F470537

General Info

Members Datasets Scaffolds Average Seq Length
627 238 1254 123

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100003824|Ga0070711_1000038247
Length 143
Sequence MSNAPIPAHAAQNCGWPRKSKMKRSHRKNWNAVNAASLARWIVMTAFLALAGLSYVYLTLQLYHLGERKKAVENELISLRTQNDVASVQIAALTSRSALQRRLKEGYLKMIPISENNIVRLTIPARPAEEDAIQPVANRSRLR

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
96 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
195 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
238 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 4.47
Rhizosphere 94.9
Stem 0
Stem Tuber 0
Unclassified 45.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100003824 3300005439 Bacteria 8842
2 SwRhRL2b_contig_3434452 2162886007 Bacteria 3882
3 MBSR1b_contig_6760597 2162886012 Unclassified 873
4 JGI24746J21847_1005009 3300001977 Unclassified 2075
5 JGI24750J21931_1025851 3300002070 Unclassified 843
6 JGI25404J52841_10072869 3300003659 Unclassified 718
7 Ga0065703_1022475 3300005272 Bacteria 903
8 Ga0065704_10017679 3300005289 Bacteria 1419
9 Ga0065704_10094320 3300005289 Unclassified 2532
10 Ga0065704_10202793 3300005289 Unclassified 1139
11 Ga0065704_10229432 3300005289 Unclassified 1048
12 Ga0065704_10375795 3300005289 Unclassified 779
13 Ga0065704_10439644 3300005289 Bacteria 715
14 Ga0065712_10001064 3300005290 Bacteria 10541
15 Ga0065712_10020335 3300005290 Unclassified 1993
16 Ga0065712_10132930 3300005290 Bacteria 1528
17 Ga0065712_10136744 3300005290 Bacteria 1490
18 Ga0065712_10137278 3300005290 Bacteria 1473
19 Ga0065712_10194486 3300005290 Unclassified 1134
20 Ga0065712_10321977 3300005290 Unclassified 822
21 Ga0065712_10487132 3300005290 Bacteria 658
22 Ga0065715_10000989 3300005293 Bacteria 7981
23 Ga0065715_10034440 3300005293 Unclassified 1284
24 Ga0065715_10043178 3300005293 Bacteria 2440
25 Ga0065715_10108246 3300005293 Bacteria 2729
26 Ga0065715_10143749 3300005293 Bacteria 1816
27 Ga0065715_10208422 3300005293 Bacteria 1326
28 Ga0065715_10242670 3300005293 Bacteria 1194
29 Ga0065715_10620470 3300005293 Unclassified 689
30 Ga0065715_10640652 3300005293 Unclassified 684
31 Ga0065715_10658621 3300005293 Unclassified 674
32 Ga0065715_10755459 3300005293 Unclassified 628
33 Ga0065715_11178995 3300005293 Unclassified 501
34 Ga0065707_10006439 3300005295 Bacteria 4880
35 Ga0065707_10212411 3300005295 Unclassified 1259
36 Ga0065707_10218825 3300005295 Bacteria 1233
37 Ga0065707_10318317 3300005295 Bacteria 971
38 Ga0065707_10344687 3300005295 Unclassified 928
39 Ga0070676_10014349 3300005328 Bacteria 4354
40 Ga0070676_10227106 3300005328 Unclassified 1236
41 Ga0070676_10265958 3300005328 Unclassified 1150
42 Ga0070683_100051450 3300005329 Unclassified 3814
43 Ga0070690_101698858 3300005330 Bacteria 513
44 Ga0068869_100045337 3300005334 Unclassified 3165
45 Ga0070680_100066605 3300005336 Unclassified 2953
46 Ga0070680_101235735 3300005336 Unclassified 646
47 Ga0070682_101010201 3300005337 Unclassified 691
48 Ga0068868_100020223 3300005338 Bacteria 4998
49 Ga0068868_100177970 3300005338 Bacteria 1763
50 Ga0068868_100182693 3300005338 Unclassified 1741
51 Ga0068868_101318217 3300005338 Bacteria 671
52 Ga0070660_100119923 3300005339 Bacteria 2099
53 Ga0070689_100004952 3300005340 Bacteria 9040
54 Ga0070689_100017621 3300005340 Bacteria 5249
55 Ga0070689_100110414 3300005340 Unclassified 2186
56 Ga0070689_100934861 3300005340 Unclassified 768
57 Ga0070689_101253774 3300005340 Unclassified 667
58 Ga0070687_100006902 3300005343 Bacteria 4689
59 Ga0070687_100015727 3300005343 Unclassified 3429
60 Ga0070661_100062115 3300005344 Unclassified 2742
61 Ga0070661_100627410 3300005344 Bacteria 871
62 Ga0070692_10289334 3300005345 Unclassified 996
63 Ga0070668_100008617 3300005347 Bacteria 7575
64 Ga0070668_100074085 3300005347 Bacteria 2655
65 Ga0070669_100004754 3300005353 Bacteria 9793
66 Ga0070669_100351904 3300005353 Unclassified 1196
67 Ga0070669_101117990 3300005353 Unclassified 679
68 Ga0070669_101597761 3300005353 Bacteria 568
69 Ga0070675_100003834 3300005354 Bacteria 11405
70 Ga0070675_100018650 3300005354 Bacteria 5523
71 Ga0070675_100074977 3300005354 Unclassified 2811
72 Ga0070675_100238711 3300005354 Unclassified 1588
73 Ga0070675_101148162 3300005354 Unclassified 715
74 Ga0070671_100068495 3300005355 Bacteria 2960
75 Ga0070671_100078592 3300005355 Unclassified 2757
76 Ga0070671_100677636 3300005355 Unclassified 894
77 Ga0070673_100026241 3300005364 Bacteria 4301
78 Ga0070673_100065293 3300005364 Unclassified 2903
79 Ga0070673_100141057 3300005364 Bacteria 2033
80 Ga0070673_100832648 3300005364 Bacteria 853
81 Ga0070673_100854433 3300005364 Unclassified 842
82 Ga0070673_101280299 3300005364 Bacteria 688
83 Ga0070688_100002253 3300005365 Bacteria 9735
84 Ga0070688_100040787 3300005365 Bacteria 2846
85 Ga0070688_100090290 3300005365 Bacteria 2000
86 Ga0070688_100219939 3300005365 Unclassified 1338
87 Ga0070688_100333556 3300005365 Bacteria 1105
88 Ga0070688_101040028 3300005365 Unclassified 652
89 Ga0070659_100002447 3300005366 Bacteria 13195
90 Ga0070659_100019125 3300005366 Bacteria 5182
91 Ga0070659_100241984 3300005366 Bacteria 1494
92 Ga0070659_100289940 3300005366 Unclassified 1363
93 Ga0070667_100011531 3300005367 Bacteria 7306
94 Ga0070667_100342637 3300005367 Bacteria 1352
95 Ga0070667_100572988 3300005367 Unclassified 1039
96 Ga0070709_10024380 3300005434 Bacteria 3560
97 Ga0070709_10069224 3300005434 Bacteria 2272
98 Ga0070714_100039161 3300005435 Unclassified 3989
99 Ga0070714_100282331 3300005435 Unclassified 1543
100 Ga0070714_100596438 3300005435 Unclassified 1060
101 Ga0070714_101031697 3300005435 Unclassified 801
102 Ga0070714_101057126 3300005435 Unclassified 791
103 Ga0070713_100033365 3300005436 Unclassified 4122
104 Ga0070713_100180597 3300005436 Bacteria 1896
105 Ga0070713_100531042 3300005436 Unclassified 1113
106 Ga0070710_10015956 3300005437 Bacteria 3811
107 Ga0070710_10116098 3300005437 Bacteria 1614
108 Ga0070701_10194296 3300005438 Bacteria 1196
109 Ga0070711_100076045 3300005439 Bacteria 2379
110 Ga0070711_100167673 3300005439 Bacteria 1671
111 Ga0070711_101180193 3300005439 Unclassified 662
112 Ga0070705_100013479 3300005440 Bacteria 4183
113 Ga0070705_100108098 3300005440 Unclassified 1771
114 Ga0070705_100191789 3300005440 Bacteria 1393
115 Ga0070705_100559772 3300005440 Unclassified 878
116 Ga0070700_100007347 3300005441 Bacteria 5943
117 Ga0070694_100069047 3300005444 Unclassified 2430
118 Ga0070694_100630146 3300005444 Unclassified 866
119 Ga0070708_100041784 3300005445 Bacteria 4021
120 Ga0070708_100068450 3300005445 Unclassified 3191
121 Ga0070708_100079978 3300005445 Bacteria 2957
122 Ga0070708_100085274 3300005445 Bacteria 2867
123 Ga0070708_100122168 3300005445 Bacteria 2403
124 Ga0070708_100250568 3300005445 Unclassified 1664
125 Ga0070708_100279987 3300005445 Unclassified 1570
126 Ga0070708_100417106 3300005445 Bacteria 1266
127 Ga0070708_100478483 3300005445 Bacteria 1175
128 Ga0070708_100528274 3300005445 Bacteria 1113
129 Ga0070708_100755964 3300005445 Unclassified 914
130 Ga0070708_100784305 3300005445 Unclassified 896
131 Ga0070708_101251842 3300005445 Unclassified 693
132 Ga0070708_101645141 3300005445 Bacteria 597
133 Ga0070678_100077298 3300005456 Unclassified 2510
134 Ga0070678_100161706 3300005456 Bacteria 1815
135 Ga0070678_100378801 3300005456 Unclassified 1224
136 Ga0070678_101530102 3300005456 Unclassified 625
137 Ga0070678_101758923 3300005456 Unclassified 584
138 Ga0070662_100013958 3300005457 Bacteria 5352
139 Ga0070662_100037879 3300005457 Bacteria 3421
140 Ga0070662_100195624 3300005457 Unclassified 1601
141 Ga0070662_100197453 3300005457 Unclassified 1594
142 Ga0070662_101244077 3300005457 Unclassified 640
143 Ga0070681_11109205 3300005458 Unclassified 712
144 Ga0068867_100745107 3300005459 Bacteria 869
145 Ga0070685_10173652 3300005466 Unclassified 1383
146 Ga0070706_100000072 3300005467 Bacteria 117347
147 Ga0070706_100005471 3300005467 Bacteria 12096
148 Ga0070706_100009390 3300005467 Bacteria 9107
149 Ga0070706_100010249 3300005467 Bacteria 8707
150 Ga0070706_100029223 3300005467 Bacteria 5078
151 Ga0070706_100086460 3300005467 Bacteria 2905
152 Ga0070706_100108979 3300005467 Bacteria 2577
153 Ga0070706_100122721 3300005467 Unclassified 2422
154 Ga0070706_100371263 3300005467 Bacteria 1333
155 Ga0070706_100374216 3300005467 Bacteria 1327
156 Ga0070706_100508294 3300005467 Unclassified 1121
157 Ga0070706_100516705 3300005467 Unclassified 1111
158 Ga0070706_100917930 3300005467 Bacteria 809
159 Ga0070706_101270453 3300005467 Unclassified 675
160 Ga0070707_100000109 3300005468 Bacteria 75892
161 Ga0070707_100004502 3300005468 Bacteria 13057
162 Ga0070707_100033745 3300005468 Unclassified 4879
163 Ga0070707_100033967 3300005468 Bacteria 4865
164 Ga0070707_100049869 3300005468 Bacteria 4013
165 Ga0070707_100099460 3300005468 Unclassified 2818
166 Ga0070707_100123184 3300005468 Unclassified 2517
167 Ga0070707_100232323 3300005468 Bacteria 1795
168 Ga0070707_100270606 3300005468 Bacteria 1652
169 Ga0070707_100390504 3300005468 Unclassified 1351
170 Ga0070707_100844674 3300005468 Bacteria 880
171 Ga0070707_100907253 3300005468 Bacteria 846
172 Ga0070698_100002781 3300005471 Bacteria 19252
173 Ga0070698_100043014 3300005471 Bacteria 4632
174 Ga0070698_100096291 3300005471 Bacteria 2936
175 Ga0070698_100268167 3300005471 Bacteria 1639
176 Ga0070698_100462911 3300005471 Unclassified 1204
177 Ga0070698_100518069 3300005471 Bacteria 1131
178 Ga0070698_100549958 3300005471 Unclassified 1094
179 Ga0070699_100048712 3300005518 Bacteria 3667
180 Ga0070699_100462884 3300005518 Bacteria 1150
181 Ga0070699_100578712 3300005518 Unclassified 1023
182 Ga0070699_100679955 3300005518 Unclassified 940
183 Ga0070679_100079603 3300005530 Unclassified 3266
184 Ga0070684_100000339 3300005535 Bacteria 32322
185 Ga0070684_100011918 3300005535 Bacteria 6943
186 Ga0070697_100000972 3300005536 Bacteria 21638
187 Ga0070697_100002822 3300005536 Bacteria 13360
188 Ga0070697_100006284 3300005536 Bacteria 9197
189 Ga0070697_100006722 3300005536 Bacteria 8923
190 Ga0070697_100041385 3300005536 Bacteria 3729
191 Ga0070697_100043601 3300005536 Bacteria 3633
192 Ga0070697_100063362 3300005536 Bacteria 3019
193 Ga0070697_100206732 3300005536 Unclassified 1670
194 Ga0070697_100287079 3300005536 Bacteria 1413
195 Ga0070697_100691538 3300005536 Bacteria 900
196 Ga0070697_101467012 3300005536 Unclassified 609
197 Ga0070697_101625041 3300005536 Bacteria 578
198 Ga0070672_100091043 3300005543 Unclassified 2461
199 Ga0070672_100558217 3300005543 Bacteria 995
200 Ga0070672_101420624 3300005543 Bacteria 621
201 Ga0070686_100737559 3300005544 Bacteria 789
202 Ga0070693_100196586 3300005547 Bacteria 1307
203 Ga0070693_100480160 3300005547 Bacteria 878
204 Ga0070665_100026148 3300005548 Bacteria 5877
205 Ga0070665_100044098 3300005548 Unclassified 4479
206 Ga0070665_100194261 3300005548 Unclassified 2030
207 Ga0070665_101359483 3300005548 Unclassified 720
208 Ga0070665_102560971 3300005548 Unclassified 511
209 Ga0068855_100995961 3300005563 Unclassified 881
210 Ga0068855_102613598 3300005563 Bacteria 501
211 Ga0070664_100019044 3300005564 Bacteria 5644
212 Ga0070664_100747533 3300005564 Unclassified 913
213 Ga0070664_101621615 3300005564 Unclassified 613
214 Ga0068857_101477572 3300005577 Unclassified 662
215 Ga0068856_100132185 3300005614 Unclassified 2500
216 Ga0068856_100492843 3300005614 Bacteria 1246
217 Ga0068856_101157714 3300005614 Unclassified 790
218 Ga0068859_100122181 3300005617 Unclassified 2671
219 Ga0068864_101706582 3300005618 Bacteria 634
220 Ga0068864_101817147 3300005618 Bacteria 615
221 Ga0068866_10589270 3300005718 Unclassified 749
222 Ga0068861_100188944 3300005719 Bacteria 1720
223 Ga0068861_100460535 3300005719 Unclassified 1141
224 Ga0068861_101096719 3300005719 Unclassified 765
225 Ga0068863_100028985 3300005841 Bacteria 5287
226 Ga0068863_100187212 3300005841 Bacteria 1989
227 Ga0068863_100222101 3300005841 Unclassified 1821
228 Ga0068858_100136552 3300005842 Bacteria 2301
229 Ga0068858_102585579 3300005842 Unclassified 501
230 Ga0068860_100007141 3300005843 Bacteria 11173
231 Ga0068860_100016535 3300005843 Bacteria 7195
232 Ga0068860_100530428 3300005843 Bacteria 1178
233 Ga0068860_100955990 3300005843 Unclassified 874
234 Ga0068862_100023514 3300005844 Bacteria 5164
235 Ga0068862_100837204 3300005844 Unclassified 901
236 Ga0081455_10001013 3300005937 Bacteria 35565
237 Ga0081455_10001533 3300005937 Bacteria 28455
238 Ga0081455_10001733 3300005937 Bacteria 26391
239 Ga0081455_10015737 3300005937 Bacteria 7328
240 Ga0081455_10032715 3300005937 Unclassified 4684
241 Ga0081455_10109261 3300005937 Unclassified 2201
242 Ga0081455_10162310 3300005937 Bacteria 1711
243 Ga0081540_1000219 3300005983 Bacteria 60720
244 Ga0081540_1015104 3300005983 Bacteria 4901
245 Ga0081540_1037572 3300005983 Bacteria 2564
246 Ga0081539_10006483 3300005985 Bacteria 11201
247 Ga0081539_10021018 3300005985 Bacteria 4380
248 Ga0070717_10001521 3300006028 Bacteria 16061
249 Ga0070717_10035293 3300006028 Unclassified 4047
250 Ga0070717_10131765 3300006028 Bacteria 2150
251 Ga0070717_10138149 3300006028 Bacteria 2100
252 Ga0070717_10159582 3300006028 Unclassified 1956
253 Ga0070717_10165854 3300006028 Unclassified 1919
254 Ga0070717_10374248 3300006028 Unclassified 1276
255 Ga0070717_10424435 3300006028 Unclassified 1196
256 Ga0070717_10579111 3300006028 Bacteria 1018
257 Ga0070717_10902118 3300006028 Unclassified 805
258 Ga0070715_10027744 3300006163 Bacteria 2264
259 Ga0070715_10692793 3300006163 Unclassified 608
260 Ga0070716_100058481 3300006173 Bacteria 2219
261 Ga0070716_100128963 3300006173 Bacteria 1596
262 Ga0070716_100327038 3300006173 Unclassified 1076
263 Ga0070716_100417835 3300006173 Unclassified 969
264 Ga0070716_100501710 3300006173 Bacteria 895
265 Ga0070716_101056496 3300006173 Unclassified 645
266 Ga0070716_101563517 3300006173 Unclassified 541
267 Ga0070712_100011735 3300006175 Bacteria 5566
268 Ga0070712_100022920 3300006175 Bacteria 4117
269 Ga0070712_100030331 3300006175 Bacteria 3632
270 Ga0070712_100047912 3300006175 Unclassified 2960
271 Ga0070712_100137080 3300006175 Bacteria 1862
272 Ga0070712_100192324 3300006175 Bacteria 1597
273 Ga0070712_101663655 3300006175 Unclassified 559
274 Ga0070712_101698782 3300006175 Unclassified 553
275 Ga0097621_100187001 3300006237 Bacteria 1792
276 Ga0068871_101588954 3300006358 Unclassified 619
277 Ga0075428_100157559 3300006844 Unclassified 2466
278 Ga0075428_100232614 3300006844 Bacteria 1989
279 Ga0075428_100297121 3300006844 Bacteria 1737
280 Ga0075434_100857505 3300006871 Bacteria 924
281 Ga0075434_100980788 3300006871 Unclassified 859
282 Ga0075434_101592427 3300006871 Bacteria 662
283 Ga0068865_100092212 3300006881 Bacteria 2200
284 Ga0068865_100263890 3300006881 Bacteria 1364
285 Ga0068865_100389191 3300006881 Unclassified 1139
286 Ga0068865_101051937 3300006881 Unclassified 715
287 Ga0075436_100033364 3300006914 Bacteria 3549
288 Ga0097620_100122180 3300006931 Unclassified 2671
289 Ga0075435_100472888 3300007076 Bacteria 1082
290 Ga0099794_10047721 3300007265 Bacteria 2054
291 Ga0099794_10154287 3300007265 Unclassified 1166
292 Ga0099794_10218460 3300007265 Bacteria 979
293 Ga0099794_10262184 3300007265 Unclassified 892
294 Ga0105245_10144256 3300009098 Unclassified 2245
295 Ga0105245_10385283 3300009098 Bacteria 1397
296 Ga0105245_13248276 3300009098 Unclassified 503
297 Ga0105247_10142308 3300009101 Unclassified 1573
298 Ga0105247_10879572 3300009101 Unclassified 690
299 Ga0114129_10008863 3300009147 Bacteria 14354
300 Ga0114129_10316491 3300009147 Bacteria 2076
301 Ga0114129_10366260 3300009147 Unclassified 1906
302 Ga0114129_11308582 3300009147 Bacteria 898
303 Ga0114129_11957369 3300009147 Unclassified 710
304 Ga0105243_11751143 3300009148 Unclassified 651
305 Ga0105243_12291887 3300009148 Unclassified 577
306 Ga0105241_11230855 3300009174 Unclassified 710
307 Ga0105242_10072817 3300009176 Bacteria 2855
308 Ga0105242_10844249 3300009176 Unclassified 911
309 Ga0105248_12310537 3300009177 Unclassified 612
310 Ga0105249_10006132 3300009553 Bacteria 10429
311 Ga0099796_10354835 3300010159 Unclassified 633
312 Ga0105239_10010133 3300010375 Bacteria 10563
313 Ga0105239_10321735 3300010375 Unclassified 1744
314 Ga0105239_12086960 3300010375 Unclassified 658
315 Ga0157318_1017338 3300012482 Unclassified 607
316 Ga0157342_1006117 3300012507 Bacteria 1127
317 Ga0157371_10229925 3300013102 Bacteria 1333
318 Ga0157370_10139506 3300013104 Bacteria 2259
319 Ga0157369_12218099 3300013105 Unclassified 557
320 Ga0157374_10017287 3300013296 Bacteria 6347
321 Ga0157374_10054286 3300013296 Bacteria 3737
322 Ga0157374_10091230 3300013296 Bacteria 2905
323 Ga0157374_10131036 3300013296 Bacteria 2427
324 Ga0157374_10535697 3300013296 Bacteria 1178
325 Ga0157378_10005373 3300013297 Bacteria 11235
326 Ga0157378_10139027 3300013297 Bacteria 2254
327 Ga0157378_10144731 3300013297 Bacteria 2210
328 Ga0157378_10685852 3300013297 Unclassified 1043
329 Ga0157378_10928998 3300013297 Bacteria 902
330 Ga0157378_12317584 3300013297 Unclassified 588
331 Ga0163162_10004774 3300013306 Bacteria 13081
332 Ga0163162_10029198 3300013306 Bacteria 5457
333 Ga0163162_10738829 3300013306 Unclassified 1104
334 Ga0163162_10804296 3300013306 Unclassified 1057
335 Ga0157375_10218626 3300013308 Bacteria 2063
336 Ga0157375_10394978 3300013308 Unclassified 1550
337 Ga0157375_10408480 3300013308 Unclassified 1524
338 Ga0163163_10277836 3300014325 Bacteria 1726
339 Ga0182008_10245154 3300014497 Unclassified 923
340 Ga0157377_10151419 3300014745 Bacteria 1434
341 Ga0157377_10607781 3300014745 Unclassified 781
342 Ga0157376_10276716 3300014969 Bacteria 1579
343 Ga0157376_10279623 3300014969 Bacteria 1571
344 Ga0182007_10033168 3300015262 Bacteria 1751
345 Ga0182005_1038094 3300015265 Bacteria 1308
346 Ga0163161_10088045 3300017792 Unclassified 2295
347 Ga0163161_10397770 3300017792 Bacteria 1104
348 Ga0163161_11221105 3300017792 Bacteria 651
349 Ga0163161_11469777 3300017792 Unclassified 597
350 Ga0207666_1003711 3300025271 Bacteria 1885
351 Ga0207673_1005354 3300025290 Unclassified 1563
352 Ga0207673_1029274 3300025290 Unclassified 760
353 Ga0207697_10000198 3300025315 Bacteria 32108
354 Ga0207697_10000615 3300025315 Bacteria 20202
355 Ga0207697_10006960 3300025315 Bacteria 5071
356 Ga0207697_10026007 3300025315 Bacteria 2393
357 Ga0207697_10035154 3300025315 Unclassified 2051
358 Ga0207697_10102945 3300025315 Bacteria 1218
359 Ga0207653_10019312 3300025885 Bacteria 2149
360 Ga0207692_10014288 3300025898 Bacteria 3466
361 Ga0207692_10288038 3300025898 Unclassified 996
362 Ga0207692_10436226 3300025898 Bacteria 822
363 Ga0207692_10635252 3300025898 Unclassified 689
364 Ga0207642_10071464 3300025899 Unclassified 1653
365 Ga0207710_10115872 3300025900 Bacteria 1276
366 Ga0207688_10033445 3300025901 Bacteria 2844
367 Ga0207688_10055418 3300025901 Unclassified 2225
368 Ga0207688_10171558 3300025901 Unclassified 1290
369 Ga0207688_10848699 3300025901 Unclassified 578
370 Ga0207647_10003507 3300025904 Bacteria 11756
371 Ga0207647_10201463 3300025904 Unclassified 1151
372 Ga0207699_10020111 3300025906 Bacteria 3572
373 Ga0207699_10020756 3300025906 Bacteria 3527
374 Ga0207699_10037964 3300025906 Bacteria 2757
375 Ga0207699_10808799 3300025906 Unclassified 689
376 Ga0207645_10000634 3300025907 Bacteria 29170
377 Ga0207645_10296910 3300025907 Bacteria 1075
378 Ga0207684_10000043 3300025910 Bacteria 259939
379 Ga0207684_10002590 3300025910 Bacteria 18114
380 Ga0207684_10013932 3300025910 Bacteria 6946
381 Ga0207684_10014275 3300025910 Bacteria 6853
382 Ga0207684_10090439 3300025910 Unclassified 2608
383 Ga0207684_10102581 3300025910 Unclassified 2446
384 Ga0207684_10104807 3300025910 Unclassified 2418
385 Ga0207684_10114257 3300025910 Bacteria 2312
386 Ga0207684_10223835 3300025910 Bacteria 1624
387 Ga0207684_10338568 3300025910 Unclassified 1296
388 Ga0207684_11212891 3300025910 Unclassified 624
389 Ga0207707_10019153 3300025912 Bacteria 5974
390 Ga0207693_10003135 3300025915 Bacteria 14217
391 Ga0207693_10036469 3300025915 Bacteria 3876
392 Ga0207693_10067125 3300025915 Bacteria 2808
393 Ga0207693_10068240 3300025915 Bacteria 2783
394 Ga0207693_10130519 3300025915 Bacteria 1975
395 Ga0207693_10178468 3300025915 Bacteria 1671
396 Ga0207693_10547745 3300025915 Bacteria 902
397 Ga0207693_10798027 3300025915 Bacteria 728
398 Ga0207663_10004136 3300025916 Bacteria 7182
399 Ga0207663_10094038 3300025916 Bacteria 1996
400 Ga0207663_10180225 3300025916 Unclassified 1508
401 Ga0207663_11200513 3300025916 Unclassified 611
402 Ga0207663_11234044 3300025916 Unclassified 602
403 Ga0207662_10000729 3300025918 Bacteria 15055
404 Ga0207662_10078562 3300025918 Unclassified 2009
405 Ga0207662_10109123 3300025918 Unclassified 1724
406 Ga0207657_10227491 3300025919 Unclassified 1492
407 Ga0207657_10660204 3300025919 Bacteria 814
408 Ga0207657_10945221 3300025919 Unclassified 663
409 Ga0207649_10135697 3300025920 Unclassified 1677
410 Ga0207649_10297207 3300025920 Bacteria 1179
411 Ga0207649_10598703 3300025920 Bacteria 848
412 Ga0207652_10070834 3300025921 Unclassified 3028
413 Ga0207646_10000445 3300025922 Bacteria 55392
414 Ga0207646_10022902 3300025922 Bacteria 5743
415 Ga0207646_10023218 3300025922 Bacteria 5700
416 Ga0207646_10023608 3300025922 Bacteria 5647
417 Ga0207646_10047452 3300025922 Unclassified 3852
418 Ga0207646_10102624 3300025922 Bacteria 2564
419 Ga0207646_10115900 3300025922 Bacteria 2406
420 Ga0207646_10153742 3300025922 Bacteria 2075
421 Ga0207646_10161021 3300025922 Unclassified 2025
422 Ga0207646_10199819 3300025922 Bacteria 1806
423 Ga0207646_10386819 3300025922 Bacteria 1264
424 Ga0207646_10454050 3300025922 Bacteria 1156
425 Ga0207646_10684060 3300025922 Bacteria 918
426 Ga0207646_10695728 3300025922 Bacteria 909
427 Ga0207646_10780031 3300025922 Unclassified 852
428 Ga0207681_10029154 3300025923 Bacteria 3580
429 Ga0207681_10582195 3300025923 Unclassified 923
430 Ga0207681_10668328 3300025923 Unclassified 862
431 Ga0207650_10462895 3300025925 Unclassified 1056
432 Ga0207650_11184410 3300025925 Unclassified 650
433 Ga0207659_10033165 3300025926 Bacteria 3551
434 Ga0207659_10470938 3300025926 Bacteria 1060
435 Ga0207659_10807366 3300025926 Bacteria 806
436 Ga0207659_11405593 3300025926 Unclassified 598
437 Ga0207687_11070051 3300025927 Bacteria 692
438 Ga0207700_10016817 3300025928 Unclassified 4870
439 Ga0207700_10068397 3300025928 Bacteria 2722
440 Ga0207700_10700608 3300025928 Bacteria 904
441 Ga0207700_10874958 3300025928 Unclassified 804
442 Ga0207664_10022640 3300025929 Bacteria 4696
443 Ga0207664_10762245 3300025929 Unclassified 870
444 Ga0207664_10778727 3300025929 Bacteria 861
445 Ga0207664_11390910 3300025929 Unclassified 622
446 Ga0207644_10264100 3300025931 Unclassified 1377
447 Ga0207644_10397607 3300025931 Bacteria 1126
448 Ga0207644_10910045 3300025931 Unclassified 737
449 Ga0207690_10015254 3300025932 Bacteria 4652
450 Ga0207690_10057717 3300025932 Unclassified 2623
451 Ga0207690_10780385 3300025932 Unclassified 789
452 Ga0207706_10000702 3300025933 Bacteria 35016
453 Ga0207706_10004250 3300025933 Bacteria 13487
454 Ga0207706_10034666 3300025933 Bacteria 4491
455 Ga0207706_10067030 3300025933 Unclassified 3158
456 Ga0207706_10122914 3300025933 Unclassified 2283
457 Ga0207706_11272115 3300025933 Unclassified 609
458 Ga0207686_10310290 3300025934 Bacteria 1175
459 Ga0207686_10725371 3300025934 Unclassified 792
460 Ga0207709_10477311 3300025935 Bacteria 969
461 Ga0207670_10001041 3300025936 Bacteria 14653
462 Ga0207670_10008309 3300025936 Bacteria 5850
463 Ga0207670_10013214 3300025936 Unclassified 4859
464 Ga0207669_10097593 3300025937 Bacteria 1933
465 Ga0207669_10499061 3300025937 Unclassified 973
466 Ga0207669_10847013 3300025937 Unclassified 761
467 Ga0207704_10136861 3300025938 Bacteria 1707
468 Ga0207704_10181536 3300025938 Bacteria 1521
469 Ga0207665_10059517 3300025939 Unclassified 2585
470 Ga0207665_10071138 3300025939 Bacteria 2374
471 Ga0207665_10072053 3300025939 Bacteria 2359
472 Ga0207665_10095189 3300025939 Bacteria 2069
473 Ga0207665_10112680 3300025939 Unclassified 1913
474 Ga0207665_10260433 3300025939 Unclassified 1285
475 Ga0207665_10262793 3300025939 Bacteria 1279
476 Ga0207665_10322684 3300025939 Bacteria 1159
477 Ga0207665_10348787 3300025939 Bacteria 1117
478 Ga0207665_10631143 3300025939 Unclassified 838
479 Ga0207665_10953193 3300025939 Bacteria 682
480 Ga0207711_10142669 3300025941 Bacteria 2156
481 Ga0207711_11550177 3300025941 Unclassified 606
482 Ga0207689_10017873 3300025942 Bacteria 5989
483 Ga0207689_10812936 3300025942 Unclassified 789
484 Ga0207689_11107945 3300025942 Unclassified 667
485 Ga0207661_10040715 3300025944 Unclassified 3654
486 Ga0207661_10176182 3300025944 Bacteria 1864
487 Ga0207661_10266315 3300025944 Unclassified 1528
488 Ga0207661_10364083 3300025944 Unclassified 1306
489 Ga0207679_10320969 3300025945 Bacteria 1341
490 Ga0207679_11610069 3300025945 Unclassified 595
491 Ga0207651_10184030 3300025960 Bacteria 1660
492 Ga0207651_10219032 3300025960 Bacteria 1537
493 Ga0207651_10948874 3300025960 Bacteria 767
494 Ga0207651_11750343 3300025960 Unclassified 559
495 Ga0207712_10008042 3300025961 Bacteria 6671
496 Ga0207712_10704277 3300025961 Unclassified 882
497 Ga0207668_10058506 3300025972 Unclassified 2694
498 Ga0207668_10182365 3300025972 Bacteria 1657
499 Ga0207668_11353412 3300025972 Unclassified 641
500 Ga0207658_10067236 3300025986 Unclassified 2698
501 Ga0207658_10142278 3300025986 Bacteria 1943
502 Ga0207658_10287368 3300025986 Unclassified 1412
503 Ga0207658_10967455 3300025986 Unclassified 776
504 Ga0207677_10010730 3300026023 Bacteria 5193
505 Ga0207677_10067575 3300026023 Bacteria 2504
506 Ga0207677_11293574 3300026023 Unclassified 670
507 Ga0207703_10693333 3300026035 Unclassified 968
508 Ga0207703_11662747 3300026035 Unclassified 614
509 Ga0207639_11791631 3300026041 Bacteria 575
510 Ga0207678_10005303 3300026067 Bacteria 11544
511 Ga0207708_10027450 3300026075 Unclassified 4310
512 Ga0207708_11039842 3300026075 Unclassified 713
513 Ga0207702_10410040 3300026078 Unclassified 1308
514 Ga0207702_10411609 3300026078 Unclassified 1306
515 Ga0207641_10018693 3300026088 Bacteria 5682
516 Ga0207641_10121877 3300026088 Bacteria 2328
517 Ga0207641_10296880 3300026088 Bacteria 1525
518 Ga0207648_11275469 3300026089 Unclassified 690
519 Ga0207676_10247421 3300026095 Unclassified 1603
520 Ga0207676_11720564 3300026095 Bacteria 625
521 Ga0207675_100328522 3300026118 Bacteria 1494
522 Ga0207675_100701060 3300026118 Bacteria 1021
523 Ga0207675_101316075 3300026118 Bacteria 743
524 Ga0207683_10011404 3300026121 Bacteria 7585
525 Ga0207698_10421004 3300026142 Bacteria 1281
526 Ga0209179_1031237 3300027512 Unclassified 1092
527 Ga0210002_1025868 3300027617 Bacteria 961
528 Ga0209588_1150302 3300027671 Bacteria 738
529 Ga0209971_1022651 3300027682 Bacteria 1497
530 Ga0209974_10100448 3300027876 Unclassified 1011
531 Ga0268266_10032203 3300028379 Unclassified 4455
532 Ga0268266_10056268 3300028379 Unclassified 3383
533 Ga0268266_10237278 3300028379 Unclassified 1681
534 Ga0268266_10963811 3300028379 Unclassified 825
535 Ga0268265_10007154 3300028380 Bacteria 7538
536 Ga0268264_10014335 3300028381 Bacteria 6518
537 Ga0268264_10520072 3300028381 Unclassified 1163
538 Ga0268264_12279227 3300028381 Unclassified 549
539 Ga0307513_10111511 3300031456 Bacteria 2728
540 Ga0373938_0145101 3300034957 Unclassified 628
541 Ga0373929_0131432 3300035085 Unclassified 657
542 Ga0373923_0084701 3300035111 Bacteria 1379
543 Ga0373936_0304864 3300035113 Unclassified 719
544 Ga0373939_0170926 3300035114 Unclassified 804
545 Ga0373941_0208557 3300035115 Unclassified 746
546 Ga0373953_0132046 3300035117 Unclassified 1065
547 Ga0373956_0026317 3300035119 Unclassified 2519
548 Ga0373943_0066429 3300035170 Bacteria 1816
549 Ga0373943_0211949 3300035170 Unclassified 1076
550 Ga0373943_0251899 3300035170 Unclassified 992
551 Ga0373955_0798973 3300035172 Unclassified 580
552 Ga0373961_0129639 3300035241 Unclassified 843
553 Ga0373931_0027665 3300035691 Unclassified 2897
554 Ga0373931_0360508 3300035691 Bacteria 912
555 Ga0373935_0016674 3300035692 Bacteria 4446
556 Ga0373947_0032662 3300035725 Bacteria 3069
557 Ga0373947_0229333 3300035725 Bacteria 1223
558 Ga0395899_0083103 3300037312 Unclassified 2329
559 Ga0395900_0033096 3300037418 Bacteria 5320
560 Ga0395900_0132881 3300037418 Bacteria 2550
561 Ga0395900_0251244 3300037418 Bacteria 1770
562 Ga0395900_0475832 3300037418 Bacteria 1202
563 Ga0395900_0732363 3300037418 Bacteria 920
564 Ga0395905_0035375 3300037471 Bacteria 4690
565 Ga0395905_0439588 3300037471 Unclassified 1202
566 Ga0395901_0029202 3300038443 Bacteria 5675
567 Ga0395901_0128259 3300038443 Bacteria 2666
568 Ga0395901_0181757 3300038443 Bacteria 2206
569 Ga0395901_1297587 3300038443 Unclassified 690
570 Ga0395901_1739691 3300038443 Unclassified 574
571 Ga0436363_0527460 3300039450 Unclassified 511
572 Ga0451789_0379071 3300041443 Unclassified 787
573 Ga0451800_1503148 3300041459 Bacteria 641
574 Ga0451804_1160921 3300041463 Bacteria 594
575 Ga0451807_1549576 3300041486 Bacteria 1270
576 Ga0451807_1920741 3300041486 Bacteria 622
577 Ga0451853_2864927 3300041512 Unclassified 763
578 Ga0439448_0090645 3300042005 Unclassified 1033
579 Ga0439451_030035 3300042009 Unclassified 1093
580 Ga0453683_0247106 3300044673 Bacteria 1137
581 Ga0451576_0036267 3300045051 Bacteria 5228
582 Ga0495592_0014862 3300046454 Bacteria 5910
583 Ga0495629_0089648 3300046459 Unclassified 2145
584 Ga0495580_0222887 3300046472 Unclassified 1296
585 Ga0495584_0097678 3300046491 Bacteria 1484
586 Ga0495628_0835665 3300046516 Unclassified 642
587 Ga0495587_0016884 3300046536 Unclassified 4539
588 Ga0495667_0256227 3300046559 Unclassified 1113
589 Ga0495588_0742587 3300046674 Unclassified 513
590 Ga0495599_0035607 3300046678 Unclassified 3125
591 Ga0495623_0031772 3300046679 Bacteria 3394
592 Ga0495669_0132238 3300046684 Unclassified 1175
593 Ga0495604_0046620 3300047317 Unclassified 3379
594 Ga0495675_0008938 3300047444 Bacteria 6227
595 Ga0495602_0076232 3300048088 Bacteria 2842
596 Ga0496100_0663381 3300048903 Bacteria 813
597 Ga0496101_1093157 3300048904 Unclassified 626
598 Ga0496102_0582192 3300048905 Bacteria 1042
599 Ga0496103_1062683 3300048906 Unclassified 502
600 Ga0496104_0336703 3300048907 Bacteria 1422
601 Ga0496105_0134919 3300048908 Bacteria 2034
602 Ga0496105_0566684 3300048908 Unclassified 885
603 Ga0496106_0975692 3300048909 Unclassified 667
604 Ga0496107_0228405 3300048910 Bacteria 1385
605 Ga0496107_0349241 3300048910 Bacteria 1101
606 Ga0496108_0151202 3300048911 Bacteria 2003
607 Ga0496108_0513020 3300048911 Bacteria 1047
608 Ga0496109_0010796 3300048912 Bacteria 7820
609 Ga0496109_0065137 3300048912 Bacteria 3336
610 Ga0496110_0332551 3300048913 Unclassified 1384
611 Ga0496110_1706339 3300048913 Unclassified 540
612 Ga0496112_0008465 3300048915 Bacteria 9218
613 Ga0496112_1271058 3300048915 Unclassified 652
614 Ga0496113_0028847 3300048916 Bacteria 3997
615 Ga0496113_0592833 3300048916 Bacteria 888
616 Ga0496114_0039983 3300048917 Bacteria 3881
617 Ga0496115_0022124 3300048918 Bacteria 4919
618 Ga0496115_0027647 3300048918 Bacteria 4439
619 nmdc:mga05p37_343017_c1 3300050507 Bacteria 1761
620 nmdc:mga05p37_344208_c1 3300050507 Unclassified 1757
621 nmdc:mga05p37_5948_c1 3300050507 Bacteria 14354
622 nmdc:mga08y16_575985_c1 3300050511 Unclassified 1137
623 nmdc:mga0n895_344504_c1 3300050512 Unclassified 1509
624 nmdc:mga0rr50_920669_c1 3300050513 Unclassified 745
625 nmdc:mga08x19_41768_c1 3300050514 Bacteria 2921
626 Ga0495655_0058346 3300053083 Unclassified 1045
627 Ga0500618_083669 3300053125 Unclassified 716
628 Ga0070711_100003824
629 SwRhRL2b_contig_3434452
630 MBSR1b_contig_6760597
631 JGI24746J21847_1005009
632 JGI24750J21931_1025851
633 JGI25404J52841_10072869
634 Ga0065703_1022475
635 Ga0065704_10017679
636 Ga0065704_10094320
637 Ga0065704_10202793
638 Ga0065704_10229432
639 Ga0065704_10375795
640 Ga0065704_10439644
641 Ga0065712_10001064
642 Ga0065712_10020335
643 Ga0065712_10132930
644 Ga0065712_10136744
645 Ga0065712_10137278
646 Ga0065712_10194486
647 Ga0065712_10321977
648 Ga0065712_10487132
649 Ga0065715_10000989
650 Ga0065715_10034440
651 Ga0065715_10043178
652 Ga0065715_10108246
653 Ga0065715_10143749
654 Ga0065715_10208422
655 Ga0065715_10242670
656 Ga0065715_10620470
657 Ga0065715_10640652
658 Ga0065715_10658621
659 Ga0065715_10755459
660 Ga0065715_11178995
661 Ga0065707_10006439
662 Ga0065707_10212411
663 Ga0065707_10218825
664 Ga0065707_10318317
665 Ga0065707_10344687
666 Ga0070676_10014349
667 Ga0070676_10227106
668 Ga0070676_10265958
669 Ga0070683_100051450
670 Ga0070690_101698858
671 Ga0068869_100045337
672 Ga0070680_100066605
673 Ga0070680_101235735
674 Ga0070682_101010201
675 Ga0068868_100020223
676 Ga0068868_100177970
677 Ga0068868_100182693
678 Ga0068868_101318217
679 Ga0070660_100119923
680 Ga0070689_100004952
681 Ga0070689_100017621
682 Ga0070689_100110414
683 Ga0070689_100934861
684 Ga0070689_101253774
685 Ga0070687_100006902
686 Ga0070687_100015727
687 Ga0070661_100062115
688 Ga0070661_100627410
689 Ga0070692_10289334
690 Ga0070668_100008617
691 Ga0070668_100074085
692 Ga0070669_100004754
693 Ga0070669_100351904
694 Ga0070669_101117990
695 Ga0070669_101597761
696 Ga0070675_100003834
697 Ga0070675_100018650
698 Ga0070675_100074977
699 Ga0070675_100238711
700 Ga0070675_101148162
701 Ga0070671_100068495
702 Ga0070671_100078592
703 Ga0070671_100677636
704 Ga0070673_100026241
705 Ga0070673_100065293
706 Ga0070673_100141057
707 Ga0070673_100832648
708 Ga0070673_100854433
709 Ga0070673_101280299
710 Ga0070688_100002253
711 Ga0070688_100040787
712 Ga0070688_100090290
713 Ga0070688_100219939
714 Ga0070688_100333556
715 Ga0070688_101040028
716 Ga0070659_100002447
717 Ga0070659_100019125
718 Ga0070659_100241984
719 Ga0070659_100289940
720 Ga0070667_100011531
721 Ga0070667_100342637
722 Ga0070667_100572988
723 Ga0070709_10024380
724 Ga0070709_10069224
725 Ga0070714_100039161
726 Ga0070714_100282331
727 Ga0070714_100596438
728 Ga0070714_101031697
729 Ga0070714_101057126
730 Ga0070713_100033365
731 Ga0070713_100180597
732 Ga0070713_100531042
733 Ga0070710_10015956
734 Ga0070710_10116098
735 Ga0070701_10194296
736 Ga0070711_100076045
737 Ga0070711_100167673
738 Ga0070711_101180193
739 Ga0070705_100013479
740 Ga0070705_100108098
741 Ga0070705_100191789
742 Ga0070705_100559772
743 Ga0070700_100007347
744 Ga0070694_100069047
745 Ga0070694_100630146
746 Ga0070708_100041784
747 Ga0070708_100068450
748 Ga0070708_100079978
749 Ga0070708_100085274
750 Ga0070708_100122168
751 Ga0070708_100250568
752 Ga0070708_100279987
753 Ga0070708_100417106
754 Ga0070708_100478483
755 Ga0070708_100528274
756 Ga0070708_100755964
757 Ga0070708_100784305
758 Ga0070708_101251842
759 Ga0070708_101645141
760 Ga0070678_100077298
761 Ga0070678_100161706
762 Ga0070678_100378801
763 Ga0070678_101530102
764 Ga0070678_101758923
765 Ga0070662_100013958
766 Ga0070662_100037879
767 Ga0070662_100195624
768 Ga0070662_100197453
769 Ga0070662_101244077
770 Ga0070681_11109205
771 Ga0068867_100745107
772 Ga0070685_10173652
773 Ga0070706_100000072
774 Ga0070706_100005471
775 Ga0070706_100009390
776 Ga0070706_100010249
777 Ga0070706_100029223
778 Ga0070706_100086460
779 Ga0070706_100108979
780 Ga0070706_100122721
781 Ga0070706_100371263
782 Ga0070706_100374216
783 Ga0070706_100508294
784 Ga0070706_100516705
785 Ga0070706_100917930
786 Ga0070706_101270453
787 Ga0070707_100000109
788 Ga0070707_100004502
789 Ga0070707_100033745
790 Ga0070707_100033967
791 Ga0070707_100049869
792 Ga0070707_100099460
793 Ga0070707_100123184
794 Ga0070707_100232323
795 Ga0070707_100270606
796 Ga0070707_100390504
797 Ga0070707_100844674
798 Ga0070707_100907253
799 Ga0070698_100002781
800 Ga0070698_100043014
801 Ga0070698_100096291
802 Ga0070698_100268167
803 Ga0070698_100462911
804 Ga0070698_100518069
805 Ga0070698_100549958
806 Ga0070699_100048712
807 Ga0070699_100462884
808 Ga0070699_100578712
809 Ga0070699_100679955
810 Ga0070679_100079603
811 Ga0070684_100000339
812 Ga0070684_100011918
813 Ga0070697_100000972
814 Ga0070697_100002822
815 Ga0070697_100006284
816 Ga0070697_100006722
817 Ga0070697_100041385
818 Ga0070697_100043601
819 Ga0070697_100063362
820 Ga0070697_100206732
821 Ga0070697_100287079
822 Ga0070697_100691538
823 Ga0070697_101467012
824 Ga0070697_101625041
825 Ga0070672_100091043
826 Ga0070672_100558217
827 Ga0070672_101420624
828 Ga0070686_100737559
829 Ga0070693_100196586
830 Ga0070693_100480160
831 Ga0070665_100026148
832 Ga0070665_100044098
833 Ga0070665_100194261
834 Ga0070665_101359483
835 Ga0070665_102560971
836 Ga0068855_100995961
837 Ga0068855_102613598
838 Ga0070664_100019044
839 Ga0070664_100747533
840 Ga0070664_101621615
841 Ga0068857_101477572
842 Ga0068856_100132185
843 Ga0068856_100492843
844 Ga0068856_101157714
845 Ga0068859_100122181
846 Ga0068864_101706582
847 Ga0068864_101817147
848 Ga0068866_10589270
849 Ga0068861_100188944
850 Ga0068861_100460535
851 Ga0068861_101096719
852 Ga0068863_100028985
853 Ga0068863_100187212
854 Ga0068863_100222101
855 Ga0068858_100136552
856 Ga0068858_102585579
857 Ga0068860_100007141
858 Ga0068860_100016535
859 Ga0068860_100530428
860 Ga0068860_100955990
861 Ga0068862_100023514
862 Ga0068862_100837204
863 Ga0081455_10001013
864 Ga0081455_10001533
865 Ga0081455_10001733
866 Ga0081455_10015737
867 Ga0081455_10032715
868 Ga0081455_10109261
869 Ga0081455_10162310
870 Ga0081540_1000219
871 Ga0081540_1015104
872 Ga0081540_1037572
873 Ga0081539_10006483
874 Ga0081539_10021018
875 Ga0070717_10001521
876 Ga0070717_10035293
877 Ga0070717_10131765
878 Ga0070717_10138149
879 Ga0070717_10159582
880 Ga0070717_10165854
881 Ga0070717_10374248
882 Ga0070717_10424435
883 Ga0070717_10579111
884 Ga0070717_10902118
885 Ga0070715_10027744
886 Ga0070715_10692793
887 Ga0070716_100058481
888 Ga0070716_100128963
889 Ga0070716_100327038
890 Ga0070716_100417835
891 Ga0070716_100501710
892 Ga0070716_101056496
893 Ga0070716_101563517
894 Ga0070712_100011735
895 Ga0070712_100022920
896 Ga0070712_100030331
897 Ga0070712_100047912
898 Ga0070712_100137080
899 Ga0070712_100192324
900 Ga0070712_101663655
901 Ga0070712_101698782
902 Ga0097621_100187001
903 Ga0068871_101588954
904 Ga0075428_100157559
905 Ga0075428_100232614
906 Ga0075428_100297121
907 Ga0075434_100857505
908 Ga0075434_100980788
909 Ga0075434_101592427
910 Ga0068865_100092212
911 Ga0068865_100263890
912 Ga0068865_100389191
913 Ga0068865_101051937
914 Ga0075436_100033364
915 Ga0097620_100122180
916 Ga0075435_100472888
917 Ga0099794_10047721
918 Ga0099794_10154287
919 Ga0099794_10218460
920 Ga0099794_10262184
921 Ga0105245_10144256
922 Ga0105245_10385283
923 Ga0105245_13248276
924 Ga0105247_10142308
925 Ga0105247_10879572
926 Ga0114129_10008863
927 Ga0114129_10316491
928 Ga0114129_10366260
929 Ga0114129_11308582
930 Ga0114129_11957369
931 Ga0105243_11751143
932 Ga0105243_12291887
933 Ga0105241_11230855
934 Ga0105242_10072817
935 Ga0105242_10844249
936 Ga0105248_12310537
937 Ga0105249_10006132
938 Ga0099796_10354835
939 Ga0105239_10010133
940 Ga0105239_10321735
941 Ga0105239_12086960
942 Ga0157318_1017338
943 Ga0157342_1006117
944 Ga0157371_10229925
945 Ga0157370_10139506
946 Ga0157369_12218099
947 Ga0157374_10017287
948 Ga0157374_10054286
949 Ga0157374_10091230
950 Ga0157374_10131036
951 Ga0157374_10535697
952 Ga0157378_10005373
953 Ga0157378_10139027
954 Ga0157378_10144731
955 Ga0157378_10685852
956 Ga0157378_10928998
957 Ga0157378_12317584
958 Ga0163162_10004774
959 Ga0163162_10029198
960 Ga0163162_10738829
961 Ga0163162_10804296
962 Ga0157375_10218626
963 Ga0157375_10394978
964 Ga0157375_10408480
965 Ga0163163_10277836
966 Ga0182008_10245154
967 Ga0157377_10151419
968 Ga0157377_10607781
969 Ga0157376_10276716
970 Ga0157376_10279623
971 Ga0182007_10033168
972 Ga0182005_1038094
973 Ga0163161_10088045
974 Ga0163161_10397770
975 Ga0163161_11221105
976 Ga0163161_11469777
977 Ga0207666_1003711
978 Ga0207673_1005354
979 Ga0207673_1029274
980 Ga0207697_10000198
981 Ga0207697_10000615
982 Ga0207697_10006960
983 Ga0207697_10026007
984 Ga0207697_10035154
985 Ga0207697_10102945
986 Ga0207653_10019312
987 Ga0207692_10014288
988 Ga0207692_10288038
989 Ga0207692_10436226
990 Ga0207692_10635252
991 Ga0207642_10071464
992 Ga0207710_10115872
993 Ga0207688_10033445
994 Ga0207688_10055418
995 Ga0207688_10171558
996 Ga0207688_10848699
997 Ga0207647_10003507
998 Ga0207647_10201463
999 Ga0207699_10020111
1000 Ga0207699_10020756
1001 Ga0207699_10037964
1002 Ga0207699_10808799
1003 Ga0207645_10000634
1004 Ga0207645_10296910
1005 Ga0207684_10000043
1006 Ga0207684_10002590
1007 Ga0207684_10013932
1008 Ga0207684_10014275
1009 Ga0207684_10090439
1010 Ga0207684_10102581
1011 Ga0207684_10104807
1012 Ga0207684_10114257
1013 Ga0207684_10223835
1014 Ga0207684_10338568
1015 Ga0207684_11212891
1016 Ga0207707_10019153
1017 Ga0207693_10003135
1018 Ga0207693_10036469
1019 Ga0207693_10067125
1020 Ga0207693_10068240
1021 Ga0207693_10130519
1022 Ga0207693_10178468
1023 Ga0207693_10547745
1024 Ga0207693_10798027
1025 Ga0207663_10004136
1026 Ga0207663_10094038
1027 Ga0207663_10180225
1028 Ga0207663_11200513
1029 Ga0207663_11234044
1030 Ga0207662_10000729
1031 Ga0207662_10078562
1032 Ga0207662_10109123
1033 Ga0207657_10227491
1034 Ga0207657_10660204
1035 Ga0207657_10945221
1036 Ga0207649_10135697
1037 Ga0207649_10297207
1038 Ga0207649_10598703
1039 Ga0207652_10070834
1040 Ga0207646_10000445
1041 Ga0207646_10022902
1042 Ga0207646_10023218
1043 Ga0207646_10023608
1044 Ga0207646_10047452
1045 Ga0207646_10102624
1046 Ga0207646_10115900
1047 Ga0207646_10153742
1048 Ga0207646_10161021
1049 Ga0207646_10199819
1050 Ga0207646_10386819
1051 Ga0207646_10454050
1052 Ga0207646_10684060
1053 Ga0207646_10695728
1054 Ga0207646_10780031
1055 Ga0207681_10029154
1056 Ga0207681_10582195
1057 Ga0207681_10668328
1058 Ga0207650_10462895
1059 Ga0207650_11184410
1060 Ga0207659_10033165
1061 Ga0207659_10470938
1062 Ga0207659_10807366
1063 Ga0207659_11405593
1064 Ga0207687_11070051
1065 Ga0207700_10016817
1066 Ga0207700_10068397
1067 Ga0207700_10700608
1068 Ga0207700_10874958
1069 Ga0207664_10022640
1070 Ga0207664_10762245
1071 Ga0207664_10778727
1072 Ga0207664_11390910
1073 Ga0207644_10264100
1074 Ga0207644_10397607
1075 Ga0207644_10910045
1076 Ga0207690_10015254
1077 Ga0207690_10057717
1078 Ga0207690_10780385
1079 Ga0207706_10000702
1080 Ga0207706_10004250
1081 Ga0207706_10034666
1082 Ga0207706_10067030
1083 Ga0207706_10122914
1084 Ga0207706_11272115
1085 Ga0207686_10310290
1086 Ga0207686_10725371
1087 Ga0207709_10477311
1088 Ga0207670_10001041
1089 Ga0207670_10008309
1090 Ga0207670_10013214
1091 Ga0207669_10097593
1092 Ga0207669_10499061
1093 Ga0207669_10847013
1094 Ga0207704_10136861
1095 Ga0207704_10181536
1096 Ga0207665_10059517
1097 Ga0207665_10071138
1098 Ga0207665_10072053
1099 Ga0207665_10095189
1100 Ga0207665_10112680
1101 Ga0207665_10260433
1102 Ga0207665_10262793
1103 Ga0207665_10322684
1104 Ga0207665_10348787
1105 Ga0207665_10631143
1106 Ga0207665_10953193
1107 Ga0207711_10142669
1108 Ga0207711_11550177
1109 Ga0207689_10017873
1110 Ga0207689_10812936
1111 Ga0207689_11107945
1112 Ga0207661_10040715
1113 Ga0207661_10176182
1114 Ga0207661_10266315
1115 Ga0207661_10364083
1116 Ga0207679_10320969
1117 Ga0207679_11610069
1118 Ga0207651_10184030
1119 Ga0207651_10219032
1120 Ga0207651_10948874
1121 Ga0207651_11750343
1122 Ga0207712_10008042
1123 Ga0207712_10704277
1124 Ga0207668_10058506
1125 Ga0207668_10182365
1126 Ga0207668_11353412
1127 Ga0207658_10067236
1128 Ga0207658_10142278
1129 Ga0207658_10287368
1130 Ga0207658_10967455
1131 Ga0207677_10010730
1132 Ga0207677_10067575
1133 Ga0207677_11293574
1134 Ga0207703_10693333
1135 Ga0207703_11662747
1136 Ga0207639_11791631
1137 Ga0207678_10005303
1138 Ga0207708_10027450
1139 Ga0207708_11039842
1140 Ga0207702_10410040
1141 Ga0207702_10411609
1142 Ga0207641_10018693
1143 Ga0207641_10121877
1144 Ga0207641_10296880
1145 Ga0207648_11275469
1146 Ga0207676_10247421
1147 Ga0207676_11720564
1148 Ga0207675_100328522
1149 Ga0207675_100701060
1150 Ga0207675_101316075
1151 Ga0207683_10011404
1152 Ga0207698_10421004
1153 Ga0209179_1031237
1154 Ga0210002_1025868
1155 Ga0209588_1150302
1156 Ga0209971_1022651
1157 Ga0209974_10100448
1158 Ga0268266_10032203
1159 Ga0268266_10056268
1160 Ga0268266_10237278
1161 Ga0268266_10963811
1162 Ga0268265_10007154
1163 Ga0268264_10014335
1164 Ga0268264_10520072
1165 Ga0268264_12279227
1166 Ga0307513_10111511
1167 Ga0373938_0145101
1168 Ga0373929_0131432
1169 Ga0373923_0084701
1170 Ga0373936_0304864
1171 Ga0373939_0170926
1172 Ga0373941_0208557
1173 Ga0373953_0132046
1174 Ga0373956_0026317
1175 Ga0373943_0066429
1176 Ga0373943_0211949
1177 Ga0373943_0251899
1178 Ga0373955_0798973
1179 Ga0373961_0129639
1180 Ga0373931_0027665
1181 Ga0373931_0360508
1182 Ga0373935_0016674
1183 Ga0373947_0032662
1184 Ga0373947_0229333
1185 Ga0395899_0083103
1186 Ga0395900_0033096
1187 Ga0395900_0132881
1188 Ga0395900_0251244
1189 Ga0395900_0475832
1190 Ga0395900_0732363
1191 Ga0395905_0035375
1192 Ga0395905_0439588
1193 Ga0395901_0029202
1194 Ga0395901_0128259
1195 Ga0395901_0181757
1196 Ga0395901_1297587
1197 Ga0395901_1739691
1198 Ga0436363_0527460
1199 Ga0451789_0379071
1200 Ga0451800_1503148
1201 Ga0451804_1160921
1202 Ga0451807_1549576
1203 Ga0451807_1920741
1204 Ga0451853_2864927
1205 Ga0439448_0090645
1206 Ga0439451_030035
1207 Ga0453683_0247106
1208 Ga0451576_0036267
1209 Ga0495592_0014862
1210 Ga0495629_0089648
1211 Ga0495580_0222887
1212 Ga0495584_0097678
1213 Ga0495628_0835665
1214 Ga0495587_0016884
1215 Ga0495667_0256227
1216 Ga0495588_0742587
1217 Ga0495599_0035607
1218 Ga0495623_0031772
1219 Ga0495669_0132238
1220 Ga0495604_0046620
1221 Ga0495675_0008938
1222 Ga0495602_0076232
1223 Ga0496100_0663381
1224 Ga0496101_1093157
1225 Ga0496102_0582192
1226 Ga0496103_1062683
1227 Ga0496104_0336703
1228 Ga0496105_0134919
1229 Ga0496105_0566684
1230 Ga0496106_0975692
1231 Ga0496107_0228405
1232 Ga0496107_0349241
1233 Ga0496108_0151202
1234 Ga0496108_0513020
1235 Ga0496109_0010796
1236 Ga0496109_0065137
1237 Ga0496110_0332551
1238 Ga0496110_1706339
1239 Ga0496112_0008465
1240 Ga0496112_1271058
1241 Ga0496113_0028847
1242 Ga0496113_0592833
1243 Ga0496114_0039983
1244 Ga0496115_0022124
1245 Ga0496115_0027647
1246 nmdc:mga05p37_343017_c1
1247 nmdc:mga05p37_344208_c1
1248 nmdc:mga05p37_5948_c1
1249 nmdc:mga08y16_575985_c1
1250 nmdc:mga0n895_344504_c1
1251 nmdc:mga0rr50_920669_c1
1252 nmdc:mga08x19_41768_c1
1253 Ga0495655_0058346
1254 Ga0500618_083669

MSA Aligner

Family Sequences

Map