F470537
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 627 | 238 | 1254 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100003824|Ga0070711_1000038247 |
| Length | 143 |
| Sequence | MSNAPIPAHAAQNCGWPRKSKMKRSHRKNWNAVNAASLARWIVMTAFLALAGLSYVYLTLQLYHLGERKKAVENELISLRTQNDVASVQIAALTSRSALQRRLKEGYLKMIPISENNIVRLTIPARPAEEDAIQPVANRSRLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 96 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 176 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 180 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 194 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 199 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 200 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 201 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 225 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0 |
| Rhizoplane | 4.47 |
| Rhizosphere | 94.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 45.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070711_100003824 | 3300005439 | Bacteria | 8842 |
| 2 | SwRhRL2b_contig_3434452 | 2162886007 | Bacteria | 3882 |
| 3 | MBSR1b_contig_6760597 | 2162886012 | Unclassified | 873 |
| 4 | JGI24746J21847_1005009 | 3300001977 | Unclassified | 2075 |
| 5 | JGI24750J21931_1025851 | 3300002070 | Unclassified | 843 |
| 6 | JGI25404J52841_10072869 | 3300003659 | Unclassified | 718 |
| 7 | Ga0065703_1022475 | 3300005272 | Bacteria | 903 |
| 8 | Ga0065704_10017679 | 3300005289 | Bacteria | 1419 |
| 9 | Ga0065704_10094320 | 3300005289 | Unclassified | 2532 |
| 10 | Ga0065704_10202793 | 3300005289 | Unclassified | 1139 |
| 11 | Ga0065704_10229432 | 3300005289 | Unclassified | 1048 |
| 12 | Ga0065704_10375795 | 3300005289 | Unclassified | 779 |
| 13 | Ga0065704_10439644 | 3300005289 | Bacteria | 715 |
| 14 | Ga0065712_10001064 | 3300005290 | Bacteria | 10541 |
| 15 | Ga0065712_10020335 | 3300005290 | Unclassified | 1993 |
| 16 | Ga0065712_10132930 | 3300005290 | Bacteria | 1528 |
| 17 | Ga0065712_10136744 | 3300005290 | Bacteria | 1490 |
| 18 | Ga0065712_10137278 | 3300005290 | Bacteria | 1473 |
| 19 | Ga0065712_10194486 | 3300005290 | Unclassified | 1134 |
| 20 | Ga0065712_10321977 | 3300005290 | Unclassified | 822 |
| 21 | Ga0065712_10487132 | 3300005290 | Bacteria | 658 |
| 22 | Ga0065715_10000989 | 3300005293 | Bacteria | 7981 |
| 23 | Ga0065715_10034440 | 3300005293 | Unclassified | 1284 |
| 24 | Ga0065715_10043178 | 3300005293 | Bacteria | 2440 |
| 25 | Ga0065715_10108246 | 3300005293 | Bacteria | 2729 |
| 26 | Ga0065715_10143749 | 3300005293 | Bacteria | 1816 |
| 27 | Ga0065715_10208422 | 3300005293 | Bacteria | 1326 |
| 28 | Ga0065715_10242670 | 3300005293 | Bacteria | 1194 |
| 29 | Ga0065715_10620470 | 3300005293 | Unclassified | 689 |
| 30 | Ga0065715_10640652 | 3300005293 | Unclassified | 684 |
| 31 | Ga0065715_10658621 | 3300005293 | Unclassified | 674 |
| 32 | Ga0065715_10755459 | 3300005293 | Unclassified | 628 |
| 33 | Ga0065715_11178995 | 3300005293 | Unclassified | 501 |
| 34 | Ga0065707_10006439 | 3300005295 | Bacteria | 4880 |
| 35 | Ga0065707_10212411 | 3300005295 | Unclassified | 1259 |
| 36 | Ga0065707_10218825 | 3300005295 | Bacteria | 1233 |
| 37 | Ga0065707_10318317 | 3300005295 | Bacteria | 971 |
| 38 | Ga0065707_10344687 | 3300005295 | Unclassified | 928 |
| 39 | Ga0070676_10014349 | 3300005328 | Bacteria | 4354 |
| 40 | Ga0070676_10227106 | 3300005328 | Unclassified | 1236 |
| 41 | Ga0070676_10265958 | 3300005328 | Unclassified | 1150 |
| 42 | Ga0070683_100051450 | 3300005329 | Unclassified | 3814 |
| 43 | Ga0070690_101698858 | 3300005330 | Bacteria | 513 |
| 44 | Ga0068869_100045337 | 3300005334 | Unclassified | 3165 |
| 45 | Ga0070680_100066605 | 3300005336 | Unclassified | 2953 |
| 46 | Ga0070680_101235735 | 3300005336 | Unclassified | 646 |
| 47 | Ga0070682_101010201 | 3300005337 | Unclassified | 691 |
| 48 | Ga0068868_100020223 | 3300005338 | Bacteria | 4998 |
| 49 | Ga0068868_100177970 | 3300005338 | Bacteria | 1763 |
| 50 | Ga0068868_100182693 | 3300005338 | Unclassified | 1741 |
| 51 | Ga0068868_101318217 | 3300005338 | Bacteria | 671 |
| 52 | Ga0070660_100119923 | 3300005339 | Bacteria | 2099 |
| 53 | Ga0070689_100004952 | 3300005340 | Bacteria | 9040 |
| 54 | Ga0070689_100017621 | 3300005340 | Bacteria | 5249 |
| 55 | Ga0070689_100110414 | 3300005340 | Unclassified | 2186 |
| 56 | Ga0070689_100934861 | 3300005340 | Unclassified | 768 |
| 57 | Ga0070689_101253774 | 3300005340 | Unclassified | 667 |
| 58 | Ga0070687_100006902 | 3300005343 | Bacteria | 4689 |
| 59 | Ga0070687_100015727 | 3300005343 | Unclassified | 3429 |
| 60 | Ga0070661_100062115 | 3300005344 | Unclassified | 2742 |
| 61 | Ga0070661_100627410 | 3300005344 | Bacteria | 871 |
| 62 | Ga0070692_10289334 | 3300005345 | Unclassified | 996 |
| 63 | Ga0070668_100008617 | 3300005347 | Bacteria | 7575 |
| 64 | Ga0070668_100074085 | 3300005347 | Bacteria | 2655 |
| 65 | Ga0070669_100004754 | 3300005353 | Bacteria | 9793 |
| 66 | Ga0070669_100351904 | 3300005353 | Unclassified | 1196 |
| 67 | Ga0070669_101117990 | 3300005353 | Unclassified | 679 |
| 68 | Ga0070669_101597761 | 3300005353 | Bacteria | 568 |
| 69 | Ga0070675_100003834 | 3300005354 | Bacteria | 11405 |
| 70 | Ga0070675_100018650 | 3300005354 | Bacteria | 5523 |
| 71 | Ga0070675_100074977 | 3300005354 | Unclassified | 2811 |
| 72 | Ga0070675_100238711 | 3300005354 | Unclassified | 1588 |
| 73 | Ga0070675_101148162 | 3300005354 | Unclassified | 715 |
| 74 | Ga0070671_100068495 | 3300005355 | Bacteria | 2960 |
| 75 | Ga0070671_100078592 | 3300005355 | Unclassified | 2757 |
| 76 | Ga0070671_100677636 | 3300005355 | Unclassified | 894 |
| 77 | Ga0070673_100026241 | 3300005364 | Bacteria | 4301 |
| 78 | Ga0070673_100065293 | 3300005364 | Unclassified | 2903 |
| 79 | Ga0070673_100141057 | 3300005364 | Bacteria | 2033 |
| 80 | Ga0070673_100832648 | 3300005364 | Bacteria | 853 |
| 81 | Ga0070673_100854433 | 3300005364 | Unclassified | 842 |
| 82 | Ga0070673_101280299 | 3300005364 | Bacteria | 688 |
| 83 | Ga0070688_100002253 | 3300005365 | Bacteria | 9735 |
| 84 | Ga0070688_100040787 | 3300005365 | Bacteria | 2846 |
| 85 | Ga0070688_100090290 | 3300005365 | Bacteria | 2000 |
| 86 | Ga0070688_100219939 | 3300005365 | Unclassified | 1338 |
| 87 | Ga0070688_100333556 | 3300005365 | Bacteria | 1105 |
| 88 | Ga0070688_101040028 | 3300005365 | Unclassified | 652 |
| 89 | Ga0070659_100002447 | 3300005366 | Bacteria | 13195 |
| 90 | Ga0070659_100019125 | 3300005366 | Bacteria | 5182 |
| 91 | Ga0070659_100241984 | 3300005366 | Bacteria | 1494 |
| 92 | Ga0070659_100289940 | 3300005366 | Unclassified | 1363 |
| 93 | Ga0070667_100011531 | 3300005367 | Bacteria | 7306 |
| 94 | Ga0070667_100342637 | 3300005367 | Bacteria | 1352 |
| 95 | Ga0070667_100572988 | 3300005367 | Unclassified | 1039 |
| 96 | Ga0070709_10024380 | 3300005434 | Bacteria | 3560 |
| 97 | Ga0070709_10069224 | 3300005434 | Bacteria | 2272 |
| 98 | Ga0070714_100039161 | 3300005435 | Unclassified | 3989 |
| 99 | Ga0070714_100282331 | 3300005435 | Unclassified | 1543 |
| 100 | Ga0070714_100596438 | 3300005435 | Unclassified | 1060 |
| 101 | Ga0070714_101031697 | 3300005435 | Unclassified | 801 |
| 102 | Ga0070714_101057126 | 3300005435 | Unclassified | 791 |
| 103 | Ga0070713_100033365 | 3300005436 | Unclassified | 4122 |
| 104 | Ga0070713_100180597 | 3300005436 | Bacteria | 1896 |
| 105 | Ga0070713_100531042 | 3300005436 | Unclassified | 1113 |
| 106 | Ga0070710_10015956 | 3300005437 | Bacteria | 3811 |
| 107 | Ga0070710_10116098 | 3300005437 | Bacteria | 1614 |
| 108 | Ga0070701_10194296 | 3300005438 | Bacteria | 1196 |
| 109 | Ga0070711_100076045 | 3300005439 | Bacteria | 2379 |
| 110 | Ga0070711_100167673 | 3300005439 | Bacteria | 1671 |
| 111 | Ga0070711_101180193 | 3300005439 | Unclassified | 662 |
| 112 | Ga0070705_100013479 | 3300005440 | Bacteria | 4183 |
| 113 | Ga0070705_100108098 | 3300005440 | Unclassified | 1771 |
| 114 | Ga0070705_100191789 | 3300005440 | Bacteria | 1393 |
| 115 | Ga0070705_100559772 | 3300005440 | Unclassified | 878 |
| 116 | Ga0070700_100007347 | 3300005441 | Bacteria | 5943 |
| 117 | Ga0070694_100069047 | 3300005444 | Unclassified | 2430 |
| 118 | Ga0070694_100630146 | 3300005444 | Unclassified | 866 |
| 119 | Ga0070708_100041784 | 3300005445 | Bacteria | 4021 |
| 120 | Ga0070708_100068450 | 3300005445 | Unclassified | 3191 |
| 121 | Ga0070708_100079978 | 3300005445 | Bacteria | 2957 |
| 122 | Ga0070708_100085274 | 3300005445 | Bacteria | 2867 |
| 123 | Ga0070708_100122168 | 3300005445 | Bacteria | 2403 |
| 124 | Ga0070708_100250568 | 3300005445 | Unclassified | 1664 |
| 125 | Ga0070708_100279987 | 3300005445 | Unclassified | 1570 |
| 126 | Ga0070708_100417106 | 3300005445 | Bacteria | 1266 |
| 127 | Ga0070708_100478483 | 3300005445 | Bacteria | 1175 |
| 128 | Ga0070708_100528274 | 3300005445 | Bacteria | 1113 |
| 129 | Ga0070708_100755964 | 3300005445 | Unclassified | 914 |
| 130 | Ga0070708_100784305 | 3300005445 | Unclassified | 896 |
| 131 | Ga0070708_101251842 | 3300005445 | Unclassified | 693 |
| 132 | Ga0070708_101645141 | 3300005445 | Bacteria | 597 |
| 133 | Ga0070678_100077298 | 3300005456 | Unclassified | 2510 |
| 134 | Ga0070678_100161706 | 3300005456 | Bacteria | 1815 |
| 135 | Ga0070678_100378801 | 3300005456 | Unclassified | 1224 |
| 136 | Ga0070678_101530102 | 3300005456 | Unclassified | 625 |
| 137 | Ga0070678_101758923 | 3300005456 | Unclassified | 584 |
| 138 | Ga0070662_100013958 | 3300005457 | Bacteria | 5352 |
| 139 | Ga0070662_100037879 | 3300005457 | Bacteria | 3421 |
| 140 | Ga0070662_100195624 | 3300005457 | Unclassified | 1601 |
| 141 | Ga0070662_100197453 | 3300005457 | Unclassified | 1594 |
| 142 | Ga0070662_101244077 | 3300005457 | Unclassified | 640 |
| 143 | Ga0070681_11109205 | 3300005458 | Unclassified | 712 |
| 144 | Ga0068867_100745107 | 3300005459 | Bacteria | 869 |
| 145 | Ga0070685_10173652 | 3300005466 | Unclassified | 1383 |
| 146 | Ga0070706_100000072 | 3300005467 | Bacteria | 117347 |
| 147 | Ga0070706_100005471 | 3300005467 | Bacteria | 12096 |
| 148 | Ga0070706_100009390 | 3300005467 | Bacteria | 9107 |
| 149 | Ga0070706_100010249 | 3300005467 | Bacteria | 8707 |
| 150 | Ga0070706_100029223 | 3300005467 | Bacteria | 5078 |
| 151 | Ga0070706_100086460 | 3300005467 | Bacteria | 2905 |
| 152 | Ga0070706_100108979 | 3300005467 | Bacteria | 2577 |
| 153 | Ga0070706_100122721 | 3300005467 | Unclassified | 2422 |
| 154 | Ga0070706_100371263 | 3300005467 | Bacteria | 1333 |
| 155 | Ga0070706_100374216 | 3300005467 | Bacteria | 1327 |
| 156 | Ga0070706_100508294 | 3300005467 | Unclassified | 1121 |
| 157 | Ga0070706_100516705 | 3300005467 | Unclassified | 1111 |
| 158 | Ga0070706_100917930 | 3300005467 | Bacteria | 809 |
| 159 | Ga0070706_101270453 | 3300005467 | Unclassified | 675 |
| 160 | Ga0070707_100000109 | 3300005468 | Bacteria | 75892 |
| 161 | Ga0070707_100004502 | 3300005468 | Bacteria | 13057 |
| 162 | Ga0070707_100033745 | 3300005468 | Unclassified | 4879 |
| 163 | Ga0070707_100033967 | 3300005468 | Bacteria | 4865 |
| 164 | Ga0070707_100049869 | 3300005468 | Bacteria | 4013 |
| 165 | Ga0070707_100099460 | 3300005468 | Unclassified | 2818 |
| 166 | Ga0070707_100123184 | 3300005468 | Unclassified | 2517 |
| 167 | Ga0070707_100232323 | 3300005468 | Bacteria | 1795 |
| 168 | Ga0070707_100270606 | 3300005468 | Bacteria | 1652 |
| 169 | Ga0070707_100390504 | 3300005468 | Unclassified | 1351 |
| 170 | Ga0070707_100844674 | 3300005468 | Bacteria | 880 |
| 171 | Ga0070707_100907253 | 3300005468 | Bacteria | 846 |
| 172 | Ga0070698_100002781 | 3300005471 | Bacteria | 19252 |
| 173 | Ga0070698_100043014 | 3300005471 | Bacteria | 4632 |
| 174 | Ga0070698_100096291 | 3300005471 | Bacteria | 2936 |
| 175 | Ga0070698_100268167 | 3300005471 | Bacteria | 1639 |
| 176 | Ga0070698_100462911 | 3300005471 | Unclassified | 1204 |
| 177 | Ga0070698_100518069 | 3300005471 | Bacteria | 1131 |
| 178 | Ga0070698_100549958 | 3300005471 | Unclassified | 1094 |
| 179 | Ga0070699_100048712 | 3300005518 | Bacteria | 3667 |
| 180 | Ga0070699_100462884 | 3300005518 | Bacteria | 1150 |
| 181 | Ga0070699_100578712 | 3300005518 | Unclassified | 1023 |
| 182 | Ga0070699_100679955 | 3300005518 | Unclassified | 940 |
| 183 | Ga0070679_100079603 | 3300005530 | Unclassified | 3266 |
| 184 | Ga0070684_100000339 | 3300005535 | Bacteria | 32322 |
| 185 | Ga0070684_100011918 | 3300005535 | Bacteria | 6943 |
| 186 | Ga0070697_100000972 | 3300005536 | Bacteria | 21638 |
| 187 | Ga0070697_100002822 | 3300005536 | Bacteria | 13360 |
| 188 | Ga0070697_100006284 | 3300005536 | Bacteria | 9197 |
| 189 | Ga0070697_100006722 | 3300005536 | Bacteria | 8923 |
| 190 | Ga0070697_100041385 | 3300005536 | Bacteria | 3729 |
| 191 | Ga0070697_100043601 | 3300005536 | Bacteria | 3633 |
| 192 | Ga0070697_100063362 | 3300005536 | Bacteria | 3019 |
| 193 | Ga0070697_100206732 | 3300005536 | Unclassified | 1670 |
| 194 | Ga0070697_100287079 | 3300005536 | Bacteria | 1413 |
| 195 | Ga0070697_100691538 | 3300005536 | Bacteria | 900 |
| 196 | Ga0070697_101467012 | 3300005536 | Unclassified | 609 |
| 197 | Ga0070697_101625041 | 3300005536 | Bacteria | 578 |
| 198 | Ga0070672_100091043 | 3300005543 | Unclassified | 2461 |
| 199 | Ga0070672_100558217 | 3300005543 | Bacteria | 995 |
| 200 | Ga0070672_101420624 | 3300005543 | Bacteria | 621 |
| 201 | Ga0070686_100737559 | 3300005544 | Bacteria | 789 |
| 202 | Ga0070693_100196586 | 3300005547 | Bacteria | 1307 |
| 203 | Ga0070693_100480160 | 3300005547 | Bacteria | 878 |
| 204 | Ga0070665_100026148 | 3300005548 | Bacteria | 5877 |
| 205 | Ga0070665_100044098 | 3300005548 | Unclassified | 4479 |
| 206 | Ga0070665_100194261 | 3300005548 | Unclassified | 2030 |
| 207 | Ga0070665_101359483 | 3300005548 | Unclassified | 720 |
| 208 | Ga0070665_102560971 | 3300005548 | Unclassified | 511 |
| 209 | Ga0068855_100995961 | 3300005563 | Unclassified | 881 |
| 210 | Ga0068855_102613598 | 3300005563 | Bacteria | 501 |
| 211 | Ga0070664_100019044 | 3300005564 | Bacteria | 5644 |
| 212 | Ga0070664_100747533 | 3300005564 | Unclassified | 913 |
| 213 | Ga0070664_101621615 | 3300005564 | Unclassified | 613 |
| 214 | Ga0068857_101477572 | 3300005577 | Unclassified | 662 |
| 215 | Ga0068856_100132185 | 3300005614 | Unclassified | 2500 |
| 216 | Ga0068856_100492843 | 3300005614 | Bacteria | 1246 |
| 217 | Ga0068856_101157714 | 3300005614 | Unclassified | 790 |
| 218 | Ga0068859_100122181 | 3300005617 | Unclassified | 2671 |
| 219 | Ga0068864_101706582 | 3300005618 | Bacteria | 634 |
| 220 | Ga0068864_101817147 | 3300005618 | Bacteria | 615 |
| 221 | Ga0068866_10589270 | 3300005718 | Unclassified | 749 |
| 222 | Ga0068861_100188944 | 3300005719 | Bacteria | 1720 |
| 223 | Ga0068861_100460535 | 3300005719 | Unclassified | 1141 |
| 224 | Ga0068861_101096719 | 3300005719 | Unclassified | 765 |
| 225 | Ga0068863_100028985 | 3300005841 | Bacteria | 5287 |
| 226 | Ga0068863_100187212 | 3300005841 | Bacteria | 1989 |
| 227 | Ga0068863_100222101 | 3300005841 | Unclassified | 1821 |
| 228 | Ga0068858_100136552 | 3300005842 | Bacteria | 2301 |
| 229 | Ga0068858_102585579 | 3300005842 | Unclassified | 501 |
| 230 | Ga0068860_100007141 | 3300005843 | Bacteria | 11173 |
| 231 | Ga0068860_100016535 | 3300005843 | Bacteria | 7195 |
| 232 | Ga0068860_100530428 | 3300005843 | Bacteria | 1178 |
| 233 | Ga0068860_100955990 | 3300005843 | Unclassified | 874 |
| 234 | Ga0068862_100023514 | 3300005844 | Bacteria | 5164 |
| 235 | Ga0068862_100837204 | 3300005844 | Unclassified | 901 |
| 236 | Ga0081455_10001013 | 3300005937 | Bacteria | 35565 |
| 237 | Ga0081455_10001533 | 3300005937 | Bacteria | 28455 |
| 238 | Ga0081455_10001733 | 3300005937 | Bacteria | 26391 |
| 239 | Ga0081455_10015737 | 3300005937 | Bacteria | 7328 |
| 240 | Ga0081455_10032715 | 3300005937 | Unclassified | 4684 |
| 241 | Ga0081455_10109261 | 3300005937 | Unclassified | 2201 |
| 242 | Ga0081455_10162310 | 3300005937 | Bacteria | 1711 |
| 243 | Ga0081540_1000219 | 3300005983 | Bacteria | 60720 |
| 244 | Ga0081540_1015104 | 3300005983 | Bacteria | 4901 |
| 245 | Ga0081540_1037572 | 3300005983 | Bacteria | 2564 |
| 246 | Ga0081539_10006483 | 3300005985 | Bacteria | 11201 |
| 247 | Ga0081539_10021018 | 3300005985 | Bacteria | 4380 |
| 248 | Ga0070717_10001521 | 3300006028 | Bacteria | 16061 |
| 249 | Ga0070717_10035293 | 3300006028 | Unclassified | 4047 |
| 250 | Ga0070717_10131765 | 3300006028 | Bacteria | 2150 |
| 251 | Ga0070717_10138149 | 3300006028 | Bacteria | 2100 |
| 252 | Ga0070717_10159582 | 3300006028 | Unclassified | 1956 |
| 253 | Ga0070717_10165854 | 3300006028 | Unclassified | 1919 |
| 254 | Ga0070717_10374248 | 3300006028 | Unclassified | 1276 |
| 255 | Ga0070717_10424435 | 3300006028 | Unclassified | 1196 |
| 256 | Ga0070717_10579111 | 3300006028 | Bacteria | 1018 |
| 257 | Ga0070717_10902118 | 3300006028 | Unclassified | 805 |
| 258 | Ga0070715_10027744 | 3300006163 | Bacteria | 2264 |
| 259 | Ga0070715_10692793 | 3300006163 | Unclassified | 608 |
| 260 | Ga0070716_100058481 | 3300006173 | Bacteria | 2219 |
| 261 | Ga0070716_100128963 | 3300006173 | Bacteria | 1596 |
| 262 | Ga0070716_100327038 | 3300006173 | Unclassified | 1076 |
| 263 | Ga0070716_100417835 | 3300006173 | Unclassified | 969 |
| 264 | Ga0070716_100501710 | 3300006173 | Bacteria | 895 |
| 265 | Ga0070716_101056496 | 3300006173 | Unclassified | 645 |
| 266 | Ga0070716_101563517 | 3300006173 | Unclassified | 541 |
| 267 | Ga0070712_100011735 | 3300006175 | Bacteria | 5566 |
| 268 | Ga0070712_100022920 | 3300006175 | Bacteria | 4117 |
| 269 | Ga0070712_100030331 | 3300006175 | Bacteria | 3632 |
| 270 | Ga0070712_100047912 | 3300006175 | Unclassified | 2960 |
| 271 | Ga0070712_100137080 | 3300006175 | Bacteria | 1862 |
| 272 | Ga0070712_100192324 | 3300006175 | Bacteria | 1597 |
| 273 | Ga0070712_101663655 | 3300006175 | Unclassified | 559 |
| 274 | Ga0070712_101698782 | 3300006175 | Unclassified | 553 |
| 275 | Ga0097621_100187001 | 3300006237 | Bacteria | 1792 |
| 276 | Ga0068871_101588954 | 3300006358 | Unclassified | 619 |
| 277 | Ga0075428_100157559 | 3300006844 | Unclassified | 2466 |
| 278 | Ga0075428_100232614 | 3300006844 | Bacteria | 1989 |
| 279 | Ga0075428_100297121 | 3300006844 | Bacteria | 1737 |
| 280 | Ga0075434_100857505 | 3300006871 | Bacteria | 924 |
| 281 | Ga0075434_100980788 | 3300006871 | Unclassified | 859 |
| 282 | Ga0075434_101592427 | 3300006871 | Bacteria | 662 |
| 283 | Ga0068865_100092212 | 3300006881 | Bacteria | 2200 |
| 284 | Ga0068865_100263890 | 3300006881 | Bacteria | 1364 |
| 285 | Ga0068865_100389191 | 3300006881 | Unclassified | 1139 |
| 286 | Ga0068865_101051937 | 3300006881 | Unclassified | 715 |
| 287 | Ga0075436_100033364 | 3300006914 | Bacteria | 3549 |
| 288 | Ga0097620_100122180 | 3300006931 | Unclassified | 2671 |
| 289 | Ga0075435_100472888 | 3300007076 | Bacteria | 1082 |
| 290 | Ga0099794_10047721 | 3300007265 | Bacteria | 2054 |
| 291 | Ga0099794_10154287 | 3300007265 | Unclassified | 1166 |
| 292 | Ga0099794_10218460 | 3300007265 | Bacteria | 979 |
| 293 | Ga0099794_10262184 | 3300007265 | Unclassified | 892 |
| 294 | Ga0105245_10144256 | 3300009098 | Unclassified | 2245 |
| 295 | Ga0105245_10385283 | 3300009098 | Bacteria | 1397 |
| 296 | Ga0105245_13248276 | 3300009098 | Unclassified | 503 |
| 297 | Ga0105247_10142308 | 3300009101 | Unclassified | 1573 |
| 298 | Ga0105247_10879572 | 3300009101 | Unclassified | 690 |
| 299 | Ga0114129_10008863 | 3300009147 | Bacteria | 14354 |
| 300 | Ga0114129_10316491 | 3300009147 | Bacteria | 2076 |
| 301 | Ga0114129_10366260 | 3300009147 | Unclassified | 1906 |
| 302 | Ga0114129_11308582 | 3300009147 | Bacteria | 898 |
| 303 | Ga0114129_11957369 | 3300009147 | Unclassified | 710 |
| 304 | Ga0105243_11751143 | 3300009148 | Unclassified | 651 |
| 305 | Ga0105243_12291887 | 3300009148 | Unclassified | 577 |
| 306 | Ga0105241_11230855 | 3300009174 | Unclassified | 710 |
| 307 | Ga0105242_10072817 | 3300009176 | Bacteria | 2855 |
| 308 | Ga0105242_10844249 | 3300009176 | Unclassified | 911 |
| 309 | Ga0105248_12310537 | 3300009177 | Unclassified | 612 |
| 310 | Ga0105249_10006132 | 3300009553 | Bacteria | 10429 |
| 311 | Ga0099796_10354835 | 3300010159 | Unclassified | 633 |
| 312 | Ga0105239_10010133 | 3300010375 | Bacteria | 10563 |
| 313 | Ga0105239_10321735 | 3300010375 | Unclassified | 1744 |
| 314 | Ga0105239_12086960 | 3300010375 | Unclassified | 658 |
| 315 | Ga0157318_1017338 | 3300012482 | Unclassified | 607 |
| 316 | Ga0157342_1006117 | 3300012507 | Bacteria | 1127 |
| 317 | Ga0157371_10229925 | 3300013102 | Bacteria | 1333 |
| 318 | Ga0157370_10139506 | 3300013104 | Bacteria | 2259 |
| 319 | Ga0157369_12218099 | 3300013105 | Unclassified | 557 |
| 320 | Ga0157374_10017287 | 3300013296 | Bacteria | 6347 |
| 321 | Ga0157374_10054286 | 3300013296 | Bacteria | 3737 |
| 322 | Ga0157374_10091230 | 3300013296 | Bacteria | 2905 |
| 323 | Ga0157374_10131036 | 3300013296 | Bacteria | 2427 |
| 324 | Ga0157374_10535697 | 3300013296 | Bacteria | 1178 |
| 325 | Ga0157378_10005373 | 3300013297 | Bacteria | 11235 |
| 326 | Ga0157378_10139027 | 3300013297 | Bacteria | 2254 |
| 327 | Ga0157378_10144731 | 3300013297 | Bacteria | 2210 |
| 328 | Ga0157378_10685852 | 3300013297 | Unclassified | 1043 |
| 329 | Ga0157378_10928998 | 3300013297 | Bacteria | 902 |
| 330 | Ga0157378_12317584 | 3300013297 | Unclassified | 588 |
| 331 | Ga0163162_10004774 | 3300013306 | Bacteria | 13081 |
| 332 | Ga0163162_10029198 | 3300013306 | Bacteria | 5457 |
| 333 | Ga0163162_10738829 | 3300013306 | Unclassified | 1104 |
| 334 | Ga0163162_10804296 | 3300013306 | Unclassified | 1057 |
| 335 | Ga0157375_10218626 | 3300013308 | Bacteria | 2063 |
| 336 | Ga0157375_10394978 | 3300013308 | Unclassified | 1550 |
| 337 | Ga0157375_10408480 | 3300013308 | Unclassified | 1524 |
| 338 | Ga0163163_10277836 | 3300014325 | Bacteria | 1726 |
| 339 | Ga0182008_10245154 | 3300014497 | Unclassified | 923 |
| 340 | Ga0157377_10151419 | 3300014745 | Bacteria | 1434 |
| 341 | Ga0157377_10607781 | 3300014745 | Unclassified | 781 |
| 342 | Ga0157376_10276716 | 3300014969 | Bacteria | 1579 |
| 343 | Ga0157376_10279623 | 3300014969 | Bacteria | 1571 |
| 344 | Ga0182007_10033168 | 3300015262 | Bacteria | 1751 |
| 345 | Ga0182005_1038094 | 3300015265 | Bacteria | 1308 |
| 346 | Ga0163161_10088045 | 3300017792 | Unclassified | 2295 |
| 347 | Ga0163161_10397770 | 3300017792 | Bacteria | 1104 |
| 348 | Ga0163161_11221105 | 3300017792 | Bacteria | 651 |
| 349 | Ga0163161_11469777 | 3300017792 | Unclassified | 597 |
| 350 | Ga0207666_1003711 | 3300025271 | Bacteria | 1885 |
| 351 | Ga0207673_1005354 | 3300025290 | Unclassified | 1563 |
| 352 | Ga0207673_1029274 | 3300025290 | Unclassified | 760 |
| 353 | Ga0207697_10000198 | 3300025315 | Bacteria | 32108 |
| 354 | Ga0207697_10000615 | 3300025315 | Bacteria | 20202 |
| 355 | Ga0207697_10006960 | 3300025315 | Bacteria | 5071 |
| 356 | Ga0207697_10026007 | 3300025315 | Bacteria | 2393 |
| 357 | Ga0207697_10035154 | 3300025315 | Unclassified | 2051 |
| 358 | Ga0207697_10102945 | 3300025315 | Bacteria | 1218 |
| 359 | Ga0207653_10019312 | 3300025885 | Bacteria | 2149 |
| 360 | Ga0207692_10014288 | 3300025898 | Bacteria | 3466 |
| 361 | Ga0207692_10288038 | 3300025898 | Unclassified | 996 |
| 362 | Ga0207692_10436226 | 3300025898 | Bacteria | 822 |
| 363 | Ga0207692_10635252 | 3300025898 | Unclassified | 689 |
| 364 | Ga0207642_10071464 | 3300025899 | Unclassified | 1653 |
| 365 | Ga0207710_10115872 | 3300025900 | Bacteria | 1276 |
| 366 | Ga0207688_10033445 | 3300025901 | Bacteria | 2844 |
| 367 | Ga0207688_10055418 | 3300025901 | Unclassified | 2225 |
| 368 | Ga0207688_10171558 | 3300025901 | Unclassified | 1290 |
| 369 | Ga0207688_10848699 | 3300025901 | Unclassified | 578 |
| 370 | Ga0207647_10003507 | 3300025904 | Bacteria | 11756 |
| 371 | Ga0207647_10201463 | 3300025904 | Unclassified | 1151 |
| 372 | Ga0207699_10020111 | 3300025906 | Bacteria | 3572 |
| 373 | Ga0207699_10020756 | 3300025906 | Bacteria | 3527 |
| 374 | Ga0207699_10037964 | 3300025906 | Bacteria | 2757 |
| 375 | Ga0207699_10808799 | 3300025906 | Unclassified | 689 |
| 376 | Ga0207645_10000634 | 3300025907 | Bacteria | 29170 |
| 377 | Ga0207645_10296910 | 3300025907 | Bacteria | 1075 |
| 378 | Ga0207684_10000043 | 3300025910 | Bacteria | 259939 |
| 379 | Ga0207684_10002590 | 3300025910 | Bacteria | 18114 |
| 380 | Ga0207684_10013932 | 3300025910 | Bacteria | 6946 |
| 381 | Ga0207684_10014275 | 3300025910 | Bacteria | 6853 |
| 382 | Ga0207684_10090439 | 3300025910 | Unclassified | 2608 |
| 383 | Ga0207684_10102581 | 3300025910 | Unclassified | 2446 |
| 384 | Ga0207684_10104807 | 3300025910 | Unclassified | 2418 |
| 385 | Ga0207684_10114257 | 3300025910 | Bacteria | 2312 |
| 386 | Ga0207684_10223835 | 3300025910 | Bacteria | 1624 |
| 387 | Ga0207684_10338568 | 3300025910 | Unclassified | 1296 |
| 388 | Ga0207684_11212891 | 3300025910 | Unclassified | 624 |
| 389 | Ga0207707_10019153 | 3300025912 | Bacteria | 5974 |
| 390 | Ga0207693_10003135 | 3300025915 | Bacteria | 14217 |
| 391 | Ga0207693_10036469 | 3300025915 | Bacteria | 3876 |
| 392 | Ga0207693_10067125 | 3300025915 | Bacteria | 2808 |
| 393 | Ga0207693_10068240 | 3300025915 | Bacteria | 2783 |
| 394 | Ga0207693_10130519 | 3300025915 | Bacteria | 1975 |
| 395 | Ga0207693_10178468 | 3300025915 | Bacteria | 1671 |
| 396 | Ga0207693_10547745 | 3300025915 | Bacteria | 902 |
| 397 | Ga0207693_10798027 | 3300025915 | Bacteria | 728 |
| 398 | Ga0207663_10004136 | 3300025916 | Bacteria | 7182 |
| 399 | Ga0207663_10094038 | 3300025916 | Bacteria | 1996 |
| 400 | Ga0207663_10180225 | 3300025916 | Unclassified | 1508 |
| 401 | Ga0207663_11200513 | 3300025916 | Unclassified | 611 |
| 402 | Ga0207663_11234044 | 3300025916 | Unclassified | 602 |
| 403 | Ga0207662_10000729 | 3300025918 | Bacteria | 15055 |
| 404 | Ga0207662_10078562 | 3300025918 | Unclassified | 2009 |
| 405 | Ga0207662_10109123 | 3300025918 | Unclassified | 1724 |
| 406 | Ga0207657_10227491 | 3300025919 | Unclassified | 1492 |
| 407 | Ga0207657_10660204 | 3300025919 | Bacteria | 814 |
| 408 | Ga0207657_10945221 | 3300025919 | Unclassified | 663 |
| 409 | Ga0207649_10135697 | 3300025920 | Unclassified | 1677 |
| 410 | Ga0207649_10297207 | 3300025920 | Bacteria | 1179 |
| 411 | Ga0207649_10598703 | 3300025920 | Bacteria | 848 |
| 412 | Ga0207652_10070834 | 3300025921 | Unclassified | 3028 |
| 413 | Ga0207646_10000445 | 3300025922 | Bacteria | 55392 |
| 414 | Ga0207646_10022902 | 3300025922 | Bacteria | 5743 |
| 415 | Ga0207646_10023218 | 3300025922 | Bacteria | 5700 |
| 416 | Ga0207646_10023608 | 3300025922 | Bacteria | 5647 |
| 417 | Ga0207646_10047452 | 3300025922 | Unclassified | 3852 |
| 418 | Ga0207646_10102624 | 3300025922 | Bacteria | 2564 |
| 419 | Ga0207646_10115900 | 3300025922 | Bacteria | 2406 |
| 420 | Ga0207646_10153742 | 3300025922 | Bacteria | 2075 |
| 421 | Ga0207646_10161021 | 3300025922 | Unclassified | 2025 |
| 422 | Ga0207646_10199819 | 3300025922 | Bacteria | 1806 |
| 423 | Ga0207646_10386819 | 3300025922 | Bacteria | 1264 |
| 424 | Ga0207646_10454050 | 3300025922 | Bacteria | 1156 |
| 425 | Ga0207646_10684060 | 3300025922 | Bacteria | 918 |
| 426 | Ga0207646_10695728 | 3300025922 | Bacteria | 909 |
| 427 | Ga0207646_10780031 | 3300025922 | Unclassified | 852 |
| 428 | Ga0207681_10029154 | 3300025923 | Bacteria | 3580 |
| 429 | Ga0207681_10582195 | 3300025923 | Unclassified | 923 |
| 430 | Ga0207681_10668328 | 3300025923 | Unclassified | 862 |
| 431 | Ga0207650_10462895 | 3300025925 | Unclassified | 1056 |
| 432 | Ga0207650_11184410 | 3300025925 | Unclassified | 650 |
| 433 | Ga0207659_10033165 | 3300025926 | Bacteria | 3551 |
| 434 | Ga0207659_10470938 | 3300025926 | Bacteria | 1060 |
| 435 | Ga0207659_10807366 | 3300025926 | Bacteria | 806 |
| 436 | Ga0207659_11405593 | 3300025926 | Unclassified | 598 |
| 437 | Ga0207687_11070051 | 3300025927 | Bacteria | 692 |
| 438 | Ga0207700_10016817 | 3300025928 | Unclassified | 4870 |
| 439 | Ga0207700_10068397 | 3300025928 | Bacteria | 2722 |
| 440 | Ga0207700_10700608 | 3300025928 | Bacteria | 904 |
| 441 | Ga0207700_10874958 | 3300025928 | Unclassified | 804 |
| 442 | Ga0207664_10022640 | 3300025929 | Bacteria | 4696 |
| 443 | Ga0207664_10762245 | 3300025929 | Unclassified | 870 |
| 444 | Ga0207664_10778727 | 3300025929 | Bacteria | 861 |
| 445 | Ga0207664_11390910 | 3300025929 | Unclassified | 622 |
| 446 | Ga0207644_10264100 | 3300025931 | Unclassified | 1377 |
| 447 | Ga0207644_10397607 | 3300025931 | Bacteria | 1126 |
| 448 | Ga0207644_10910045 | 3300025931 | Unclassified | 737 |
| 449 | Ga0207690_10015254 | 3300025932 | Bacteria | 4652 |
| 450 | Ga0207690_10057717 | 3300025932 | Unclassified | 2623 |
| 451 | Ga0207690_10780385 | 3300025932 | Unclassified | 789 |
| 452 | Ga0207706_10000702 | 3300025933 | Bacteria | 35016 |
| 453 | Ga0207706_10004250 | 3300025933 | Bacteria | 13487 |
| 454 | Ga0207706_10034666 | 3300025933 | Bacteria | 4491 |
| 455 | Ga0207706_10067030 | 3300025933 | Unclassified | 3158 |
| 456 | Ga0207706_10122914 | 3300025933 | Unclassified | 2283 |
| 457 | Ga0207706_11272115 | 3300025933 | Unclassified | 609 |
| 458 | Ga0207686_10310290 | 3300025934 | Bacteria | 1175 |
| 459 | Ga0207686_10725371 | 3300025934 | Unclassified | 792 |
| 460 | Ga0207709_10477311 | 3300025935 | Bacteria | 969 |
| 461 | Ga0207670_10001041 | 3300025936 | Bacteria | 14653 |
| 462 | Ga0207670_10008309 | 3300025936 | Bacteria | 5850 |
| 463 | Ga0207670_10013214 | 3300025936 | Unclassified | 4859 |
| 464 | Ga0207669_10097593 | 3300025937 | Bacteria | 1933 |
| 465 | Ga0207669_10499061 | 3300025937 | Unclassified | 973 |
| 466 | Ga0207669_10847013 | 3300025937 | Unclassified | 761 |
| 467 | Ga0207704_10136861 | 3300025938 | Bacteria | 1707 |
| 468 | Ga0207704_10181536 | 3300025938 | Bacteria | 1521 |
| 469 | Ga0207665_10059517 | 3300025939 | Unclassified | 2585 |
| 470 | Ga0207665_10071138 | 3300025939 | Bacteria | 2374 |
| 471 | Ga0207665_10072053 | 3300025939 | Bacteria | 2359 |
| 472 | Ga0207665_10095189 | 3300025939 | Bacteria | 2069 |
| 473 | Ga0207665_10112680 | 3300025939 | Unclassified | 1913 |
| 474 | Ga0207665_10260433 | 3300025939 | Unclassified | 1285 |
| 475 | Ga0207665_10262793 | 3300025939 | Bacteria | 1279 |
| 476 | Ga0207665_10322684 | 3300025939 | Bacteria | 1159 |
| 477 | Ga0207665_10348787 | 3300025939 | Bacteria | 1117 |
| 478 | Ga0207665_10631143 | 3300025939 | Unclassified | 838 |
| 479 | Ga0207665_10953193 | 3300025939 | Bacteria | 682 |
| 480 | Ga0207711_10142669 | 3300025941 | Bacteria | 2156 |
| 481 | Ga0207711_11550177 | 3300025941 | Unclassified | 606 |
| 482 | Ga0207689_10017873 | 3300025942 | Bacteria | 5989 |
| 483 | Ga0207689_10812936 | 3300025942 | Unclassified | 789 |
| 484 | Ga0207689_11107945 | 3300025942 | Unclassified | 667 |
| 485 | Ga0207661_10040715 | 3300025944 | Unclassified | 3654 |
| 486 | Ga0207661_10176182 | 3300025944 | Bacteria | 1864 |
| 487 | Ga0207661_10266315 | 3300025944 | Unclassified | 1528 |
| 488 | Ga0207661_10364083 | 3300025944 | Unclassified | 1306 |
| 489 | Ga0207679_10320969 | 3300025945 | Bacteria | 1341 |
| 490 | Ga0207679_11610069 | 3300025945 | Unclassified | 595 |
| 491 | Ga0207651_10184030 | 3300025960 | Bacteria | 1660 |
| 492 | Ga0207651_10219032 | 3300025960 | Bacteria | 1537 |
| 493 | Ga0207651_10948874 | 3300025960 | Bacteria | 767 |
| 494 | Ga0207651_11750343 | 3300025960 | Unclassified | 559 |
| 495 | Ga0207712_10008042 | 3300025961 | Bacteria | 6671 |
| 496 | Ga0207712_10704277 | 3300025961 | Unclassified | 882 |
| 497 | Ga0207668_10058506 | 3300025972 | Unclassified | 2694 |
| 498 | Ga0207668_10182365 | 3300025972 | Bacteria | 1657 |
| 499 | Ga0207668_11353412 | 3300025972 | Unclassified | 641 |
| 500 | Ga0207658_10067236 | 3300025986 | Unclassified | 2698 |
| 501 | Ga0207658_10142278 | 3300025986 | Bacteria | 1943 |
| 502 | Ga0207658_10287368 | 3300025986 | Unclassified | 1412 |
| 503 | Ga0207658_10967455 | 3300025986 | Unclassified | 776 |
| 504 | Ga0207677_10010730 | 3300026023 | Bacteria | 5193 |
| 505 | Ga0207677_10067575 | 3300026023 | Bacteria | 2504 |
| 506 | Ga0207677_11293574 | 3300026023 | Unclassified | 670 |
| 507 | Ga0207703_10693333 | 3300026035 | Unclassified | 968 |
| 508 | Ga0207703_11662747 | 3300026035 | Unclassified | 614 |
| 509 | Ga0207639_11791631 | 3300026041 | Bacteria | 575 |
| 510 | Ga0207678_10005303 | 3300026067 | Bacteria | 11544 |
| 511 | Ga0207708_10027450 | 3300026075 | Unclassified | 4310 |
| 512 | Ga0207708_11039842 | 3300026075 | Unclassified | 713 |
| 513 | Ga0207702_10410040 | 3300026078 | Unclassified | 1308 |
| 514 | Ga0207702_10411609 | 3300026078 | Unclassified | 1306 |
| 515 | Ga0207641_10018693 | 3300026088 | Bacteria | 5682 |
| 516 | Ga0207641_10121877 | 3300026088 | Bacteria | 2328 |
| 517 | Ga0207641_10296880 | 3300026088 | Bacteria | 1525 |
| 518 | Ga0207648_11275469 | 3300026089 | Unclassified | 690 |
| 519 | Ga0207676_10247421 | 3300026095 | Unclassified | 1603 |
| 520 | Ga0207676_11720564 | 3300026095 | Bacteria | 625 |
| 521 | Ga0207675_100328522 | 3300026118 | Bacteria | 1494 |
| 522 | Ga0207675_100701060 | 3300026118 | Bacteria | 1021 |
| 523 | Ga0207675_101316075 | 3300026118 | Bacteria | 743 |
| 524 | Ga0207683_10011404 | 3300026121 | Bacteria | 7585 |
| 525 | Ga0207698_10421004 | 3300026142 | Bacteria | 1281 |
| 526 | Ga0209179_1031237 | 3300027512 | Unclassified | 1092 |
| 527 | Ga0210002_1025868 | 3300027617 | Bacteria | 961 |
| 528 | Ga0209588_1150302 | 3300027671 | Bacteria | 738 |
| 529 | Ga0209971_1022651 | 3300027682 | Bacteria | 1497 |
| 530 | Ga0209974_10100448 | 3300027876 | Unclassified | 1011 |
| 531 | Ga0268266_10032203 | 3300028379 | Unclassified | 4455 |
| 532 | Ga0268266_10056268 | 3300028379 | Unclassified | 3383 |
| 533 | Ga0268266_10237278 | 3300028379 | Unclassified | 1681 |
| 534 | Ga0268266_10963811 | 3300028379 | Unclassified | 825 |
| 535 | Ga0268265_10007154 | 3300028380 | Bacteria | 7538 |
| 536 | Ga0268264_10014335 | 3300028381 | Bacteria | 6518 |
| 537 | Ga0268264_10520072 | 3300028381 | Unclassified | 1163 |
| 538 | Ga0268264_12279227 | 3300028381 | Unclassified | 549 |
| 539 | Ga0307513_10111511 | 3300031456 | Bacteria | 2728 |
| 540 | Ga0373938_0145101 | 3300034957 | Unclassified | 628 |
| 541 | Ga0373929_0131432 | 3300035085 | Unclassified | 657 |
| 542 | Ga0373923_0084701 | 3300035111 | Bacteria | 1379 |
| 543 | Ga0373936_0304864 | 3300035113 | Unclassified | 719 |
| 544 | Ga0373939_0170926 | 3300035114 | Unclassified | 804 |
| 545 | Ga0373941_0208557 | 3300035115 | Unclassified | 746 |
| 546 | Ga0373953_0132046 | 3300035117 | Unclassified | 1065 |
| 547 | Ga0373956_0026317 | 3300035119 | Unclassified | 2519 |
| 548 | Ga0373943_0066429 | 3300035170 | Bacteria | 1816 |
| 549 | Ga0373943_0211949 | 3300035170 | Unclassified | 1076 |
| 550 | Ga0373943_0251899 | 3300035170 | Unclassified | 992 |
| 551 | Ga0373955_0798973 | 3300035172 | Unclassified | 580 |
| 552 | Ga0373961_0129639 | 3300035241 | Unclassified | 843 |
| 553 | Ga0373931_0027665 | 3300035691 | Unclassified | 2897 |
| 554 | Ga0373931_0360508 | 3300035691 | Bacteria | 912 |
| 555 | Ga0373935_0016674 | 3300035692 | Bacteria | 4446 |
| 556 | Ga0373947_0032662 | 3300035725 | Bacteria | 3069 |
| 557 | Ga0373947_0229333 | 3300035725 | Bacteria | 1223 |
| 558 | Ga0395899_0083103 | 3300037312 | Unclassified | 2329 |
| 559 | Ga0395900_0033096 | 3300037418 | Bacteria | 5320 |
| 560 | Ga0395900_0132881 | 3300037418 | Bacteria | 2550 |
| 561 | Ga0395900_0251244 | 3300037418 | Bacteria | 1770 |
| 562 | Ga0395900_0475832 | 3300037418 | Bacteria | 1202 |
| 563 | Ga0395900_0732363 | 3300037418 | Bacteria | 920 |
| 564 | Ga0395905_0035375 | 3300037471 | Bacteria | 4690 |
| 565 | Ga0395905_0439588 | 3300037471 | Unclassified | 1202 |
| 566 | Ga0395901_0029202 | 3300038443 | Bacteria | 5675 |
| 567 | Ga0395901_0128259 | 3300038443 | Bacteria | 2666 |
| 568 | Ga0395901_0181757 | 3300038443 | Bacteria | 2206 |
| 569 | Ga0395901_1297587 | 3300038443 | Unclassified | 690 |
| 570 | Ga0395901_1739691 | 3300038443 | Unclassified | 574 |
| 571 | Ga0436363_0527460 | 3300039450 | Unclassified | 511 |
| 572 | Ga0451789_0379071 | 3300041443 | Unclassified | 787 |
| 573 | Ga0451800_1503148 | 3300041459 | Bacteria | 641 |
| 574 | Ga0451804_1160921 | 3300041463 | Bacteria | 594 |
| 575 | Ga0451807_1549576 | 3300041486 | Bacteria | 1270 |
| 576 | Ga0451807_1920741 | 3300041486 | Bacteria | 622 |
| 577 | Ga0451853_2864927 | 3300041512 | Unclassified | 763 |
| 578 | Ga0439448_0090645 | 3300042005 | Unclassified | 1033 |
| 579 | Ga0439451_030035 | 3300042009 | Unclassified | 1093 |
| 580 | Ga0453683_0247106 | 3300044673 | Bacteria | 1137 |
| 581 | Ga0451576_0036267 | 3300045051 | Bacteria | 5228 |
| 582 | Ga0495592_0014862 | 3300046454 | Bacteria | 5910 |
| 583 | Ga0495629_0089648 | 3300046459 | Unclassified | 2145 |
| 584 | Ga0495580_0222887 | 3300046472 | Unclassified | 1296 |
| 585 | Ga0495584_0097678 | 3300046491 | Bacteria | 1484 |
| 586 | Ga0495628_0835665 | 3300046516 | Unclassified | 642 |
| 587 | Ga0495587_0016884 | 3300046536 | Unclassified | 4539 |
| 588 | Ga0495667_0256227 | 3300046559 | Unclassified | 1113 |
| 589 | Ga0495588_0742587 | 3300046674 | Unclassified | 513 |
| 590 | Ga0495599_0035607 | 3300046678 | Unclassified | 3125 |
| 591 | Ga0495623_0031772 | 3300046679 | Bacteria | 3394 |
| 592 | Ga0495669_0132238 | 3300046684 | Unclassified | 1175 |
| 593 | Ga0495604_0046620 | 3300047317 | Unclassified | 3379 |
| 594 | Ga0495675_0008938 | 3300047444 | Bacteria | 6227 |
| 595 | Ga0495602_0076232 | 3300048088 | Bacteria | 2842 |
| 596 | Ga0496100_0663381 | 3300048903 | Bacteria | 813 |
| 597 | Ga0496101_1093157 | 3300048904 | Unclassified | 626 |
| 598 | Ga0496102_0582192 | 3300048905 | Bacteria | 1042 |
| 599 | Ga0496103_1062683 | 3300048906 | Unclassified | 502 |
| 600 | Ga0496104_0336703 | 3300048907 | Bacteria | 1422 |
| 601 | Ga0496105_0134919 | 3300048908 | Bacteria | 2034 |
| 602 | Ga0496105_0566684 | 3300048908 | Unclassified | 885 |
| 603 | Ga0496106_0975692 | 3300048909 | Unclassified | 667 |
| 604 | Ga0496107_0228405 | 3300048910 | Bacteria | 1385 |
| 605 | Ga0496107_0349241 | 3300048910 | Bacteria | 1101 |
| 606 | Ga0496108_0151202 | 3300048911 | Bacteria | 2003 |
| 607 | Ga0496108_0513020 | 3300048911 | Bacteria | 1047 |
| 608 | Ga0496109_0010796 | 3300048912 | Bacteria | 7820 |
| 609 | Ga0496109_0065137 | 3300048912 | Bacteria | 3336 |
| 610 | Ga0496110_0332551 | 3300048913 | Unclassified | 1384 |
| 611 | Ga0496110_1706339 | 3300048913 | Unclassified | 540 |
| 612 | Ga0496112_0008465 | 3300048915 | Bacteria | 9218 |
| 613 | Ga0496112_1271058 | 3300048915 | Unclassified | 652 |
| 614 | Ga0496113_0028847 | 3300048916 | Bacteria | 3997 |
| 615 | Ga0496113_0592833 | 3300048916 | Bacteria | 888 |
| 616 | Ga0496114_0039983 | 3300048917 | Bacteria | 3881 |
| 617 | Ga0496115_0022124 | 3300048918 | Bacteria | 4919 |
| 618 | Ga0496115_0027647 | 3300048918 | Bacteria | 4439 |
| 619 | nmdc:mga05p37_343017_c1 | 3300050507 | Bacteria | 1761 |
| 620 | nmdc:mga05p37_344208_c1 | 3300050507 | Unclassified | 1757 |
| 621 | nmdc:mga05p37_5948_c1 | 3300050507 | Bacteria | 14354 |
| 622 | nmdc:mga08y16_575985_c1 | 3300050511 | Unclassified | 1137 |
| 623 | nmdc:mga0n895_344504_c1 | 3300050512 | Unclassified | 1509 |
| 624 | nmdc:mga0rr50_920669_c1 | 3300050513 | Unclassified | 745 |
| 625 | nmdc:mga08x19_41768_c1 | 3300050514 | Bacteria | 2921 |
| 626 | Ga0495655_0058346 | 3300053083 | Unclassified | 1045 |
| 627 | Ga0500618_083669 | 3300053125 | Unclassified | 716 |
| 628 | Ga0070711_100003824 | |||
| 629 | SwRhRL2b_contig_3434452 | |||
| 630 | MBSR1b_contig_6760597 | |||
| 631 | JGI24746J21847_1005009 | |||
| 632 | JGI24750J21931_1025851 | |||
| 633 | JGI25404J52841_10072869 | |||
| 634 | Ga0065703_1022475 | |||
| 635 | Ga0065704_10017679 | |||
| 636 | Ga0065704_10094320 | |||
| 637 | Ga0065704_10202793 | |||
| 638 | Ga0065704_10229432 | |||
| 639 | Ga0065704_10375795 | |||
| 640 | Ga0065704_10439644 | |||
| 641 | Ga0065712_10001064 | |||
| 642 | Ga0065712_10020335 | |||
| 643 | Ga0065712_10132930 | |||
| 644 | Ga0065712_10136744 | |||
| 645 | Ga0065712_10137278 | |||
| 646 | Ga0065712_10194486 | |||
| 647 | Ga0065712_10321977 | |||
| 648 | Ga0065712_10487132 | |||
| 649 | Ga0065715_10000989 | |||
| 650 | Ga0065715_10034440 | |||
| 651 | Ga0065715_10043178 | |||
| 652 | Ga0065715_10108246 | |||
| 653 | Ga0065715_10143749 | |||
| 654 | Ga0065715_10208422 | |||
| 655 | Ga0065715_10242670 | |||
| 656 | Ga0065715_10620470 | |||
| 657 | Ga0065715_10640652 | |||
| 658 | Ga0065715_10658621 | |||
| 659 | Ga0065715_10755459 | |||
| 660 | Ga0065715_11178995 | |||
| 661 | Ga0065707_10006439 | |||
| 662 | Ga0065707_10212411 | |||
| 663 | Ga0065707_10218825 | |||
| 664 | Ga0065707_10318317 | |||
| 665 | Ga0065707_10344687 | |||
| 666 | Ga0070676_10014349 | |||
| 667 | Ga0070676_10227106 | |||
| 668 | Ga0070676_10265958 | |||
| 669 | Ga0070683_100051450 | |||
| 670 | Ga0070690_101698858 | |||
| 671 | Ga0068869_100045337 | |||
| 672 | Ga0070680_100066605 | |||
| 673 | Ga0070680_101235735 | |||
| 674 | Ga0070682_101010201 | |||
| 675 | Ga0068868_100020223 | |||
| 676 | Ga0068868_100177970 | |||
| 677 | Ga0068868_100182693 | |||
| 678 | Ga0068868_101318217 | |||
| 679 | Ga0070660_100119923 | |||
| 680 | Ga0070689_100004952 | |||
| 681 | Ga0070689_100017621 | |||
| 682 | Ga0070689_100110414 | |||
| 683 | Ga0070689_100934861 | |||
| 684 | Ga0070689_101253774 | |||
| 685 | Ga0070687_100006902 | |||
| 686 | Ga0070687_100015727 | |||
| 687 | Ga0070661_100062115 | |||
| 688 | Ga0070661_100627410 | |||
| 689 | Ga0070692_10289334 | |||
| 690 | Ga0070668_100008617 | |||
| 691 | Ga0070668_100074085 | |||
| 692 | Ga0070669_100004754 | |||
| 693 | Ga0070669_100351904 | |||
| 694 | Ga0070669_101117990 | |||
| 695 | Ga0070669_101597761 | |||
| 696 | Ga0070675_100003834 | |||
| 697 | Ga0070675_100018650 | |||
| 698 | Ga0070675_100074977 | |||
| 699 | Ga0070675_100238711 | |||
| 700 | Ga0070675_101148162 | |||
| 701 | Ga0070671_100068495 | |||
| 702 | Ga0070671_100078592 | |||
| 703 | Ga0070671_100677636 | |||
| 704 | Ga0070673_100026241 | |||
| 705 | Ga0070673_100065293 | |||
| 706 | Ga0070673_100141057 | |||
| 707 | Ga0070673_100832648 | |||
| 708 | Ga0070673_100854433 | |||
| 709 | Ga0070673_101280299 | |||
| 710 | Ga0070688_100002253 | |||
| 711 | Ga0070688_100040787 | |||
| 712 | Ga0070688_100090290 | |||
| 713 | Ga0070688_100219939 | |||
| 714 | Ga0070688_100333556 | |||
| 715 | Ga0070688_101040028 | |||
| 716 | Ga0070659_100002447 | |||
| 717 | Ga0070659_100019125 | |||
| 718 | Ga0070659_100241984 | |||
| 719 | Ga0070659_100289940 | |||
| 720 | Ga0070667_100011531 | |||
| 721 | Ga0070667_100342637 | |||
| 722 | Ga0070667_100572988 | |||
| 723 | Ga0070709_10024380 | |||
| 724 | Ga0070709_10069224 | |||
| 725 | Ga0070714_100039161 | |||
| 726 | Ga0070714_100282331 | |||
| 727 | Ga0070714_100596438 | |||
| 728 | Ga0070714_101031697 | |||
| 729 | Ga0070714_101057126 | |||
| 730 | Ga0070713_100033365 | |||
| 731 | Ga0070713_100180597 | |||
| 732 | Ga0070713_100531042 | |||
| 733 | Ga0070710_10015956 | |||
| 734 | Ga0070710_10116098 | |||
| 735 | Ga0070701_10194296 | |||
| 736 | Ga0070711_100076045 | |||
| 737 | Ga0070711_100167673 | |||
| 738 | Ga0070711_101180193 | |||
| 739 | Ga0070705_100013479 | |||
| 740 | Ga0070705_100108098 | |||
| 741 | Ga0070705_100191789 | |||
| 742 | Ga0070705_100559772 | |||
| 743 | Ga0070700_100007347 | |||
| 744 | Ga0070694_100069047 | |||
| 745 | Ga0070694_100630146 | |||
| 746 | Ga0070708_100041784 | |||
| 747 | Ga0070708_100068450 | |||
| 748 | Ga0070708_100079978 | |||
| 749 | Ga0070708_100085274 | |||
| 750 | Ga0070708_100122168 | |||
| 751 | Ga0070708_100250568 | |||
| 752 | Ga0070708_100279987 | |||
| 753 | Ga0070708_100417106 | |||
| 754 | Ga0070708_100478483 | |||
| 755 | Ga0070708_100528274 | |||
| 756 | Ga0070708_100755964 | |||
| 757 | Ga0070708_100784305 | |||
| 758 | Ga0070708_101251842 | |||
| 759 | Ga0070708_101645141 | |||
| 760 | Ga0070678_100077298 | |||
| 761 | Ga0070678_100161706 | |||
| 762 | Ga0070678_100378801 | |||
| 763 | Ga0070678_101530102 | |||
| 764 | Ga0070678_101758923 | |||
| 765 | Ga0070662_100013958 | |||
| 766 | Ga0070662_100037879 | |||
| 767 | Ga0070662_100195624 | |||
| 768 | Ga0070662_100197453 | |||
| 769 | Ga0070662_101244077 | |||
| 770 | Ga0070681_11109205 | |||
| 771 | Ga0068867_100745107 | |||
| 772 | Ga0070685_10173652 | |||
| 773 | Ga0070706_100000072 | |||
| 774 | Ga0070706_100005471 | |||
| 775 | Ga0070706_100009390 | |||
| 776 | Ga0070706_100010249 | |||
| 777 | Ga0070706_100029223 | |||
| 778 | Ga0070706_100086460 | |||
| 779 | Ga0070706_100108979 | |||
| 780 | Ga0070706_100122721 | |||
| 781 | Ga0070706_100371263 | |||
| 782 | Ga0070706_100374216 | |||
| 783 | Ga0070706_100508294 | |||
| 784 | Ga0070706_100516705 | |||
| 785 | Ga0070706_100917930 | |||
| 786 | Ga0070706_101270453 | |||
| 787 | Ga0070707_100000109 | |||
| 788 | Ga0070707_100004502 | |||
| 789 | Ga0070707_100033745 | |||
| 790 | Ga0070707_100033967 | |||
| 791 | Ga0070707_100049869 | |||
| 792 | Ga0070707_100099460 | |||
| 793 | Ga0070707_100123184 | |||
| 794 | Ga0070707_100232323 | |||
| 795 | Ga0070707_100270606 | |||
| 796 | Ga0070707_100390504 | |||
| 797 | Ga0070707_100844674 | |||
| 798 | Ga0070707_100907253 | |||
| 799 | Ga0070698_100002781 | |||
| 800 | Ga0070698_100043014 | |||
| 801 | Ga0070698_100096291 | |||
| 802 | Ga0070698_100268167 | |||
| 803 | Ga0070698_100462911 | |||
| 804 | Ga0070698_100518069 | |||
| 805 | Ga0070698_100549958 | |||
| 806 | Ga0070699_100048712 | |||
| 807 | Ga0070699_100462884 | |||
| 808 | Ga0070699_100578712 | |||
| 809 | Ga0070699_100679955 | |||
| 810 | Ga0070679_100079603 | |||
| 811 | Ga0070684_100000339 | |||
| 812 | Ga0070684_100011918 | |||
| 813 | Ga0070697_100000972 | |||
| 814 | Ga0070697_100002822 | |||
| 815 | Ga0070697_100006284 | |||
| 816 | Ga0070697_100006722 | |||
| 817 | Ga0070697_100041385 | |||
| 818 | Ga0070697_100043601 | |||
| 819 | Ga0070697_100063362 | |||
| 820 | Ga0070697_100206732 | |||
| 821 | Ga0070697_100287079 | |||
| 822 | Ga0070697_100691538 | |||
| 823 | Ga0070697_101467012 | |||
| 824 | Ga0070697_101625041 | |||
| 825 | Ga0070672_100091043 | |||
| 826 | Ga0070672_100558217 | |||
| 827 | Ga0070672_101420624 | |||
| 828 | Ga0070686_100737559 | |||
| 829 | Ga0070693_100196586 | |||
| 830 | Ga0070693_100480160 | |||
| 831 | Ga0070665_100026148 | |||
| 832 | Ga0070665_100044098 | |||
| 833 | Ga0070665_100194261 | |||
| 834 | Ga0070665_101359483 | |||
| 835 | Ga0070665_102560971 | |||
| 836 | Ga0068855_100995961 | |||
| 837 | Ga0068855_102613598 | |||
| 838 | Ga0070664_100019044 | |||
| 839 | Ga0070664_100747533 | |||
| 840 | Ga0070664_101621615 | |||
| 841 | Ga0068857_101477572 | |||
| 842 | Ga0068856_100132185 | |||
| 843 | Ga0068856_100492843 | |||
| 844 | Ga0068856_101157714 | |||
| 845 | Ga0068859_100122181 | |||
| 846 | Ga0068864_101706582 | |||
| 847 | Ga0068864_101817147 | |||
| 848 | Ga0068866_10589270 | |||
| 849 | Ga0068861_100188944 | |||
| 850 | Ga0068861_100460535 | |||
| 851 | Ga0068861_101096719 | |||
| 852 | Ga0068863_100028985 | |||
| 853 | Ga0068863_100187212 | |||
| 854 | Ga0068863_100222101 | |||
| 855 | Ga0068858_100136552 | |||
| 856 | Ga0068858_102585579 | |||
| 857 | Ga0068860_100007141 | |||
| 858 | Ga0068860_100016535 | |||
| 859 | Ga0068860_100530428 | |||
| 860 | Ga0068860_100955990 | |||
| 861 | Ga0068862_100023514 | |||
| 862 | Ga0068862_100837204 | |||
| 863 | Ga0081455_10001013 | |||
| 864 | Ga0081455_10001533 | |||
| 865 | Ga0081455_10001733 | |||
| 866 | Ga0081455_10015737 | |||
| 867 | Ga0081455_10032715 | |||
| 868 | Ga0081455_10109261 | |||
| 869 | Ga0081455_10162310 | |||
| 870 | Ga0081540_1000219 | |||
| 871 | Ga0081540_1015104 | |||
| 872 | Ga0081540_1037572 | |||
| 873 | Ga0081539_10006483 | |||
| 874 | Ga0081539_10021018 | |||
| 875 | Ga0070717_10001521 | |||
| 876 | Ga0070717_10035293 | |||
| 877 | Ga0070717_10131765 | |||
| 878 | Ga0070717_10138149 | |||
| 879 | Ga0070717_10159582 | |||
| 880 | Ga0070717_10165854 | |||
| 881 | Ga0070717_10374248 | |||
| 882 | Ga0070717_10424435 | |||
| 883 | Ga0070717_10579111 | |||
| 884 | Ga0070717_10902118 | |||
| 885 | Ga0070715_10027744 | |||
| 886 | Ga0070715_10692793 | |||
| 887 | Ga0070716_100058481 | |||
| 888 | Ga0070716_100128963 | |||
| 889 | Ga0070716_100327038 | |||
| 890 | Ga0070716_100417835 | |||
| 891 | Ga0070716_100501710 | |||
| 892 | Ga0070716_101056496 | |||
| 893 | Ga0070716_101563517 | |||
| 894 | Ga0070712_100011735 | |||
| 895 | Ga0070712_100022920 | |||
| 896 | Ga0070712_100030331 | |||
| 897 | Ga0070712_100047912 | |||
| 898 | Ga0070712_100137080 | |||
| 899 | Ga0070712_100192324 | |||
| 900 | Ga0070712_101663655 | |||
| 901 | Ga0070712_101698782 | |||
| 902 | Ga0097621_100187001 | |||
| 903 | Ga0068871_101588954 | |||
| 904 | Ga0075428_100157559 | |||
| 905 | Ga0075428_100232614 | |||
| 906 | Ga0075428_100297121 | |||
| 907 | Ga0075434_100857505 | |||
| 908 | Ga0075434_100980788 | |||
| 909 | Ga0075434_101592427 | |||
| 910 | Ga0068865_100092212 | |||
| 911 | Ga0068865_100263890 | |||
| 912 | Ga0068865_100389191 | |||
| 913 | Ga0068865_101051937 | |||
| 914 | Ga0075436_100033364 | |||
| 915 | Ga0097620_100122180 | |||
| 916 | Ga0075435_100472888 | |||
| 917 | Ga0099794_10047721 | |||
| 918 | Ga0099794_10154287 | |||
| 919 | Ga0099794_10218460 | |||
| 920 | Ga0099794_10262184 | |||
| 921 | Ga0105245_10144256 | |||
| 922 | Ga0105245_10385283 | |||
| 923 | Ga0105245_13248276 | |||
| 924 | Ga0105247_10142308 | |||
| 925 | Ga0105247_10879572 | |||
| 926 | Ga0114129_10008863 | |||
| 927 | Ga0114129_10316491 | |||
| 928 | Ga0114129_10366260 | |||
| 929 | Ga0114129_11308582 | |||
| 930 | Ga0114129_11957369 | |||
| 931 | Ga0105243_11751143 | |||
| 932 | Ga0105243_12291887 | |||
| 933 | Ga0105241_11230855 | |||
| 934 | Ga0105242_10072817 | |||
| 935 | Ga0105242_10844249 | |||
| 936 | Ga0105248_12310537 | |||
| 937 | Ga0105249_10006132 | |||
| 938 | Ga0099796_10354835 | |||
| 939 | Ga0105239_10010133 | |||
| 940 | Ga0105239_10321735 | |||
| 941 | Ga0105239_12086960 | |||
| 942 | Ga0157318_1017338 | |||
| 943 | Ga0157342_1006117 | |||
| 944 | Ga0157371_10229925 | |||
| 945 | Ga0157370_10139506 | |||
| 946 | Ga0157369_12218099 | |||
| 947 | Ga0157374_10017287 | |||
| 948 | Ga0157374_10054286 | |||
| 949 | Ga0157374_10091230 | |||
| 950 | Ga0157374_10131036 | |||
| 951 | Ga0157374_10535697 | |||
| 952 | Ga0157378_10005373 | |||
| 953 | Ga0157378_10139027 | |||
| 954 | Ga0157378_10144731 | |||
| 955 | Ga0157378_10685852 | |||
| 956 | Ga0157378_10928998 | |||
| 957 | Ga0157378_12317584 | |||
| 958 | Ga0163162_10004774 | |||
| 959 | Ga0163162_10029198 | |||
| 960 | Ga0163162_10738829 | |||
| 961 | Ga0163162_10804296 | |||
| 962 | Ga0157375_10218626 | |||
| 963 | Ga0157375_10394978 | |||
| 964 | Ga0157375_10408480 | |||
| 965 | Ga0163163_10277836 | |||
| 966 | Ga0182008_10245154 | |||
| 967 | Ga0157377_10151419 | |||
| 968 | Ga0157377_10607781 | |||
| 969 | Ga0157376_10276716 | |||
| 970 | Ga0157376_10279623 | |||
| 971 | Ga0182007_10033168 | |||
| 972 | Ga0182005_1038094 | |||
| 973 | Ga0163161_10088045 | |||
| 974 | Ga0163161_10397770 | |||
| 975 | Ga0163161_11221105 | |||
| 976 | Ga0163161_11469777 | |||
| 977 | Ga0207666_1003711 | |||
| 978 | Ga0207673_1005354 | |||
| 979 | Ga0207673_1029274 | |||
| 980 | Ga0207697_10000198 | |||
| 981 | Ga0207697_10000615 | |||
| 982 | Ga0207697_10006960 | |||
| 983 | Ga0207697_10026007 | |||
| 984 | Ga0207697_10035154 | |||
| 985 | Ga0207697_10102945 | |||
| 986 | Ga0207653_10019312 | |||
| 987 | Ga0207692_10014288 | |||
| 988 | Ga0207692_10288038 | |||
| 989 | Ga0207692_10436226 | |||
| 990 | Ga0207692_10635252 | |||
| 991 | Ga0207642_10071464 | |||
| 992 | Ga0207710_10115872 | |||
| 993 | Ga0207688_10033445 | |||
| 994 | Ga0207688_10055418 | |||
| 995 | Ga0207688_10171558 | |||
| 996 | Ga0207688_10848699 | |||
| 997 | Ga0207647_10003507 | |||
| 998 | Ga0207647_10201463 | |||
| 999 | Ga0207699_10020111 | |||
| 1000 | Ga0207699_10020756 | |||
| 1001 | Ga0207699_10037964 | |||
| 1002 | Ga0207699_10808799 | |||
| 1003 | Ga0207645_10000634 | |||
| 1004 | Ga0207645_10296910 | |||
| 1005 | Ga0207684_10000043 | |||
| 1006 | Ga0207684_10002590 | |||
| 1007 | Ga0207684_10013932 | |||
| 1008 | Ga0207684_10014275 | |||
| 1009 | Ga0207684_10090439 | |||
| 1010 | Ga0207684_10102581 | |||
| 1011 | Ga0207684_10104807 | |||
| 1012 | Ga0207684_10114257 | |||
| 1013 | Ga0207684_10223835 | |||
| 1014 | Ga0207684_10338568 | |||
| 1015 | Ga0207684_11212891 | |||
| 1016 | Ga0207707_10019153 | |||
| 1017 | Ga0207693_10003135 | |||
| 1018 | Ga0207693_10036469 | |||
| 1019 | Ga0207693_10067125 | |||
| 1020 | Ga0207693_10068240 | |||
| 1021 | Ga0207693_10130519 | |||
| 1022 | Ga0207693_10178468 | |||
| 1023 | Ga0207693_10547745 | |||
| 1024 | Ga0207693_10798027 | |||
| 1025 | Ga0207663_10004136 | |||
| 1026 | Ga0207663_10094038 | |||
| 1027 | Ga0207663_10180225 | |||
| 1028 | Ga0207663_11200513 | |||
| 1029 | Ga0207663_11234044 | |||
| 1030 | Ga0207662_10000729 | |||
| 1031 | Ga0207662_10078562 | |||
| 1032 | Ga0207662_10109123 | |||
| 1033 | Ga0207657_10227491 | |||
| 1034 | Ga0207657_10660204 | |||
| 1035 | Ga0207657_10945221 | |||
| 1036 | Ga0207649_10135697 | |||
| 1037 | Ga0207649_10297207 | |||
| 1038 | Ga0207649_10598703 | |||
| 1039 | Ga0207652_10070834 | |||
| 1040 | Ga0207646_10000445 | |||
| 1041 | Ga0207646_10022902 | |||
| 1042 | Ga0207646_10023218 | |||
| 1043 | Ga0207646_10023608 | |||
| 1044 | Ga0207646_10047452 | |||
| 1045 | Ga0207646_10102624 | |||
| 1046 | Ga0207646_10115900 | |||
| 1047 | Ga0207646_10153742 | |||
| 1048 | Ga0207646_10161021 | |||
| 1049 | Ga0207646_10199819 | |||
| 1050 | Ga0207646_10386819 | |||
| 1051 | Ga0207646_10454050 | |||
| 1052 | Ga0207646_10684060 | |||
| 1053 | Ga0207646_10695728 | |||
| 1054 | Ga0207646_10780031 | |||
| 1055 | Ga0207681_10029154 | |||
| 1056 | Ga0207681_10582195 | |||
| 1057 | Ga0207681_10668328 | |||
| 1058 | Ga0207650_10462895 | |||
| 1059 | Ga0207650_11184410 | |||
| 1060 | Ga0207659_10033165 | |||
| 1061 | Ga0207659_10470938 | |||
| 1062 | Ga0207659_10807366 | |||
| 1063 | Ga0207659_11405593 | |||
| 1064 | Ga0207687_11070051 | |||
| 1065 | Ga0207700_10016817 | |||
| 1066 | Ga0207700_10068397 | |||
| 1067 | Ga0207700_10700608 | |||
| 1068 | Ga0207700_10874958 | |||
| 1069 | Ga0207664_10022640 | |||
| 1070 | Ga0207664_10762245 | |||
| 1071 | Ga0207664_10778727 | |||
| 1072 | Ga0207664_11390910 | |||
| 1073 | Ga0207644_10264100 | |||
| 1074 | Ga0207644_10397607 | |||
| 1075 | Ga0207644_10910045 | |||
| 1076 | Ga0207690_10015254 | |||
| 1077 | Ga0207690_10057717 | |||
| 1078 | Ga0207690_10780385 | |||
| 1079 | Ga0207706_10000702 | |||
| 1080 | Ga0207706_10004250 | |||
| 1081 | Ga0207706_10034666 | |||
| 1082 | Ga0207706_10067030 | |||
| 1083 | Ga0207706_10122914 | |||
| 1084 | Ga0207706_11272115 | |||
| 1085 | Ga0207686_10310290 | |||
| 1086 | Ga0207686_10725371 | |||
| 1087 | Ga0207709_10477311 | |||
| 1088 | Ga0207670_10001041 | |||
| 1089 | Ga0207670_10008309 | |||
| 1090 | Ga0207670_10013214 | |||
| 1091 | Ga0207669_10097593 | |||
| 1092 | Ga0207669_10499061 | |||
| 1093 | Ga0207669_10847013 | |||
| 1094 | Ga0207704_10136861 | |||
| 1095 | Ga0207704_10181536 | |||
| 1096 | Ga0207665_10059517 | |||
| 1097 | Ga0207665_10071138 | |||
| 1098 | Ga0207665_10072053 | |||
| 1099 | Ga0207665_10095189 | |||
| 1100 | Ga0207665_10112680 | |||
| 1101 | Ga0207665_10260433 | |||
| 1102 | Ga0207665_10262793 | |||
| 1103 | Ga0207665_10322684 | |||
| 1104 | Ga0207665_10348787 | |||
| 1105 | Ga0207665_10631143 | |||
| 1106 | Ga0207665_10953193 | |||
| 1107 | Ga0207711_10142669 | |||
| 1108 | Ga0207711_11550177 | |||
| 1109 | Ga0207689_10017873 | |||
| 1110 | Ga0207689_10812936 | |||
| 1111 | Ga0207689_11107945 | |||
| 1112 | Ga0207661_10040715 | |||
| 1113 | Ga0207661_10176182 | |||
| 1114 | Ga0207661_10266315 | |||
| 1115 | Ga0207661_10364083 | |||
| 1116 | Ga0207679_10320969 | |||
| 1117 | Ga0207679_11610069 | |||
| 1118 | Ga0207651_10184030 | |||
| 1119 | Ga0207651_10219032 | |||
| 1120 | Ga0207651_10948874 | |||
| 1121 | Ga0207651_11750343 | |||
| 1122 | Ga0207712_10008042 | |||
| 1123 | Ga0207712_10704277 | |||
| 1124 | Ga0207668_10058506 | |||
| 1125 | Ga0207668_10182365 | |||
| 1126 | Ga0207668_11353412 | |||
| 1127 | Ga0207658_10067236 | |||
| 1128 | Ga0207658_10142278 | |||
| 1129 | Ga0207658_10287368 | |||
| 1130 | Ga0207658_10967455 | |||
| 1131 | Ga0207677_10010730 | |||
| 1132 | Ga0207677_10067575 | |||
| 1133 | Ga0207677_11293574 | |||
| 1134 | Ga0207703_10693333 | |||
| 1135 | Ga0207703_11662747 | |||
| 1136 | Ga0207639_11791631 | |||
| 1137 | Ga0207678_10005303 | |||
| 1138 | Ga0207708_10027450 | |||
| 1139 | Ga0207708_11039842 | |||
| 1140 | Ga0207702_10410040 | |||
| 1141 | Ga0207702_10411609 | |||
| 1142 | Ga0207641_10018693 | |||
| 1143 | Ga0207641_10121877 | |||
| 1144 | Ga0207641_10296880 | |||
| 1145 | Ga0207648_11275469 | |||
| 1146 | Ga0207676_10247421 | |||
| 1147 | Ga0207676_11720564 | |||
| 1148 | Ga0207675_100328522 | |||
| 1149 | Ga0207675_100701060 | |||
| 1150 | Ga0207675_101316075 | |||
| 1151 | Ga0207683_10011404 | |||
| 1152 | Ga0207698_10421004 | |||
| 1153 | Ga0209179_1031237 | |||
| 1154 | Ga0210002_1025868 | |||
| 1155 | Ga0209588_1150302 | |||
| 1156 | Ga0209971_1022651 | |||
| 1157 | Ga0209974_10100448 | |||
| 1158 | Ga0268266_10032203 | |||
| 1159 | Ga0268266_10056268 | |||
| 1160 | Ga0268266_10237278 | |||
| 1161 | Ga0268266_10963811 | |||
| 1162 | Ga0268265_10007154 | |||
| 1163 | Ga0268264_10014335 | |||
| 1164 | Ga0268264_10520072 | |||
| 1165 | Ga0268264_12279227 | |||
| 1166 | Ga0307513_10111511 | |||
| 1167 | Ga0373938_0145101 | |||
| 1168 | Ga0373929_0131432 | |||
| 1169 | Ga0373923_0084701 | |||
| 1170 | Ga0373936_0304864 | |||
| 1171 | Ga0373939_0170926 | |||
| 1172 | Ga0373941_0208557 | |||
| 1173 | Ga0373953_0132046 | |||
| 1174 | Ga0373956_0026317 | |||
| 1175 | Ga0373943_0066429 | |||
| 1176 | Ga0373943_0211949 | |||
| 1177 | Ga0373943_0251899 | |||
| 1178 | Ga0373955_0798973 | |||
| 1179 | Ga0373961_0129639 | |||
| 1180 | Ga0373931_0027665 | |||
| 1181 | Ga0373931_0360508 | |||
| 1182 | Ga0373935_0016674 | |||
| 1183 | Ga0373947_0032662 | |||
| 1184 | Ga0373947_0229333 | |||
| 1185 | Ga0395899_0083103 | |||
| 1186 | Ga0395900_0033096 | |||
| 1187 | Ga0395900_0132881 | |||
| 1188 | Ga0395900_0251244 | |||
| 1189 | Ga0395900_0475832 | |||
| 1190 | Ga0395900_0732363 | |||
| 1191 | Ga0395905_0035375 | |||
| 1192 | Ga0395905_0439588 | |||
| 1193 | Ga0395901_0029202 | |||
| 1194 | Ga0395901_0128259 | |||
| 1195 | Ga0395901_0181757 | |||
| 1196 | Ga0395901_1297587 | |||
| 1197 | Ga0395901_1739691 | |||
| 1198 | Ga0436363_0527460 | |||
| 1199 | Ga0451789_0379071 | |||
| 1200 | Ga0451800_1503148 | |||
| 1201 | Ga0451804_1160921 | |||
| 1202 | Ga0451807_1549576 | |||
| 1203 | Ga0451807_1920741 | |||
| 1204 | Ga0451853_2864927 | |||
| 1205 | Ga0439448_0090645 | |||
| 1206 | Ga0439451_030035 | |||
| 1207 | Ga0453683_0247106 | |||
| 1208 | Ga0451576_0036267 | |||
| 1209 | Ga0495592_0014862 | |||
| 1210 | Ga0495629_0089648 | |||
| 1211 | Ga0495580_0222887 | |||
| 1212 | Ga0495584_0097678 | |||
| 1213 | Ga0495628_0835665 | |||
| 1214 | Ga0495587_0016884 | |||
| 1215 | Ga0495667_0256227 | |||
| 1216 | Ga0495588_0742587 | |||
| 1217 | Ga0495599_0035607 | |||
| 1218 | Ga0495623_0031772 | |||
| 1219 | Ga0495669_0132238 | |||
| 1220 | Ga0495604_0046620 | |||
| 1221 | Ga0495675_0008938 | |||
| 1222 | Ga0495602_0076232 | |||
| 1223 | Ga0496100_0663381 | |||
| 1224 | Ga0496101_1093157 | |||
| 1225 | Ga0496102_0582192 | |||
| 1226 | Ga0496103_1062683 | |||
| 1227 | Ga0496104_0336703 | |||
| 1228 | Ga0496105_0134919 | |||
| 1229 | Ga0496105_0566684 | |||
| 1230 | Ga0496106_0975692 | |||
| 1231 | Ga0496107_0228405 | |||
| 1232 | Ga0496107_0349241 | |||
| 1233 | Ga0496108_0151202 | |||
| 1234 | Ga0496108_0513020 | |||
| 1235 | Ga0496109_0010796 | |||
| 1236 | Ga0496109_0065137 | |||
| 1237 | Ga0496110_0332551 | |||
| 1238 | Ga0496110_1706339 | |||
| 1239 | Ga0496112_0008465 | |||
| 1240 | Ga0496112_1271058 | |||
| 1241 | Ga0496113_0028847 | |||
| 1242 | Ga0496113_0592833 | |||
| 1243 | Ga0496114_0039983 | |||
| 1244 | Ga0496115_0022124 | |||
| 1245 | Ga0496115_0027647 | |||
| 1246 | nmdc:mga05p37_343017_c1 | |||
| 1247 | nmdc:mga05p37_344208_c1 | |||
| 1248 | nmdc:mga05p37_5948_c1 | |||
| 1249 | nmdc:mga08y16_575985_c1 | |||
| 1250 | nmdc:mga0n895_344504_c1 | |||
| 1251 | nmdc:mga0rr50_920669_c1 | |||
| 1252 | nmdc:mga08x19_41768_c1 | |||
| 1253 | Ga0495655_0058346 | |||
| 1254 | Ga0500618_083669 |