 Bacteria 4565
177 Ga0105239_10149385 3300010375 Bacteria 2607
178 Ga0105239_10281288 3300010375 Bacteria 1873
179 Ga0105246_10395474 3300011119 Bacteria 1146
180 Ga0105246_10488858 3300011119 Bacteria 1043
181 Ga0157327_1010949 3300012512 Bacteria 866
182 Ga0157373_10912637 3300013100 Bacteria 652
183 Ga0157370_10775121 3300013104 Bacteria 873
184 Ga0157369_11767842 3300013105 Bacteria 628
185 Ga0157374_10009372 3300013296 Bacteria 8399
186 Ga0157374_10112802 3300013296 Bacteria 2616
187 Ga0157374_10198560 3300013296 Bacteria 1964
188 Ga0157374_11892295 3300013296 Bacteria 622
189 Ga0157378_10003444 3300013297 Bacteria 14031
190 Ga0157378_10045384 3300013297 Bacteria 3904
191 Ga0157378_10757574 3300013297 Bacteria 994
192 Ga0163162_10153091 3300013306 Bacteria 2424
193 Ga0163162_10220688 3300013306 Bacteria 2026
194 Ga0163162_10484505 3300013306 Bacteria 1368
195 Ga0157372_10105254 3300013307 Bacteria 3227
196 Ga0157372_10263813 3300013307 Bacteria 2000
197 Ga0157375_10022564 3300013308 Bacteria 5794
198 Ga0157375_12342249 3300013308 Bacteria 637
199 Ga0157375_12810108 3300013308 Bacteria 582
200 Ga0163163_10021826 3300014325 Bacteria 6049
201 Ga0163163_10601532 3300014325 Bacteria 1163
202 Ga0163163_10866264 3300014325 Bacteria 967
203 Ga0163163_12310689 3300014325 Bacteria 596
204 Ga0157380_10052522 3300014326 Bacteria 3228
205 Ga0157380_10282031 3300014326 Bacteria 1521
206 Ga0157380_10345536 3300014326 Bacteria 1390
207 Ga0157380_11542881 3300014326 Bacteria 718
208 Ga0157377_10281129 3300014745 Bacteria 1091
209 Ga0157377_10886326 3300014745 Bacteria 666
210 Ga0157379_10680781 3300014968 Bacteria 964
211 Ga0157379_10845509 3300014968 Bacteria 866
212 Ga0157379_11929384 3300014968 Bacteria 582
213 Ga0157376_10293870 3300014969 Bacteria 1535
214 Ga0157376_10319065 3300014969 Bacteria 1477
215 Ga0157376_10422956 3300014969 Bacteria 1293
216 Ga0157376_11170706 3300014969 Bacteria 796
217 Ga0157376_12368150 3300014969 Bacteria 570
218 Ga0213874_10033852 3300021377 Bacteria 1492
219 Ga0213876_10000626 3300021384 Bacteria 25893
220 Ga0224570_111091 3300022730 Bacteria 571
221 Ga0207666_1078688 3300025271 Bacteria 532
222 Ga0209758_1177734 3300025297 Bacteria 514
223 Ga0207697_10093514 3300025315 Bacteria 1276
224 Ga0207682_10161161 3300025893 Bacteria 1016
225 Ga0207692_10079982 3300025898 Bacteria 1745
226 Ga0207710_10256021 3300025900 Bacteria 876
227 Ga0207710_10349430 3300025900 Bacteria 753
228 Ga0207688_10019741 3300025901 Bacteria 3673
229 Ga0207680_10353405 3300025903 Bacteria 1033
230 Ga0207647_10006000 3300025904 Bacteria 8850
231 Ga0207685_10516899 3300025905 Bacteria 630
232 Ga0207645_11137449 3300025907 Bacteria 526
233 Ga0207643_10157747 3300025908 Bacteria 1364
234 Ga0207654_10044682 3300025911 Bacteria 2518
235 Ga0207654_10059976 3300025911 Bacteria 2221
236 Ga0207654_11420636 3300025911 Bacteria 506
237 Ga0207707_11018237 3300025912 Bacteria 679
238 Ga0207671_10011631 3300025914 Bacteria 7142
239 Ga0207671_10044454 3300025914 Bacteria 3285
240 Ga0207671_10189896 3300025914 Bacteria 1602
241 Ga0207693_10184408 3300025915 Bacteria 1643
242 Ga0207693_10233469 3300025915 Bacteria 1444
243 Ga0207663_10159678 3300025916 Bacteria 1590
244 Ga0207660_10473260 3300025917 Bacteria 1015
245 Ga0207657_10940877 3300025919 Bacteria 665
246 Ga0207649_10255417 3300025920 Bacteria 1264
247 Ga0207649_10381526 3300025920 Bacteria 1050
248 Ga0207694_10105853 3300025924 Bacteria 2234
249 Ga0207650_10137944 3300025925 Bacteria 1915
250 Ga0207659_10116985 3300025926 Bacteria 2036
251 Ga0207700_10283011 3300025928 Bacteria 1427
252 Ga0207644_10207088 3300025931 Bacteria 1549
253 Ga0207644_10377303 3300025931 Bacteria 1156
254 Ga0207690_10375064 3300025932 Bacteria 1129
255 Ga0207690_10627002 3300025932 Bacteria 879
256 Ga0207706_10081135 3300025933 Bacteria 2850
257 Ga0207706_10101488 3300025933 Bacteria 2531
258 Ga0207686_10602428 3300025934 Bacteria 865
259 Ga0207709_11198701 3300025935 Bacteria 626
260 Ga0207670_10180841 3300025936 Bacteria 1588
261 Ga0207704_10056511 3300025938 Bacteria 2405
262 Ga0207691_10300062 3300025940 Bacteria 1380
263 Ga0207711_10074279 3300025941 Bacteria 2957
264 Ga0207711_10324839 3300025941 Bacteria 1422
265 Ga0207689_10378945 3300025942 Bacteria 1178
266 Ga0207661_10214387 3300025944 Bacteria 1698
267 Ga0207661_11236350 3300025944 Bacteria 687
268 Ga0207679_10566883 3300025945 Bacteria 1020
269 Ga0207679_10613362 3300025945 Bacteria 981
270 Ga0207679_10987383 3300025945 Bacteria 772
271 Ga0207667_10022120 3300025949 Bacteria 7033
272 Ga0207667_10433078 3300025949 Bacteria 1337
273 Ga0207667_10569263 3300025949 Bacteria 1144
274 Ga0207667_11099942 3300025949 Bacteria 778
275 Ga0207667_11497691 3300025949 Bacteria 646
276 Ga0207651_10229538 3300025960 Bacteria 1506
277 Ga0207712_10375695 3300025961 Bacteria 1188
278 Ga0207668_10794269 3300025972 Bacteria 837
279 Ga0207640_10170186 3300025981 Bacteria 1622
280 Ga0207640_10267614 3300025981 Bacteria 1335
281 Ga0207658_10088818 3300025986 Bacteria 2391
282 Ga0207658_11689491 3300025986 Bacteria 578
283 Ga0207677_10334179 3300026023 Bacteria 1264
284 Ga0207677_10702336 3300026023 Bacteria 897
285 Ga0207703_10010633 3300026035 Bacteria 7190
286 Ga0207703_10411782 3300026035 Bacteria 1256
287 Ga0207639_10789391 3300026041 Bacteria 884
288 Ga0207639_11388887 3300026041 Bacteria 659
289 Ga0207678_10063726 3300026067 Bacteria 3167
290 Ga0207678_10115541 3300026067 Bacteria 2289
291 Ga0207678_10135485 3300026067 Bacteria 2101
292 Ga0207678_10230622 3300026067 Bacteria 1585
293 Ga0207678_10335020 3300026067 Bacteria 1303
294 Ga0207678_10510941 3300026067 Bacteria 1048
295 Ga0207678_10546665 3300026067 Bacteria 1013
296 Ga0207678_10731189 3300026067 Bacteria 872
297 Ga0207708_10257029 3300026075 Bacteria 1409
298 Ga0207708_10312083 3300026075 Bacteria 1281
299 Ga0207708_11106691 3300026075 Bacteria 691
300 Ga0207702_10000350 3300026078 Bacteria 52867
301 Ga0207702_10098523 3300026078 Bacteria 2575
302 Ga0207702_10693403 3300026078 Bacteria 1003
303 Ga0207702_10890872 3300026078 Bacteria 881
304 Ga0207702_12166453 3300026078 Bacteria 545
305 Ga0207641_10405586 3300026088 Bacteria 1310
306 Ga0207641_10621119 3300026088 Bacteria 1059
307 Ga0207641_10647054 3300026088 Bacteria 1038
308 Ga0207648_10861890 3300026089 Bacteria 845
309 Ga0207676_10074199 3300026095 Bacteria 2740
310 Ga0207676_10434943 3300026095 Bacteria 1233
311 Ga0207674_10006945 3300026116 Bacteria 13259
312 Ga0207674_10220520 3300026116 Bacteria 1844
313 Ga0207674_11284086 3300026116 Bacteria 702
314 Ga0207675_101359976 3300026118 Bacteria 731
315 Ga0207683_10010728 3300026121 Bacteria 7811
316 Ga0207683_10041218 3300026121 Bacteria 4031
317 Ga0207683_10334708 3300026121 Bacteria 1388
318 Ga0207698_10589009 3300026142 Bacteria 1095
319 Ga0207698_10794296 3300026142 Bacteria 948
320 Ga0207698_12486035 3300026142 Bacteria 528
321 Ga0268266_10012776 3300028379 Bacteria 7256
322 Ga0268266_10045764 3300028379 Bacteria 3744
323 Ga0268266_10542507 3300028379 Bacteria 1113
324 Ga0268266_11439808 3300028379 Bacteria 664
325 Ga0268265_10253061 3300028380 Bacteria 1561
326 Ga0268265_10429958 3300028380 Bacteria 1228
327 Ga0268265_10977532 3300028380 Bacteria 835
328 Ga0268264_10541188 3300028381 Bacteria 1141
329 Ga0307512_10357854 3300030522 Bacteria 639
330 Ga0265325_10244601 3300031241 Bacteria 814
331 Ga0307513_10049687 3300031456 Bacteria 4541
332 Ga0307513_10211720 3300031456 Bacteria 1769
333 Ga0307513_10384932 3300031456 Bacteria 1141
334 Ga0307508_10091451 3300031616 Bacteria 2631
335 Ga0307508_10179322 3300031616 Bacteria 1721
336 Ga0265314_10256948 3300031711 Bacteria 1000
337 Ga0307516_10620178 3300031730 Bacteria 736
338 Ga0307405_10665599 3300031731 Bacteria 858
339 Ga0307413_10676702 3300031824 Bacteria 854
340 Ga0307406_10090174 3300031901 Bacteria 2062
341 Ga0307407_10124957 3300031903 Bacteria 1637
342 Ga0307412_11068999 3300031911 Bacteria 716
343 Ga0307412_12321800 3300031911 Bacteria 501
344 Ga0307409_101259042 3300031995 Bacteria 764
345 Ga0307409_102374348 3300031995 Bacteria 559
346 Ga0307414_10359313 3300032004 Bacteria 1253
347 Ga0307411_10069110 3300032005 Bacteria 2384
348 Ga0307415_101534073 3300032126 Bacteria 638
349 Ga0307510_10132748 3300033180 Bacteria 2157
350 Ga0307510_10257142 3300033180 Bacteria 1230
351 Ga0373934_0240884 3300035086 Bacteria 747
352 Ga0373952_0009417 3300035092 Bacteria 1870
353 Ga0373923_0040551 3300035111 Bacteria 1917
354 Ga0373936_0004866 3300035113 Bacteria 5061
355 Ga0373941_0019211 3300035115 Bacteria 1899
356 Ga0373945_0257430 3300035116 Bacteria 738
357 Ga0373954_0247087 3300035118 Bacteria 878
358 Ga0373954_0592390 3300035118 Unclassified 550
359 Ga0373957_0059373 3300035120 Bacteria 1479
360 Ga0373943_0017134 3300035170 Bacteria 3314
361 Ga0373946_0008220 3300035171 Bacteria 3829
362 Ga0373955_0175382 3300035172 Bacteria 1270
363 Ga0373962_0113549 3300035242 Bacteria 857
364 Ga0373931_0448687 3300035691 Bacteria 824
365 Ga0373931_0920493 3300035691 Bacteria 588
366 Ga0373935_0023113 3300035692 Bacteria 3818
367 Ga0373935_0064843 3300035692 Bacteria 2343
368 Ga0373927_0001471 3300035695 Bacteria 17726
369 Ga0373927_0030244 3300035695 Bacteria 3534
370 Ga0373927_0061335 3300035695 Bacteria 2433
371 Ga0373927_0480072 3300035695 Bacteria 821
372 Ga0373933_0083515 3300035724 Bacteria 1962
373 Ga0373947_0007952 3300035725 Bacteria 6114
374 Ga0373947_1023700 3300035725 Bacteria 563
375 Ga0373937_0031523 3300036401 Bacteria 4805
376 Ga0373925_0010463 3300037068 Bacteria 6727
377 Ga0395905_0108267 3300037471 Bacteria 2609
378 Ga0436364_0895467 3300037853 Bacteria 589
379 Ga0436365_0547646 3300039437 Bacteria 34965
380 Ga0436363_0755236 3300039450 Bacteria 785
381 Ga0439465_0007496 3300041413 Bacteria 3470
382 Ga0439465_0019042 3300041413 Bacteria 2146
383 Ga0439465_0025241 3300041413 Bacteria 1875
384 Ga0451787_133193 3300041441 Bacteria 534
385 Ga0451797_0692727 3300041453 Bacteria 568
386 Ga0451795_0856195 3300041456 Bacteria 960
387 Ga0451795_1450322 3300041456 Bacteria 507
388 Ga0451802_0079631 3300041460 Bacteria 540
389 Ga0451802_0566185 3300041460 Bacteria 1079
390 Ga0451849_1469277 3300041505 Bacteria 624
391 Ga0451853_3857333 3300041512 Bacteria 738
392 Ga0450905_043000 3300042142 Bacteria 722
393 Ga0439459_0189238 3300042438 Bacteria 557
394 Ga0495592_0024967 3300046454 Bacteria 4540
395 Ga0495592_0260656 3300046454 Bacteria 1142
396 Ga0495592_0347980 3300046454 Bacteria 951
397 Ga0495603_0000387 3300046455 Bacteria 24105
398 Ga0495603_0203838 3300046455 Bacteria 1143
399 Ga0495629_0000417 3300046459 Bacteria 35793
400 Ga0495629_0846168 3300046459 Bacteria 602
401 Ga0495638_0015406 3300046460 Bacteria 5134
402 Ga0495638_0206863 3300046460 Bacteria 1104
403 Ga0495638_0279369 3300046460 Bacteria 908
404 Ga0495641_0006015 3300046461 Bacteria 7989
405 Ga0495651_0222939 3300046462 Bacteria 1304
406 Ga0495651_0396542 3300046462 Bacteria 902
407 Ga0495651_0591040 3300046462 Bacteria 701
408 Ga0495653_0102281 3300046463 Bacteria 2074
409 Ga0495580_0001175 3300046472 Bacteria 23040
410 Ga0495582_0000909 3300046473 Bacteria 16476
411 Ga0495582_0413639 3300046473 Bacteria 778
412 Ga0495639_0000739 3300046475 Bacteria 14934
413 Ga0495662_0000148 3300046476 Bacteria 27496
414 Ga0495662_0068566 3300046476 Bacteria 1718
415 Ga0495662_0682905 3300046476 Bacteria 501
416 Ga0495664_0865328 3300046477 Bacteria 529
417 Ga0495584_0025058 3300046491 Bacteria 3024
418 Ga0495594_0000312 3300046499 Bacteria 23910
419 Ga0495594_0148014 3300046499 Bacteria 1333
420 Ga0495594_0397988 3300046499 Bacteria 784
421 Ga0495606_0006792 3300046507 Bacteria 10457
422 Ga0495606_0357553 3300046507 Bacteria 773
423 Ga0495608_0094368 3300046511 Bacteria 1933
424 Ga0495608_0878462 3300046511 Bacteria 526
425 Ga0495618_0214573 3300046514 Bacteria 1216
426 Ga0495628_0100242 3300046516 Bacteria 2236
427 Ga0495628_1133017 3300046516 Bacteria 533
428 Ga0495630_0005775 3300046517 Bacteria 8745
429 Ga0495630_0173077 3300046517 Bacteria 1645
430 Ga0495632_0206402 3300046519 Bacteria 893
431 Ga0495632_0311339 3300046519 Bacteria 697
432 Ga0495644_0207118 3300046523 Bacteria 757
433 Ga0495666_0113909 3300046526 Bacteria 1269
434 Ga0495665_0000248 3300046531 Bacteria 27116
435 Ga0495640_0014448 3300046533 Bacteria 5976
436 Ga0495622_0003491 3300046557 Bacteria 7404
437 Ga0495633_0353397 3300046558 Bacteria 666
438 Ga0495667_0074342 3300046559 Bacteria 2213
439 Ga0495656_0454105 3300046615 Bacteria 675
440 Ga0495668_0063371 3300046616 Bacteria 2036
441 Ga0495668_0208938 3300046616 Bacteria 1069
442 Ga0495634_0014221 3300046642 Bacteria 5742
443 Ga0495634_0455813 3300046642 Bacteria 754
444 Ga0495611_0063290 3300046648 Bacteria 1683
445 Ga0495635_0001128 3300046663 Bacteria 17791
446 Ga0495661_0343113 3300046665 Bacteria 737
447 Ga0495588_0044830 3300046674 Bacteria 2266
448 Ga0495657_0552258 3300046675 Bacteria 669
449 Ga0495646_0113917 3300046680 Bacteria 1537
450 Ga0495647_0005094 3300046681 Bacteria 4304
451 Ga0495658_0006307 3300046683 Bacteria 5828
452 Ga0495658_0628607 3300046683 Bacteria 688
453 Ga0495669_0083852 3300046684 Bacteria 1465
454 Ga0495669_0144623 3300046684 Bacteria 1123
455 Ga0495613_0019788 3300046689 Bacteria 5016
456 Ga0495613_0822829 3300046689 Bacteria 605
457 Ga0495624_0001790 3300046690 Bacteria 16446
458 Ga0495624_0222371 3300046690 Bacteria 1145
459 Ga0495624_0557417 3300046690 Bacteria 684
460 Ga0495671_0565554 3300046692 Bacteria 541
461 Ga0495649_0543823 3300046694 Bacteria 575
462 Ga0495600_0126697 3300046809 Bacteria 1661
463 Ga0495600_0277534 3300046809 Bacteria 1061
464 Ga0495600_0825173 3300046809 Bacteria 551
465 Ga0495581_0018368 3300047315 Bacteria 4060
466 Ga0495581_0196398 3300047315 Bacteria 1180
467 Ga0495604_0336399 3300047317 Bacteria 1006
468 Ga0495604_0337375 3300047317 Bacteria 1004
469 Ga0495604_0843696 3300047317 Bacteria 575
470 Ga0495674_0002207 3300047319 Bacteria 19142
471 Ga0495672_0489729 3300047320 Bacteria 548
472 Ga0495676_0035384 3300047321 Bacteria 4178
473 Ga0495680_0240425 3300047322 Bacteria 1286
474 Ga0495675_0295612 3300047444 Bacteria 963
475 Ga0495675_0370874 3300047444 Bacteria 839
476 Ga0495684_0008181 3300047471 Bacteria 8093
477 Ga0495686_0636397 3300047472 Bacteria 549
478 Ga0495593_0000312 3300047673 Bacteria 26693
479 Ga0495602_0787576 3300048088 Bacteria 639
480 Ga0495614_0011443 3300048089 Bacteria 3906
481 Ga0495626_0151637 3300048091 Bacteria 977
482 Ga0496100_0121130 3300048903 Bacteria 1830
483 Ga0496100_0194538 3300048903 Bacteria 1474
484 Ga0496100_0783140 3300048903 Bacteria 747
485 Ga0496101_0170959 3300048904 Bacteria 1670
486 Ga0496101_0615126 3300048904 Bacteria 859
487 Ga0496101_1071498 3300048904 Bacteria 633
488 Ga0496102_0041504 3300048905 Bacteria 4166
489 Ga0496102_0702969 3300048905 Bacteria 934
490 Ga0496102_0886682 3300048905 Bacteria 814
491 Ga0496102_0979209 3300048905 Bacteria 766
492 Ga0496103_0044738 3300048906 Bacteria 2729
493 Ga0496103_0492098 3300048906 Bacteria 785
494 Ga0496104_0049725 3300048907 Bacteria 3953
495 Ga0496104_0111577 3300048907 Bacteria 2622
496 Ga0496104_0191020 3300048907 Bacteria 1959
497 Ga0496104_0497662 3300048907 Bacteria 1130
498 Ga0496105_0207273 3300048908 Bacteria 1599
499 Ga0496105_0279096 3300048908 Bacteria 1347
500 Ga0496106_0001807 3300048909 Bacteria 15990
501 Ga0496106_0014272 3300048909 Bacteria 5869
502 Ga0496106_0037402 3300048909 Bacteria 3631
503 Ga0496106_0057261 3300048909 Bacteria 2947
504 Ga0496106_0314370 3300048909 Bacteria 1257
505 Ga0496107_0003099 3300048910 Bacteria 11049
506 Ga0496107_0018511 3300048910 Bacteria 4905
507 Ga0496107_1193752 3300048910 Bacteria 547
508 Ga0496107_1310272 3300048910 Bacteria 518
509 Ga0496108_0001039 3300048911 Bacteria 21656
510 Ga0496108_0066506 3300048911 Bacteria 3039
511 Ga0496108_0183820 3300048911 Bacteria 1811
512 Ga0496108_0242437 3300048911 Bacteria 1568
513 Ga0496108_1627031 3300048911 Bacteria 534
514 Ga0496109_0002576 3300048912 Bacteria 15182
515 Ga0496109_0039743 3300048912 Bacteria 4259
516 Ga0496109_0043350 3300048912 Bacteria 4078
517 Ga0496109_0371738 3300048912 Bacteria 1350
518 Ga0496109_0765871 3300048912 Bacteria 903
519 Ga0496110_0007215 3300048913 Bacteria 8852
520 Ga0496110_0042751 3300048913 Bacteria 3955
521 Ga0496110_0264114 3300048913 Bacteria 1567
522 Ga0496110_0295606 3300048913 Bacteria 1475
523 Ga0496110_1030947 3300048913 Bacteria 730
524 Ga0496111_0107047 3300048914 Bacteria 2058
525 Ga0496111_0118394 3300048914 Bacteria 1955
526 Ga0496111_0180011 3300048914 Bacteria 1571
527 Ga0496111_0260331 3300048914 Bacteria 1287
528 Ga0496112_0009793 3300048915 Bacteria 8655
529 Ga0496112_0037020 3300048915 Bacteria 4762
530 Ga0496112_0205865 3300048915 Bacteria 1926
531 Ga0496112_0532167 3300048915 Bacteria 1109
532 Ga0496113_0169160 3300048916 Bacteria 1730
533 Ga0496113_0373859 3300048916 Bacteria 1144
534 Ga0496113_0411753 3300048916 Bacteria 1086
535 Ga0496113_0488908 3300048916 Bacteria 988
536 Ga0496113_0599115 3300048916 Bacteria 882
537 Ga0496113_0683968 3300048916 Bacteria 819
538 Ga0496114_0042890 3300048917 Bacteria 3750
539 Ga0496114_0172605 3300048917 Unclassified 1885
540 Ga0496114_0512120 3300048917 Bacteria 1061
541 Ga0496114_0603586 3300048917 Bacteria 968
542 Ga0496114_0954178 3300048917 Bacteria 740
543 Ga0496115_0097503 3300048918 Bacteria 2407
544 Ga0496121_0135138 3300048924 Bacteria 1838
545 Ga0496124_0453878 3300048927 Bacteria 873
546 Ga0496125_0377905 3300048928 Bacteria 836
547 Ga0496126_0788082 3300048929 Bacteria 730
548 Ga0495682_0172533 3300049460 Bacteria 769
549 Ga0495682_0309863 3300049460 Bacteria 557
550 Ga0501031_0018688 3300049568 Bacteria 4513
551 Ga0501032_0015955 3300049569 Bacteria 5287
552 Ga0501033_0001175 3300049570 Bacteria 23612
553 Ga0501034_0000061 3300049571 Bacteria 195178
554 Ga0501036_0000387 3300049572 Bacteria 31150
555 Ga0501037_0000104 3300049573 Bacteria 80204
556 Ga0501038_0001943 3300049574 Bacteria 19063
557 Ga0501039_0000536 3300049575 Bacteria 27529
558 Ga0501042_0071107 3300049578 Bacteria 2489
559 Ga0501043_0000161 3300049579 Bacteria 60738
560 Ga0501046_0015172 3300049580 Bacteria 6478
561 Ga0501047_0000122 3300049581 Bacteria 95307
562 Ga0501048_0000053 3300049582 Bacteria 57136
563 Ga0501067_0000194 3300049583 Bacteria 34364
564 Ga0501068_0002729 3300049584 Bacteria 9374
565 Ga0501069_0021922 3300049585 Bacteria 3470
566 Ga0501070_0000659 3300049586 Bacteria 31835
567 Ga0501072_0000606 3300049588 Bacteria 25831
568 Ga0501073_0001231 3300049589 Bacteria 18682
569 Ga0501074_0000656 3300049590 Bacteria 21579
570 Ga0501076_0234592 3300049592 Bacteria 1500
571 Ga0501079_0009521 3300049741 Bacteria 7365
572 Ga0501080_0002669 3300049742 Bacteria 15612
573 Ga0501083_0028017 3300049744 Bacteria 3884
574 Ga0501035_0000099 3300049822 Bacteria 108224
575 Ga0501044_0000195 3300049823 Bacteria 76643
576 Ga0501045_0044670 3300049824 Bacteria 3227
577 nmdc:mga03683_177160_c1 3300050489 Bacteria 971
578 nmdc:mga03n38_107039_c1 3300050490 Bacteria 1356
579 nmdc:mga03n38_854_c1 3300050490 Bacteria 8155
580 nmdc:mga0yw44_105143_c1 3300050492 Bacteria 1803
581 nmdc:mga0yw44_37009_c1 3300050492 Bacteria 2879
582 nmdc:mga0yw44_39389_c1 3300050492 Bacteria 2802
583 nmdc:mga0k408_107902_c1 3300050493 Bacteria 1323
584 nmdc:mga0k408_1639_c1 3300050493 Bacteria 12101
585 nmdc:mga0k408_195646_c1 3300050493 Bacteria 1207
586 nmdc:mga06z11_143117_c1 3300050494 Bacteria 1353
587 nmdc:mga06z11_19334_c1 3300050494 Bacteria 3129
588 nmdc:mga06z11_96577_c1 3300050494 Bacteria 1614
589 nmdc:mga07m45_305338_c1 3300050496 Bacteria 925
590 nmdc:mga07m45_57421_c1 3300050496 Bacteria 2201
591 nmdc:mga07m45_577104_c1 3300050496 Bacteria 650
592 nmdc:mga07m45_665812_c1 3300050496 Bacteria 600
593 nmdc:mga07m45_877298_c1 3300050496 Bacteria 513
594 nmdc:mga08y16_137803_c1 3300050511 Bacteria 2537
595 nmdc:mga0n895_1083211_c1 3300050512 Bacteria 779
596 nmdc:mga0rr50_353657_c1 3300050513 Bacteria 1236
597 Ga0495601_0082279 3300053077 Bacteria 2067
598 Ga0495601_0084762 3300053077 Bacteria 2036
599 Ga0495612_0297982 3300053078 Bacteria 723
600 Ga0500610_0241385 3300053079 Bacteria 840
601 Ga0500635_0152798 3300053080 Bacteria 882
602 Ga0495595_0027397 3300053084 Bacteria 2539
603 Ga0495595_0211033 3300053084 Bacteria 968
604 Ga0495619_0014427 3300053085 Bacteria 4990
605 Ga0495619_0129434 3300053085 Bacteria 1734
606 Ga0495619_0804315 3300053085 Bacteria 636
607 Ga0500643_084220 3300053087 Bacteria 871
608 Ga0500583_0481030 3300053092 Bacteria 585
609 Ga0500566_0118667 3300053094 Bacteria 1429
610 Ga0500641_0006683 3300053096 Bacteria 4098
611 Ga0500641_0032371 3300053096 Bacteria 2068
612 Ga0500654_137197 3300053099 Bacteria 905
613 Ga0500594_0253416 3300053118 Bacteria 586
614 Ga0500621_035358 3300053126 Bacteria 2002
615 Ga0500577_0171351 3300053142 Bacteria 928
616 Ga0500589_100009 3300053147 Bacteria 1261
617 Ga0500604_0018370 3300053151 Bacteria 1948
618 Ga0500604_0125044 3300053151 Bacteria 862
619 Ga0500633_0091568 3300053160 Bacteria 1111
620 Ga0500634_0200635 3300053161 Bacteria 876
621 Ga0500609_030013 3300053731 Bacteria 746
622 Ga0501082_0007057 3300060353 Bacteria 9698
623 2876809290 2876808645 Bacteria 8824342
624 2879112531 2879110137 Bacteria 8907982
625 2922364908 2922361189 Bacteria 7436256
626 8006965343 8006964411 Bacteria 8966052
627 8056683565 8056681323 Bacteria 8472857
628 Ga0439442_124768
629 JGI24739J22299_10020547
630 JGI24737J22298_10009616
631 JGI24745J21846_1025685
632 JGI24034J26672_10069249
633 Ga0065715_10120325
634 Ga0070658_11863953
635 Ga0070683_100281965
636 Ga0070683_100783139
637 Ga0070670_100074830
638 Ga0070670_100756855
639 Ga0068869_100240309
640 Ga0068869_100636811
641 Ga0070682_100164668
642 Ga0070682_101767806
643 Ga0068868_100416053
644 Ga0068868_100897588
645 Ga0070660_100688696
646 Ga0070661_100094178
647 Ga0070661_100160243
648 Ga0070661_100271222
649 Ga0070692_10153477
650 Ga0070668_100813781
651 Ga0070668_101124822
652 Ga0070668_101685823
653 Ga0070675_100100097
654 Ga0070675_100601349
655 Ga0070675_101083379
656 Ga0070674_101369588
657 Ga0070673_101618467
658 Ga0070659_100197047
659 Ga0070659_100258064
660 Ga0070659_100573333
661 Ga0070659_101560165
662 Ga0070667_100418142
663 Ga0070667_101280147
664 Ga0070667_101822804
665 Ga0070709_10353795
666 Ga0070710_10706175
667 Ga0070710_10899510
668 Ga0070711_100595346
669 Ga0070711_100783617
670 Ga0070705_100286856
671 Ga0070700_100250617
672 Ga0070700_100489736
673 Ga0070663_100017501
674 Ga0070663_100066054
675 Ga0070663_100095495
676 Ga0070663_100366664
677 Ga0070663_100564790
678 Ga0070662_100368644
679 Ga0070681_11134016
680 Ga0070684_100011985
681 Ga0070684_100766715
682 Ga0068853_100058719
683 Ga0068853_100082269
684 Ga0068853_100354324
685 Ga0068853_100786433
686 Ga0070686_100094482
687 Ga0070693_100235069
688 Ga0070693_100797145
689 Ga0070665_100019830
690 Ga0070665_100764039
691 Ga0070665_101460635
692 Ga0070704_101396128
693 Ga0070704_101878735
694 Ga0068855_100024639
695 Ga0068855_100236668
696 Ga0068855_100648967
697 Ga0068855_102341363
698 Ga0070664_100506861
699 Ga0068857_100018616
700 Ga0068857_101291419
701 Ga0068857_101694306
702 Ga0068854_100298448
703 Ga0068854_102168928
704 Ga0068856_100021383
705 Ga0068856_100022581
706 Ga0068856_100085774
707 Ga0068856_100505044
708 Ga0068856_100865347
709 Ga0068856_101753544
710 Ga0070702_100116288
711 Ga0068852_100888571
712 Ga0068852_101515357
713 Ga0068852_101578066
714 Ga0068859_100298992
715 Ga0068864_100012299
716 Ga0068864_100185353
717 Ga0068864_101065166
718 Ga0068866_11228505
719 Ga0068870_10076885
720 Ga0068870_11072214
721 Ga0068863_100052926
722 Ga0068858_100048748
723 Ga0068858_100085262
724 Ga0068858_100226200
725 Ga0068860_100415503
726 Ga0068860_102104316
727 Ga0068862_100046807
728 Ga0068862_100507817
729 Ga0068862_100931813
730 Ga0068862_101949996
731 Ga0070717_10180680
732 Ga0075365_10076458
733 Ga0075365_10078694
734 Ga0075365_11318967
735 Ga0075368_10040615
736 Ga0075368_10480382
737 Ga0075368_10567070
738 Ga0075363_100010476
739 Ga0075363_100031746
740 Ga0075364_10255594
741 Ga0075432_10030102
742 Ga0070716_100455024
743 Ga0070712_100405534
744 Ga0070712_100593822
745 Ga0070712_101391786
746 Ga0075362_10252251
747 Ga0075367_10171676
748 Ga0075367_10369056
749 Ga0075369_10006952
750 Ga0075366_10001399
751 Ga0075366_10198832
752 Ga0075366_10203266
753 Ga0097621_100099531
754 Ga0097621_101383928
755 Ga0097621_101582645
756 Ga0075370_10650705
757 Ga0068871_100164259
758 Ga0068871_101100314
759 Ga0075428_100322108
760 Ga0075434_100238705
761 Ga0068865_100256843
762 Ga0068865_100338136
763 Ga0068865_100625344
764 Ga0097620_100298996
765 Ga0099794_10019338
766 Ga0099795_10006365
767 Ga0099795_10027813
768 Ga0099795_10532575
769 Ga0105251_10412020
770 Ga0105250_10156647
771 Ga0105240_10041230
772 Ga0105240_10892688
773 Ga0111539_10017732
774 Ga0111539_11867982
775 Ga0105245_10364480
776 Ga0105245_12382794
777 Ga0105247_10338552
778 Ga0105247_10448835
779 Ga0105247_10694001
780 Ga0105247_10779717
781 Ga0105243_10370078
782 Ga0105243_11936631
783 Ga0105241_10066436
784 Ga0105241_10070123
785 Ga0105241_10200352
786 Ga0105242_10535502
787 Ga0105248_10180259
788 Ga0105248_10305891
789 Ga0105248_10381319
790 Ga0105237_10009470
791 Ga0105237_10095551
792 Ga0105237_10160656
793 Ga0105237_10255007
794 Ga0105238_10079729
795 Ga0105238_10390752
796 Ga0105238_10871422
797 Ga0105238_11795994
798 Ga0105249_10219056
799 Ga0105249_11303130
800 Ga0099796_10075009
801 Ga0099796_10132022
802 Ga0105239_10015132
803 Ga0105239_10050419
804 Ga0105239_10149385
805 Ga0105239_10281288
806 Ga0105246_10395474
807 Ga0105246_10488858
808 Ga0157327_1010949
809 Ga0157373_10912637
810 Ga0157370_10775121
811 Ga0157369_11767842
812 Ga0157374_10009372
813 Ga0157374_10112802
814 Ga0157374_10198560
815 Ga0157374_11892295
816 Ga0157378_10003444
817 Ga0157378_10045384
818 Ga0157378_10757574
819 Ga0163162_10153091
820 Ga0163162_10220688
821 Ga0163162_10484505
822 Ga0157372_10105254
823 Ga0157372_10263813
824 Ga0157375_10022564
825 Ga0157375_12342249
826 Ga0157375_12810108
827 Ga0163163_10021826
828 Ga0163163_10601532
829 Ga0163163_10866264
830 Ga0163163_12310689
831 Ga0157380_10052522
832 Ga0157380_10282031
833 Ga0157380_10345536
834 Ga0157380_11542881
835 Ga0157377_10281129
836 Ga0157377_10886326
837 Ga0157379_10680781
838 Ga0157379_10845509
839 Ga0157379_11929384
840 Ga0157376_10293870
841 Ga0157376_10319065
842 Ga0157376_10422956
843 Ga0157376_11170706
844 Ga0157376_12368150
845 Ga0213874_10033852
846 Ga0213876_10000626
847 Ga0224570_111091
848 Ga0207666_1078688
849 Ga0209758_1177734
850 Ga0207697_10093514
851 Ga0207682_10161161
852 Ga0207692_10079982
853 Ga0207710_10256021
854 Ga0207710_10349430
855 Ga0207688_10019741
856 Ga0207680_10353405
857 Ga0207647_10006000
858 Ga0207685_10516899
859 Ga0207645_11137449
860 Ga0207643_10157747
861 Ga0207654_10044682
862 Ga0207654_10059976
863 Ga0207654_11420636
864 Ga0207707_11018237
865 Ga0207671_10011631
866 Ga0207671_10044454
867 Ga0207671_10189896
868 Ga0207693_10184408
869 Ga0207693_10233469
870 Ga0207663_10159678
871 Ga0207660_10473260
872 Ga0207657_10940877
873 Ga0207649_10255417
874 Ga0207649_10381526
875 Ga0207694_10105853
876 Ga0207650_10137944
877 Ga0207659_10116985
878 Ga0207700_10283011
879 Ga0207644_10207088
880 Ga0207644_10377303
881 Ga0207690_10375064
882 Ga0207690_10627002
883 Ga0207706_10081135
884 Ga0207706_10101488
885 Ga0207686_10602428
886 Ga0207709_11198701
887 Ga0207670_10180841
888 Ga0207704_10056511
889 Ga0207691_10300062
890 Ga0207711_10074279
891 Ga0207711_10324839
892 Ga0207689_10378945
893 Ga0207661_10214387
894 Ga0207661_11236350
895 Ga0207679_10566883
896 Ga0207679_10613362
897 Ga0207679_10987383
898 Ga0207667_10022120
899 Ga0207667_10433078
900 Ga0207667_10569263
901 Ga0207667_11099942
902 Ga0207667_11497691
903 Ga0207651_10229538
904 Ga0207712_10375695
905 Ga0207668_10794269
906 Ga0207640_10170186
907 Ga0207640_10267614
908 Ga0207658_10088818
909 Ga0207658_11689491
910 Ga0207677_10334179
911 Ga0207677_10702336
912 Ga0207703_10010633
913 Ga0207703_10411782
914 Ga0207639_10789391
915 Ga0207639_11388887
916 Ga0207678_10063726
917 Ga0207678_10115541
918 Ga0207678_10135485
919 Ga0207678_10230622
920 Ga0207678_10335020
921 Ga0207678_10510941
922 Ga0207678_10546665
923 Ga0207678_10731189
924 Ga0207708_10257029
925 Ga0207708_10312083
926 Ga0207708_11106691
927 Ga0207702_10000350
928 Ga0207702_10098523
929 Ga0207702_10693403
930 Ga0207702_10890872
931 Ga0207702_12166453
932 Ga0207641_10405586
933 Ga0207641_10621119
934 Ga0207641_10647054
935 Ga0207648_10861890
936 Ga0207676_10074199
937 Ga0207676_10434943
938 Ga0207674_10006945
939 Ga0207674_10220520
940 Ga0207674_11284086
941 Ga0207675_101359976
942 Ga0207683_10010728
943 Ga0207683_10041218
944 Ga0207683_10334708
945 Ga0207698_10589009
946 Ga0207698_10794296
947 Ga0207698_12486035
948 Ga0268266_10012776
949 Ga0268266_10045764
950 Ga0268266_10542507
951 Ga0268266_11439808
952 Ga0268265_10253061
953 Ga0268265_10429958
954 Ga0268265_10977532
955 Ga0268264_10541188
956 Ga0307512_10357854
957 Ga0265325_10244601
958 Ga0307513_10049687
959 Ga0307513_10211720
960 Ga0307513_10384932
961 Ga0307508_10091451
962 Ga0307508_10179322
963 Ga0265314_10256948
964 Ga0307516_10620178
965 Ga0307405_10665599
966 Ga0307413_10676702
967 Ga0307406_10090174
968 Ga0307407_10124957
969 Ga0307412_11068999
970 Ga0307412_12321800
971 Ga0307409_101259042
972 Ga0307409_102374348
973 Ga0307414_10359313
974 Ga0307411_10069110
975 Ga0307415_101534073
976 Ga0307510_10132748
977 Ga0307510_10257142
978 Ga0373934_0240884
979 Ga0373952_0009417
980 Ga0373923_0040551
981 Ga0373936_0004866
982 Ga0373941_0019211
983 Ga0373945_0257430
984 Ga0373954_0247087
985 Ga0373954_0592390
986 Ga0373957_0059373
987 Ga0373943_0017134
988 Ga0373946_0008220
989 Ga0373955_0175382
990 Ga0373962_0113549
991 Ga0373931_0448687
992 Ga0373931_0920493
993 Ga0373935_0023113
994 Ga0373935_0064843
995 Ga0373927_0001471
996 Ga0373927_0030244
997 Ga0373927_0061335
998 Ga0373927_0480072
999 Ga0373933_0083515
1000 Ga0373947_0007952
1001 Ga0373947_1023700
1002 Ga0373937_0031523
1003 Ga0373925_0010463
1004 Ga0395905_0108267
1005 Ga0436364_0895467
1006 Ga0436365_0547646
1007 Ga0436363_0755236
1008 Ga0439465_0007496
1009 Ga0439465_0019042
1010 Ga0439465_0025241
1011 Ga0451787_133193
1012 Ga0451797_0692727
1013 Ga0451795_0856195
1014 Ga0451795_1450322
1015 Ga0451802_0079631
1016 Ga0451802_0566185
1017 Ga0451849_1469277
1018 Ga0451853_3857333
1019 Ga0450905_043000
1020 Ga0439459_0189238
1021 Ga0495592_0024967
1022 Ga0495592_0260656
1023 Ga0495592_0347980
1024 Ga0495603_0000387
1025 Ga0495603_0203838
1026 Ga0495629_0000417
1027 Ga0495629_0846168
1028 Ga0495638_0015406
1029 Ga0495638_0206863
1030 Ga0495638_0279369
1031 Ga0495641_0006015
1032 Ga0495651_0222939
1033 Ga0495651_0396542
1034 Ga0495651_0591040
1035 Ga0495653_0102281
1036 Ga0495580_0001175
1037 Ga0495582_0000909
1038 Ga0495582_0413639
1039 Ga0495639_0000739
1040 Ga0495662_0000148
1041 Ga0495662_0068566
1042 Ga0495662_0682905
1043 Ga0495664_0865328
1044 Ga0495584_0025058
1045 Ga0495594_0000312
1046 Ga0495594_0148014
1047 Ga0495594_0397988
1048 Ga0495606_0006792
1049 Ga0495606_0357553
1050 Ga0495608_0094368
1051 Ga0495608_0878462
1052 Ga0495618_0214573
1053 Ga0495628_0100242
1054 Ga0495628_1133017
1055 Ga0495630_0005775
1056 Ga0495630_0173077
1057 Ga0495632_0206402
1058 Ga0495632_0311339
1059 Ga0495644_0207118
1060 Ga0495666_0113909
1061 Ga0495665_0000248
1062 Ga0495640_0014448
1063 Ga0495622_0003491
1064 Ga0495633_0353397
1065 Ga0495667_0074342
1066 Ga0495656_0454105
1067 Ga0495668_0063371
1068 Ga0495668_0208938
1069 Ga0495634_0014221
1070 Ga0495634_0455813
1071 Ga0495611_0063290
1072 Ga0495635_0001128
1073 Ga0495661_0343113
1074 Ga0495588_0044830
1075 Ga0495657_0552258
1076 Ga0495646_0113917
1077 Ga0495647_0005094
1078 Ga0495658_0006307
1079 Ga0495658_0628607
1080 Ga0495669_0083852
1081 Ga0495669_0144623
1082 Ga0495613_0019788
1083 Ga0495613_0822829
1084 Ga0495624_0001790
1085 Ga0495624_0222371
1086 Ga0495624_0557417
1087 Ga0495671_0565554
1088 Ga0495649_0543823
1089 Ga0495600_0126697
1090 Ga0495600_0277534
1091 Ga0495600_0825173
1092 Ga0495581_0018368
1093 Ga0495581_0196398
1094 Ga0495604_0336399
1095 Ga0495604_0337375
1096 Ga0495604_0843696
1097 Ga0495674_0002207
1098 Ga0495672_0489729
1099 Ga0495676_0035384
1100 Ga0495680_0240425
1101 Ga0495675_0295612
1102 Ga0495675_0370874
1103 Ga0495684_0008181
1104 Ga0495686_0636397
1105 Ga0495593_0000312
1106 Ga0495602_0787576
1107 Ga0495614_0011443
1108 Ga0495626_0151637
1109 Ga0496100_0121130
1110 Ga0496100_0194538
1111 Ga0496100_0783140
1112 Ga0496101_0170959
1113 Ga0496101_0615126
1114 Ga0496101_1071498
1115 Ga0496102_0041504
1116 Ga0496102_0702969
1117 Ga0496102_0886682
1118 Ga0496102_0979209
1119 Ga0496103_0044738
1120 Ga0496103_0492098
1121 Ga0496104_0049725
1122 Ga0496104_0111577
1123 Ga0496104_0191020
1124 Ga0496104_0497662
1125 Ga0496105_0207273
1126 Ga0496105_0279096
1127 Ga0496106_0001807
1128 Ga0496106_0014272
1129 Ga0496106_0037402
1130 Ga0496106_0057261
1131 Ga0496106_0314370
1132 Ga0496107_0003099
1133 Ga0496107_0018511
1134 Ga0496107_1193752
1135 Ga0496107_1310272
1136 Ga0496108_0001039
1137 Ga0496108_0066506
1138 Ga0496108_0183820
1139 Ga0496108_0242437
1140 Ga0496108_1627031
1141 Ga0496109_0002576
1142 Ga0496109_0039743
1143 Ga0496109_0043350
1144 Ga0496109_0371738
1145 Ga0496109_0765871
1146 Ga0496110_0007215
1147 Ga0496110_0042751
1148 Ga0496110_0264114
1149 Ga0496110_0295606
1150 Ga0496110_1030947
1151 Ga0496111_0107047
1152 Ga0496111_0118394
1153 Ga0496111_0180011
1154 Ga0496111_0260331
1155 Ga0496112_0009793
1156 Ga0496112_0037020
1157 Ga0496112_0205865
1158 Ga0496112_0532167
1159 Ga0496113_0169160
1160 Ga0496113_0373859
1161 Ga0496113_0411753
1162 Ga0496113_0488908
1163 Ga0496113_0599115
1164 Ga0496113_0683968
1165 Ga0496114_0042890
1166 Ga0496114_0172605
1167 Ga0496114_0512120
1168 Ga0496114_0603586
1169 Ga0496114_0954178
1170 Ga0496115_0097503
1171 Ga0496121_0135138
1172 Ga0496124_0453878
1173 Ga0496125_0377905
1174 Ga0496126_0788082
1175 Ga0495682_0172533
1176 Ga0495682_0309863
1177 Ga0501031_0018688
1178 Ga0501032_0015955
1179 Ga0501033_0001175
1180 Ga0501034_0000061
1181 Ga0501036_0000387
1182 Ga0501037_0000104
1183 Ga0501038_0001943
1184 Ga0501039_0000536
1185 Ga0501042_0071107
1186 Ga0501043_0000161
1187 Ga0501046_0015172
1188 Ga0501047_0000122
1189 Ga0501048_0000053
1190 Ga0501067_0000194
1191 Ga0501068_0002729
1192 Ga0501069_0021922
1193 Ga0501070_0000659
1194 Ga0501072_0000606
1195 Ga0501073_0001231
1196 Ga0501074_0000656
1197 Ga0501076_0234592
1198 Ga0501079_0009521
1199 Ga0501080_0002669
1200 Ga0501083_0028017
1201 Ga0501035_0000099
1202 Ga0501044_0000195
1203 Ga0501045_0044670
1204 nmdc:mga03683_177160_c1
1205 nmdc:mga03n38_107039_c1
1206 nmdc:mga03n38_854_c1
1207 nmdc:mga0yw44_105143_c1
1208 nmdc:mga0yw44_37009_c1
1209 nmdc:mga0yw44_39389_c1
1210 nmdc:mga0k408_107902_c1
1211 nmdc:mga0k408_1639_c1
1212 nmdc:mga0k408_195646_c1
1213 nmdc:mga06z11_143117_c1
1214 nmdc:mga06z11_19334_c1
1215 nmdc:mga06z11_96577_c1
1216 nmdc:mga07m45_305338_c1
1217 nmdc:mga07m45_57421_c1
1218 nmdc:mga07m45_577104_c1
1219 nmdc:mga07m45_665812_c1
1220 nmdc:mga07m45_877298_c1
1221 nmdc:mga08y16_137803_c1
1222 nmdc:mga0n895_1083211_c1
1223 nmdc:mga0rr50_353657_c1
1224 Ga0495601_0082279
1225 Ga0495601_0084762
1226 Ga0495612_0297982
1227 Ga0500610_0241385
1228 Ga0500635_0152798
1229 Ga0495595_0027397
1230 Ga0495595_0211033
1231 Ga0495619_0014427
1232 Ga0495619_0129434
1233 Ga0495619_0804315
1234 Ga0500643_084220
1235 Ga0500583_0481030
1236 Ga0500566_0118667
1237 Ga0500641_0006683
1238 Ga0500641_0032371
1239 Ga0500654_137197
1240 Ga0500594_0253416
1241 Ga0500621_035358
1242 Ga0500577_0171351
1243 Ga0500589_100009
1244 Ga0500604_0018370
1245 Ga0500604_0125044
1246 Ga0500633_0091568
1247 Ga0500634_0200635
1248 Ga0500609_030013
1249 Ga0501082_0007057
1250 2876809290
1251 2879112531
1252 2922364908
1253 8006965343
1254 8056683565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ifg-assembly1.cif.gz_B crystal structure of higa-higb complex from e. coli 0.5737 38 94
6jq4-assembly1.cif.gz_A higa escherichia coli-k12 0.5607 38 103
6tmg-assembly1.cif.gz_q cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, membrane region model 0.5385 56 103
7npv-assembly1.cif.gz_D4 mycp5-free esx-5 inner membrane complex, state ii 0.4294 19 95
5x11-assembly1.cif.gz_A crystal structure of bacillus subtilis padr in complex with operator dna 0.3928 1 100
ID Description Score Start End Superfamily
af_A0A2R8QAU3_1_106_1.10.1050.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain 0.6285 41 91 1.10.1050.10
af_P67701_1_63_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5845 38 94 1.20.58.80
af_P67701_1_63_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5212 38 94 1.20.58.80
af_Q9NV31_4_118_1.10.1050.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain 0.4898 6 99 1.10.1050.10
af_Q4CT52_100_242_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.4813 13 103 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A512BRX8-F1-model_v4 Uncharacterized protein 0.8719 38 98
AF-A0A021X9P7-F1-model_v4 Uncharacterized protein 0.8708 35 103
AF-A0A7W2GUY7-F1-model_v4 deleted 0.8391 37 103
AF-B0U9F2-F1-model_v4 deleted 0.8215 1 102
AF-A0A4R2GQ55-F1-model_v4 Uncharacterized protein 0.8214 35 99

Map