F470346

General Info

Members Datasets Scaffolds Average Seq Length
625 167 1250 307

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100295204|Ga0070704_1002952041
Length 323
Sequence VSGGNDSGALGPAGGLPGRLQAPSRRYGEKAIQGLLAFCGILSVLTTTAIVVSLVGPTVEFFGTVSVWEFITGTDWTPQFEPPSFGVLAIVAGTLNVTLWAMLFAVPIGLGAAIYMSEYASPRVRKTVKPVLEILAGIPTVAIGFFAATFLLPELIQPLWPGEFLGGAVGKPFLALAASLGIGLMIVPIIASISDDAMSAVPRGLREGAYAMGATKMEVSTKVVFPAALSGIVASIVLAISRAVGETMIVVLAAGSTPNFTLNPVEAIQAMTSYIAVTATGDIPANSISYKTVFAVGSLLFLMTLVMNVVSIRLVRKYREVYE

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
82 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
83 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
86 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
87 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
90 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
91 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
92 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
93 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
94 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
95 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
96 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
99 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
100 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
101 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
158 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
159 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
160 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
161 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
162 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
163 2687453737 Frankia sp. BMG5.36 Isolate Nodule
164 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
165 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
166 8002775197 Frankia nepalensis CN7 Isolate Nodule
167 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0.64
Rhizoplane 1.12
Rhizosphere 95.36
Stem 0
Stem Tuber 0
Unclassified 1.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100295204 3300005549 Bacteria 1348
2 JGI24746J21847_1000145 3300001977 Bacteria 8944
3 JGI25407J50210_10001150 3300003373 Bacteria 5851
4 JGI25407J50210_10002672 3300003373 Bacteria 4231
5 JGI25407J50210_10003426 3300003373 Bacteria 3792
6 JGI25407J50210_10017961 3300003373 Archaea 1838
7 Ga0070683_100037103 3300005329 Bacteria 4461
8 Ga0070691_10000012 3300005341 Bacteria 56648
9 Ga0070668_100353044 3300005347 Bacteria 1245
10 Ga0070669_100074338 3300005353 Bacteria 2519
11 Ga0070675_100089595 3300005354 Bacteria 2576
12 Ga0070674_100000008 3300005356 Bacteria 143844
13 Ga0070674_100000029 3300005356 Bacteria 69489
14 Ga0070705_100001466 3300005440 Bacteria 12482
15 Ga0070700_100005005 3300005441 Bacteria 6985
16 Ga0070700_100073745 3300005441 Bacteria 2185
17 Ga0070694_100047536 3300005444 Bacteria 2884
18 Ga0070678_100468967 3300005456 Bacteria 1106
19 Ga0070699_100309705 3300005518 Bacteria 1418
20 Ga0070684_100237938 3300005535 Archaea 1663
21 Ga0070672_100000027 3300005543 Bacteria 67016
22 Ga0070696_100125450 3300005546 Bacteria 1862
23 Ga0070665_100065567 3300005548 Bacteria 3642
24 Ga0070665_100451433 3300005548 Bacteria 1295
25 Ga0070704_100023905 3300005549 Bacteria 4001
26 Ga0070704_100061902 3300005549 Bacteria 2681
27 Ga0070704_100080989 3300005549 Bacteria 2390
28 Ga0070704_100262977 3300005549 Bacteria 1422
29 Ga0070702_100083774 3300005615 Bacteria 1916
30 Ga0068852_100038998 3300005616 Bacteria 3996
31 Ga0068864_100000045 3300005618 Bacteria 154739
32 Ga0068866_10000001 3300005718 Bacteria 519680
33 Ga0068866_10000031 3300005718 Bacteria 56943
34 Ga0068866_10131050 3300005718 Bacteria 1426
35 Ga0081455_10008235 3300005937 Bacteria 10866
36 Ga0081455_10013627 3300005937 Bacteria 8010
37 Ga0081455_10039859 3300005937 Bacteria 4147
38 Ga0081455_10112710 3300005937 Unclassified 2158
39 Ga0081538_10000066 3300005981 Bacteria 98455
40 Ga0081538_10000118 3300005981 Bacteria 79260
41 Ga0081538_10000144 3300005981 Bacteria 73787
42 Ga0081538_10000195 3300005981 Bacteria 66942
43 Ga0081538_10000410 3300005981 Bacteria 48485
44 Ga0081538_10000465 3300005981 Bacteria 45439
45 Ga0081538_10000590 3300005981 Bacteria 40274
46 Ga0081538_10001536 3300005981 Bacteria 23678
47 Ga0081538_10001773 3300005981 Bacteria 21836
48 Ga0081538_10003848 3300005981 Bacteria 14018
49 Ga0081538_10004852 3300005981 Bacteria 12245
50 Ga0081538_10005772 3300005981 Bacteria 11044
51 Ga0081538_10008182 3300005981 Bacteria 8925
52 Ga0081538_10018231 3300005981 Bacteria 5285
53 Ga0081538_10018349 3300005981 Bacteria 5258
54 Ga0081538_10026541 3300005981 Bacteria 4047
55 Ga0081538_10035714 3300005981 Bacteria 3259
56 Ga0081538_10039390 3300005981 Bacteria 3032
57 Ga0081538_10079078 3300005981 Bacteria 1761
58 Ga0081539_10000030 3300005985 Bacteria 317236
59 Ga0075365_10000604 3300006038 Bacteria 14112
60 Ga0075365_10018240 3300006038 Bacteria 4311
61 Ga0075365_10108828 3300006038 Bacteria 1903
62 Ga0075365_10137346 3300006038 Bacteria 1695
63 Ga0075363_100001743 3300006048 Bacteria 8473
64 Ga0075363_100003534 3300006048 Bacteria 6671
65 Ga0075364_10010277 3300006051 Bacteria 5648
66 Ga0075364_10025509 3300006051 Bacteria 3763
67 Ga0075364_10131901 3300006051 Bacteria 1677
68 Ga0075432_10029584 3300006058 Bacteria 1892
69 Ga0075367_10087288 3300006178 Bacteria 1894
70 Ga0075370_10070857 3300006353 Bacteria 1994
71 Ga0075428_100000501 3300006844 Bacteria 39750
72 Ga0075428_100021417 3300006844 Bacteria 7155
73 Ga0075428_100021734 3300006844 Bacteria 7103
74 Ga0075428_100099809 3300006844 Bacteria 3165
75 Ga0075428_100121137 3300006844 Bacteria 2849
76 Ga0075428_100132543 3300006844 Bacteria 2710
77 Ga0075428_100150146 3300006844 Bacteria 2531
78 Ga0075428_100531636 3300006844 Bacteria 1257
79 Ga0075428_100598717 3300006844 Bacteria 1177
80 Ga0075430_100001364 3300006846 Bacteria 19795
81 Ga0075430_100005439 3300006846 Bacteria 10761
82 Ga0075430_100007364 3300006846 Bacteria 9297
83 Ga0075430_100010436 3300006846 Bacteria 7863
84 Ga0075430_100102920 3300006846 Bacteria 2384
85 Ga0075430_100113811 3300006846 Bacteria 2255
86 Ga0075430_100129055 3300006846 Bacteria 2107
87 Ga0075430_100271972 3300006846 Bacteria 1402
88 Ga0075431_100003573 3300006847 Bacteria 15066
89 Ga0075431_100004107 3300006847 Bacteria 14218
90 Ga0075431_100013507 3300006847 Bacteria 8249
91 Ga0075431_100070844 3300006847 Bacteria 3597
92 Ga0075431_100078906 3300006847 Bacteria 3399
93 Ga0075431_100147686 3300006847 Bacteria 2422
94 Ga0075431_100329772 3300006847 Bacteria 1537
95 Ga0075431_100463624 3300006847 Bacteria 1261
96 Ga0075433_10105512 3300006852 Bacteria 2497
97 Ga0075429_100002951 3300006880 Bacteria 14430
98 Ga0075429_100005755 3300006880 Bacteria 10701
99 Ga0075429_100010743 3300006880 Bacteria 7916
100 Ga0075429_100052382 3300006880 Bacteria 3551
101 Ga0075429_100081065 3300006880 Bacteria 2829
102 Ga0075429_100107895 3300006880 Bacteria 2433
103 Ga0075429_100125681 3300006880 Bacteria 2243
104 Ga0075429_100211906 3300006880 Bacteria 1697
105 Ga0111539_10008931 3300009094 Bacteria 12687
106 Ga0111539_10072585 3300009094 Bacteria 4059
107 Ga0111539_10083516 3300009094 Bacteria 3756
108 Ga0111539_10143957 3300009094 Bacteria 2790
109 Ga0111539_10152157 3300009094 Bacteria 2708
110 Ga0111539_10280975 3300009094 Bacteria 1937
111 Ga0111539_10552585 3300009094 Bacteria 1341
112 Ga0111539_10587120 3300009094 Unclassified 1297
113 Ga0105245_10177416 3300009098 Bacteria 2033
114 Ga0114129_10000194 3300009147 Bacteria 68056
115 Ga0114129_10024616 3300009147 Bacteria 8531
116 Ga0114129_10055754 3300009147 Bacteria 5539
117 Ga0114129_10062629 3300009147 Bacteria 5195
118 Ga0114129_10069788 3300009147 Bacteria 4899
119 Ga0114129_10096363 3300009147 Bacteria 4096
120 Ga0114129_10135363 3300009147 Bacteria 3381
121 Ga0114129_10802096 3300009147 Bacteria 1201
122 Ga0114129_10979013 3300009147 Bacteria 1066
123 Ga0105243_10004145 3300009148 Bacteria 11512
124 Ga0105243_10138116 3300009148 Bacteria 2076
125 Ga0105243_10159574 3300009148 Bacteria 1943
126 Ga0105243_10162950 3300009148 Bacteria 1924
127 Ga0105238_10445001 3300009551 Bacteria 1292
128 Ga0105249_10682683 3300009553 Bacteria 1086
129 Ga0105239_10134102 3300010375 Bacteria 2756
130 Ga0163163_10060170 3300014325 Bacteria 3760
131 Ga0157380_10003475 3300014326 Bacteria 10819
132 Ga0157380_10218142 3300014326 Bacteria 1705
133 Ga0157377_10082351 3300014745 Bacteria 1884
134 Ga0207642_10000031 3300025899 Bacteria 45198
135 Ga0207642_10000034 3300025899 Bacteria 43362
136 Ga0207680_10006858 3300025903 Bacteria 5526
137 Ga0207684_10585582 3300025910 Unclassified 953
138 Ga0207660_10142158 3300025917 Bacteria 1835
139 Ga0207681_10111326 3300025923 Bacteria 1992
140 Ga0207659_10044493 3300025926 Bacteria 3124
141 Ga0207687_10160912 3300025927 Bacteria 1723
142 Ga0207706_10062514 3300025933 Bacteria 3279
143 Ga0207709_10001837 3300025935 Bacteria 14145
144 Ga0207709_10024913 3300025935 Bacteria 3421
145 Ga0207709_10086783 3300025935 Bacteria 2032
146 Ga0207709_10102172 3300025935 Bacteria 1897
147 Ga0207709_10127229 3300025935 Bacteria 1730
148 Ga0207669_10000004 3300025937 Bacteria 196828
149 Ga0207669_10000012 3300025937 Bacteria 138242
150 Ga0207704_10091449 3300025938 Bacteria 2000
151 Ga0207691_10000136 3300025940 Bacteria 67179
152 Ga0207661_10011700 3300025944 Bacteria 6369
153 Ga0207708_10087357 3300026075 Bacteria 2401
154 Ga0207676_10000016 3300026095 Bacteria 311561
155 Ga0207683_10195398 3300026121 Bacteria 1838
156 Ga0207428_10003693 3300027907 Bacteria 14712
157 Ga0207428_10008841 3300027907 Bacteria 9079
158 Ga0207428_10024093 3300027907 Bacteria 5110
159 Ga0268265_10570900 3300028380 Bacteria 1077
160 Ga0307408_100028093 3300031548 Bacteria 3884
161 Ga0307408_100272438 3300031548 Bacteria 1406
162 Ga0307405_10008347 3300031731 Bacteria 5242
163 Ga0307405_10076779 3300031731 Bacteria 2168
164 Ga0307405_10196225 3300031731 Bacteria 1462
165 Ga0307410_10039935 3300031852 Bacteria 3085
166 Ga0307410_10054867 3300031852 Bacteria 2703
167 Ga0307410_10160084 3300031852 Bacteria 1686
168 Ga0307410_10195077 3300031852 Bacteria 1542
169 Ga0307406_10045455 3300031901 Bacteria 2757
170 Ga0307407_10021434 3300031903 Bacteria 3332
171 Ga0307407_10187149 3300031903 Bacteria 1377
172 Ga0307412_10099039 3300031911 Bacteria 2057
173 Ga0307412_10119482 3300031911 Bacteria 1895
174 Ga0307409_100001863 3300031995 Bacteria 10730
175 Ga0307409_100006225 3300031995 Bacteria 6987
176 Ga0307409_100025947 3300031995 Bacteria 4122
177 Ga0307409_100107903 3300031995 Bacteria 2327
178 Ga0307409_100109040 3300031995 Bacteria 2317
179 Ga0307409_100222244 3300031995 Bacteria 1706
180 Ga0307409_100443047 3300031995 Unclassified 1252
181 Ga0307416_100003524 3300032002 Bacteria 9219
182 Ga0307416_100008175 3300032002 Bacteria 6725
183 Ga0307416_100027144 3300032002 Bacteria 4234
184 Ga0307416_100032563 3300032002 Bacteria 3941
185 Ga0307416_100067821 3300032002 Bacteria 2944
186 Ga0307416_100659099 3300032002 Bacteria 1132
187 Ga0307416_100724168 3300032002 Bacteria 1086
188 Ga0307414_10136695 3300032004 Bacteria 1912
189 Ga0307411_10180822 3300032005 Bacteria 1600
190 Ga0307411_10207240 3300032005 Bacteria 1511
191 Ga0307415_100001050 3300032126 Bacteria 12817
192 Ga0307415_100001186 3300032126 Bacteria 12190
193 Ga0307415_100004307 3300032126 Bacteria 7365
194 Ga0307415_100004867 3300032126 Bacteria 7048
195 Ga0307415_100007164 3300032126 Bacteria 6078
196 Ga0307415_100008872 3300032126 Bacteria 5601
197 Ga0307415_100030067 3300032126 Bacteria 3480
198 Ga0307415_100053582 3300032126 Bacteria 2749
199 Ga0307415_100146214 3300032126 Bacteria 1813
200 Ga0307415_100268874 3300032126 Bacteria 1395
201 Ga0395899_0004128 3300037312 Bacteria 11428
202 Ga0395899_0019673 3300037312 Bacteria 5126
203 Ga0395899_0045150 3300037312 Bacteria 3283
204 Ga0395899_0057195 3300037312 Bacteria 2880
205 Ga0395900_0002160 3300037418 Bacteria 21982
206 Ga0395900_0002341 3300037418 Bacteria 20980
207 Ga0395900_0005876 3300037418 Bacteria 12812
208 Ga0395900_0015224 3300037418 Bacteria 7843
209 Ga0395900_0023744 3300037418 Bacteria 6273
210 Ga0395900_0054393 3300037418 Bacteria 4122
211 Ga0395900_0060613 3300037418 Bacteria 3893
212 Ga0395900_0105998 3300037418 Bacteria 2887
213 Ga0395900_0146447 3300037418 Bacteria 2415
214 Ga0395900_0366643 3300037418 Bacteria 1411
215 Ga0395900_0493950 3300037418 Bacteria 1175
216 Ga0395898_0001770 3300037466 Bacteria 28211
217 Ga0395898_0004467 3300037466 Bacteria 15291
218 Ga0395898_0011798 3300037466 Bacteria 9057
219 Ga0395898_0013082 3300037466 Bacteria 8555
220 Ga0395898_0021050 3300037466 Bacteria 6617
221 Ga0395898_0021088 3300037466 Bacteria 6610
222 Ga0395898_0039892 3300037466 Bacteria 4646
223 Ga0395898_0068658 3300037466 Bacteria 3430
224 Ga0395898_0119856 3300037466 Bacteria 2521
225 Ga0395898_0163714 3300037466 Bacteria 2128
226 Ga0395898_0187238 3300037466 Archaea 1978
227 Ga0395905_0001447 3300037471 Bacteria 28531
228 Ga0395905_0003203 3300037471 Bacteria 17629
229 Ga0395905_0004137 3300037471 Bacteria 15181
230 Ga0395905_0009107 3300037471 Bacteria 9727
231 Ga0395905_0014284 3300037471 Bacteria 7586
232 Ga0395905_0023982 3300037471 Bacteria 5761
233 Ga0395905_0118098 3300037471 Bacteria 2493
234 Ga0395905_0148689 3300037471 Bacteria 2204
235 Ga0395905_0246775 3300037471 Bacteria 1668
236 Ga0395905_0259754 3300037471 Bacteria 1622
237 Ga0395905_0446233 3300037471 Archaea 1191
238 Ga0395901_0000659 3300038443 Bacteria 39725
239 Ga0395901_0001156 3300038443 Bacteria 28021
240 Ga0395901_0001461 3300038443 Bacteria 24595
241 Ga0395901_0002686 3300038443 Bacteria 17941
242 Ga0395901_0005938 3300038443 Bacteria 12366
243 Ga0395901_0006169 3300038443 Bacteria 12149
244 Ga0395901_0012842 3300038443 Bacteria 8496
245 Ga0395901_0021396 3300038443 Bacteria 6626
246 Ga0395901_0065618 3300038443 Bacteria 3780
247 Ga0395901_0088124 3300038443 Bacteria 3246
248 Ga0395901_0092322 3300038443 Bacteria 3169
249 Ga0395901_0250869 3300038443 Bacteria 1844
250 Ga0395901_0406018 3300038443 Bacteria 1399
251 Ga0439439_0000828 3300041406 Bacteria 5644
252 Ga0439461_0009872 3300041410 Bacteria 1741
253 Ga0451807_1101761 3300041486 Bacteria 1667
254 Ga0451853_1308288 3300041512 Bacteria 2261
255 Ga0439433_0003655 3300041999 Bacteria 3305
256 Ga0439442_018511 3300042002 Archaea 1439
257 Ga0439448_0008136 3300042005 Bacteria 3062
258 Ga0439449_0017819 3300042007 Bacteria 2666
259 Ga0439450_000058 3300042008 Bacteria 10193
260 Ga0439454_006745 3300042011 Bacteria 1422
261 Ga0439462_0000074 3300042015 Bacteria 14936
262 Ga0439463_001968 3300042016 Bacteria 5342
263 Ga0450906_008404 3300042145 Bacteria 1999
264 Ga0450907_010490 3300042146 Bacteria 1538
265 Ga0450907_023336 3300042146 Unclassified 1043
266 Ga0439446_0007658 3300042156 Bacteria 2845
267 Ga0439458_0042021 3300042157 Bacteria 1112
268 Ga0439434_0030864 3300042435 Bacteria 1628
269 Ga0439464_0002822 3300042439 Bacteria 4315
270 Ga0439460_0001200 3300042461 Bacteria 6106
271 Ga0450916_000856 3300042530 Bacteria 2870
272 Ga0439440_0000325 3300042993 Bacteria 7807
273 Ga0495641_0033692 3300046461 Bacteria 2428
274 Ga0495620_0000951 3300046515 Bacteria 17818
275 Ga0495644_0000380 3300046523 Bacteria 20202
276 Ga0495656_0000391 3300046615 Bacteria 14570
277 Ga0495658_0004468 3300046683 Bacteria 6884
278 Ga0495670_0011634 3300046691 Bacteria 4330
279 Ga0495589_0064924 3300046794 Archaea 1790
280 Ga0496106_0000081 3300048909 Bacteria 76468
281 Ga0496108_0003808 3300048911 Bacteria 12080
282 Ga0496109_0142767 3300048912 Bacteria 2239
283 Ga0496113_0011015 3300048916 Bacteria 6010
284 Ga0496113_0053694 3300048916 Bacteria 3013
285 Ga0496113_0072142 3300048916 Bacteria 2627
286 Ga0496121_0261703 3300048924 Bacteria 1194
287 Ga0501031_0002322 3300049568 Bacteria 12042
288 Ga0501031_0002959 3300049568 Bacteria 10867
289 Ga0501031_0015597 3300049568 Bacteria 4932
290 Ga0501031_0015922 3300049568 Bacteria 4882
291 Ga0501031_0023235 3300049568 Bacteria 4042
292 Ga0501031_0048863 3300049568 Bacteria 2756
293 Ga0501031_0072153 3300049568 Bacteria 2248
294 Ga0501032_0026681 3300049569 Bacteria 3971
295 Ga0501032_0027978 3300049569 Bacteria 3874
296 Ga0501032_0087127 3300049569 Bacteria 2074
297 Ga0501032_0158022 3300049569 Bacteria 1489
298 Ga0501033_0003256 3300049570 Bacteria 13441
299 Ga0501033_0003468 3300049570 Bacteria 12936
300 Ga0501033_0010597 3300049570 Bacteria 7069
301 Ga0501033_0038590 3300049570 Bacteria 3569
302 Ga0501033_0065906 3300049570 Bacteria 2663
303 Ga0501034_0122582 3300049571 Bacteria 2585
304 Ga0501036_0000308 3300049572 Bacteria 34013
305 Ga0501036_0023135 3300049572 Bacteria 5231
306 Ga0501036_0032074 3300049572 Bacteria 4438
307 Ga0501036_0056341 3300049572 Bacteria 3330
308 Ga0501036_0065872 3300049572 Bacteria 3065
309 Ga0501036_0083879 3300049572 Bacteria 2694
310 Ga0501036_0128383 3300049572 Bacteria 2141
311 Ga0501036_0215824 3300049572 Bacteria 1611
312 Ga0501036_0216333 3300049572 Bacteria 1609
313 Ga0501036_0381386 3300049572 Bacteria 1176
314 Ga0501037_0001734 3300049573 Bacteria 15838
315 Ga0501037_0130294 3300049573 Bacteria 1804
316 Ga0501037_0154519 3300049573 Bacteria 1638
317 Ga0501038_0039243 3300049574 Bacteria 4142
318 Ga0501038_0073679 3300049574 Bacteria 2891
319 Ga0501038_0126242 3300049574 Bacteria 2105
320 Ga0501038_0197851 3300049574 Bacteria 1614
321 Ga0501039_0004469 3300049575 Bacteria 10557
322 Ga0501039_0004706 3300049575 Bacteria 10331
323 Ga0501039_0005652 3300049575 Bacteria 9469
324 Ga0501039_0007849 3300049575 Bacteria 8137
325 Ga0501039_0028925 3300049575 Bacteria 4267
326 Ga0501039_0035876 3300049575 Bacteria 3827
327 Ga0501039_0049629 3300049575 Bacteria 3244
328 Ga0501039_0076511 3300049575 Bacteria 2602
329 Ga0501039_0106988 3300049575 Bacteria 2184
330 Ga0501039_0178139 3300049575 Bacteria 1672
331 Ga0501040_0006766 3300049576 Bacteria 7436
332 Ga0501040_0013691 3300049576 Bacteria 5335
333 Ga0501040_0020228 3300049576 Bacteria 4434
334 Ga0501040_0028589 3300049576 Bacteria 3759
335 Ga0501040_0044061 3300049576 Bacteria 3041
336 Ga0501040_0049469 3300049576 Bacteria 2873
337 Ga0501040_0050354 3300049576 Bacteria 2849
338 Ga0501040_0149850 3300049576 Bacteria 1645
339 Ga0501040_0272049 3300049576 Bacteria 1209
340 Ga0501040_0395343 3300049576 Bacteria 992
341 Ga0501041_0008844 3300049577 Bacteria 5926
342 Ga0501041_0014386 3300049577 Bacteria 4698
343 Ga0501041_0069874 3300049577 Bacteria 2155
344 Ga0501041_0082353 3300049577 Bacteria 1982
345 Ga0501041_0084786 3300049577 Bacteria 1953
346 Ga0501041_0108561 3300049577 Bacteria 1721
347 Ga0501041_0140255 3300049577 Bacteria 1507
348 Ga0501041_0266183 3300049577 Bacteria 1078
349 Ga0501042_0001435 3300049578 Bacteria 14027
350 Ga0501042_0011998 3300049578 Bacteria 5858
351 Ga0501042_0018528 3300049578 Bacteria 4821
352 Ga0501042_0024229 3300049578 Bacteria 4255
353 Ga0501042_0033924 3300049578 Bacteria 3619
354 Ga0501042_0050337 3300049578 Bacteria 2971
355 Ga0501042_0055572 3300049578 Bacteria 2826
356 Ga0501042_0057598 3300049578 Bacteria 2773
357 Ga0501042_0080049 3300049578 Bacteria 2341
358 Ga0501042_0081052 3300049578 Bacteria 2326
359 Ga0501042_0110924 3300049578 Bacteria 1975
360 Ga0501042_0118942 3300049578 Archaea 1902
361 Ga0501042_0150271 3300049578 Bacteria 1679
362 Ga0501042_0162951 3300049578 Bacteria 1609
363 Ga0501042_0273673 3300049578 Bacteria 1219
364 Ga0501043_0009524 3300049579 Bacteria 7613
365 Ga0501043_0010000 3300049579 Bacteria 7441
366 Ga0501043_0086608 3300049579 Bacteria 2461
367 Ga0501046_0003965 3300049580 Bacteria 13506
368 Ga0501046_0004588 3300049580 Bacteria 12473
369 Ga0501046_0007542 3300049580 Bacteria 9543
370 Ga0501046_0018224 3300049580 Bacteria 5846
371 Ga0501046_0019057 3300049580 Bacteria 5696
372 Ga0501046_0065245 3300049580 Bacteria 2841
373 Ga0501046_0284654 3300049580 Bacteria 1210
374 Ga0501047_0082872 3300049581 Bacteria 3082
375 Ga0501047_0235044 3300049581 Bacteria 1685
376 Ga0501048_0001957 3300049582 Bacteria 15662
377 Ga0501048_0010335 3300049582 Bacteria 6977
378 Ga0501048_0018651 3300049582 Bacteria 5101
379 Ga0501048_0027313 3300049582 Bacteria 4150
380 Ga0501048_0033221 3300049582 Bacteria 3728
381 Ga0501048_0037479 3300049582 Bacteria 3482
382 Ga0501048_0049748 3300049582 Bacteria 2987
383 Ga0501048_0085567 3300049582 Bacteria 2224
384 Ga0501048_0101149 3300049582 Archaea 2033
385 Ga0501048_0112136 3300049582 Bacteria 1926
386 Ga0501048_0140456 3300049582 Bacteria 1708
387 Ga0501048_0214404 3300049582 Bacteria 1365
388 Ga0501048_0223906 3300049582 Bacteria 1335
389 Ga0501068_0001237 3300049584 Bacteria 13560
390 Ga0501068_0002162 3300049584 Bacteria 10476
391 Ga0501068_0012369 3300049584 Bacteria 4837
392 Ga0501068_0051187 3300049584 Bacteria 2498
393 Ga0501069_0000404 3300049585 Bacteria 19543
394 Ga0501069_0004675 3300049585 Bacteria 7074
395 Ga0501069_0011611 3300049585 Bacteria 4669
396 Ga0501069_0043559 3300049585 Bacteria 2485
397 Ga0501069_0059811 3300049585 Bacteria 2126
398 Ga0501069_0086218 3300049585 Bacteria 1773
399 Ga0501070_0004679 3300049586 Bacteria 11720
400 Ga0501070_0008333 3300049586 Bacteria 8757
401 Ga0501070_0038687 3300049586 Bacteria 3980
402 Ga0501070_0064647 3300049586 Bacteria 3029
403 Ga0501070_0261625 3300049586 Bacteria 1414
404 Ga0501071_0000057 3300049587 Bacteria 37883
405 Ga0501071_0002187 3300049587 Bacteria 11763
406 Ga0501071_0013391 3300049587 Bacteria 5587
407 Ga0501071_0017704 3300049587 Bacteria 4919
408 Ga0501071_0039690 3300049587 Bacteria 3368
409 Ga0501071_0047019 3300049587 Bacteria 3100
410 Ga0501071_0066448 3300049587 Bacteria 2620
411 Ga0501071_0100479 3300049587 Bacteria 2132
412 Ga0501071_0111763 3300049587 Bacteria 2019
413 Ga0501071_0119860 3300049587 Bacteria 1950
414 Ga0501071_0233677 3300049587 Bacteria 1385
415 Ga0501071_0526314 3300049587 Unclassified 907
416 Ga0501072_0000387 3300049588 Bacteria 31559
417 Ga0501072_0003064 3300049588 Bacteria 12600
418 Ga0501072_0010763 3300049588 Bacteria 6971
419 Ga0501072_0013708 3300049588 Bacteria 6206
420 Ga0501072_0018450 3300049588 Bacteria 5373
421 Ga0501072_0042878 3300049588 Bacteria 3555
422 Ga0501072_0046348 3300049588 Bacteria 3421
423 Ga0501072_0051584 3300049588 Bacteria 3239
424 Ga0501072_0056744 3300049588 Bacteria 3085
425 Ga0501072_0129603 3300049588 Bacteria 2010
426 Ga0501072_0157930 3300049588 Bacteria 1808
427 Ga0501072_0186547 3300049588 Bacteria 1654
428 Ga0501072_0198522 3300049588 Bacteria 1599
429 Ga0501072_0207390 3300049588 Bacteria 1562
430 Ga0501072_0298383 3300049588 Bacteria 1281
431 Ga0501072_0305964 3300049588 Bacteria 1264
432 Ga0501072_0367732 3300049588 Archaea 1141
433 Ga0501073_0000148 3300049589 Bacteria 46653
434 Ga0501073_0044561 3300049589 Bacteria 3126
435 Ga0501073_0087460 3300049589 Bacteria 2167
436 Ga0501073_0256740 3300049589 Bacteria 1206
437 Ga0501074_0002850 3300049590 Bacteria 12107
438 Ga0501074_0004135 3300049590 Bacteria 10354
439 Ga0501074_0018304 3300049590 Bacteria 5088
440 Ga0501074_0027513 3300049590 Bacteria 4123
441 Ga0501074_0041591 3300049590 Bacteria 3327
442 Ga0501074_0095009 3300049590 Bacteria 2135
443 Ga0501075_0001751 3300049591 Bacteria 14276
444 Ga0501075_0003671 3300049591 Bacteria 10295
445 Ga0501075_0006571 3300049591 Bacteria 8008
446 Ga0501075_0009069 3300049591 Bacteria 6947
447 Ga0501075_0023151 3300049591 Bacteria 4545
448 Ga0501075_0037341 3300049591 Bacteria 3628
449 Ga0501075_0041240 3300049591 Bacteria 3458
450 Ga0501075_0063510 3300049591 Bacteria 2784
451 Ga0501075_0066731 3300049591 Bacteria 2715
452 Ga0501075_0084073 3300049591 Bacteria 2410
453 Ga0501075_0104390 3300049591 Bacteria 2154
454 Ga0501075_0122821 3300049591 Bacteria 1976
455 Ga0501075_0300619 3300049591 Bacteria 1223
456 Ga0501075_0360198 3300049591 Bacteria 1109
457 Ga0501075_0377590 3300049591 Bacteria 1080
458 Ga0501075_0504594 3300049591 Bacteria 923
459 Ga0501076_0000937 3300049592 Bacteria 19025
460 Ga0501076_0001062 3300049592 Bacteria 18051
461 Ga0501076_0001698 3300049592 Bacteria 14863
462 Ga0501076_0002718 3300049592 Bacteria 12226
463 Ga0501076_0004892 3300049592 Bacteria 9580
464 Ga0501076_0016966 3300049592 Bacteria 5527
465 Ga0501076_0045097 3300049592 Bacteria 3480
466 Ga0501076_0047216 3300049592 Bacteria 3404
467 Ga0501076_0063413 3300049592 Bacteria 2944
468 Ga0501076_0121674 3300049592 Bacteria 2113
469 Ga0501076_0336864 3300049592 Bacteria 1238
470 Ga0501077_0002813 3300049593 Bacteria 10437
471 Ga0501077_0002902 3300049593 Bacteria 10283
472 Ga0501077_0003502 3300049593 Bacteria 9422
473 Ga0501077_0005954 3300049593 Bacteria 7445
474 Ga0501077_0015792 3300049593 Bacteria 4755
475 Ga0501077_0051251 3300049593 Bacteria 2623
476 Ga0501077_0094406 3300049593 Bacteria 1896
477 Ga0501077_0098607 3300049593 Bacteria 1852
478 Ga0501077_0281924 3300049593 Bacteria 1058
479 Ga0501079_0022675 3300049741 Bacteria 4816
480 Ga0501079_0028111 3300049741 Bacteria 4314
481 Ga0501079_0067668 3300049741 Bacteria 2757
482 Ga0501079_0078268 3300049741 Bacteria 2557
483 Ga0501079_0097360 3300049741 Bacteria 2281
484 Ga0501079_0099595 3300049741 Bacteria 2252
485 Ga0501079_0119392 3300049741 Bacteria 2050
486 Ga0501079_0252657 3300049741 Bacteria 1378
487 Ga0501080_0001415 3300049742 Bacteria 20114
488 Ga0501080_0008113 3300049742 Bacteria 9515
489 Ga0501080_0038465 3300049742 Bacteria 4467
490 Ga0501080_0107531 3300049742 Bacteria 2585
491 Ga0501080_0389080 3300049742 Unclassified 1255
492 Ga0501080_0442550 3300049742 Bacteria 1166
493 Ga0501081_0000659 3300049743 Bacteria 19786
494 Ga0501081_0003256 3300049743 Bacteria 10338
495 Ga0501081_0026484 3300049743 Bacteria 3911
496 Ga0501081_0030276 3300049743 Bacteria 3663
497 Ga0501081_0046167 3300049743 Bacteria 2993
498 Ga0501081_0076159 3300049743 Bacteria 2343
499 Ga0501081_0188110 3300049743 Bacteria 1494
500 Ga0501083_0000209 3300049744 Bacteria 38057
501 Ga0501083_0008208 3300049744 Bacteria 7382
502 Ga0501083_0017973 3300049744 Bacteria 4931
503 Ga0501083_0057178 3300049744 Bacteria 2612
504 Ga0501083_0072870 3300049744 Bacteria 2282
505 Ga0501083_0267951 3300049744 Unclassified 1111
506 Ga0501035_0003290 3300049822 Bacteria 15492
507 Ga0501035_0003920 3300049822 Bacteria 14190
508 Ga0501035_0063563 3300049822 Bacteria 3282
509 Ga0501035_0096607 3300049822 Bacteria 2596
510 Ga0501035_0137441 3300049822 Bacteria 2126
511 Ga0501035_0138965 3300049822 Bacteria 2113
512 Ga0501044_0047858 3300049823 Bacteria 4421
513 Ga0501044_0084680 3300049823 Bacteria 3204
514 Ga0501045_0002829 3300049824 Bacteria 11847
515 Ga0501045_0004026 3300049824 Bacteria 10127
516 Ga0501045_0008330 3300049824 Bacteria 7221
517 Ga0501045_0011887 3300049824 Bacteria 6118
518 Ga0501045_0018176 3300049824 Bacteria 4996
519 Ga0501045_0023716 3300049824 Bacteria 4401
520 Ga0501045_0059896 3300049824 Bacteria 2790
521 Ga0501045_0062944 3300049824 Bacteria 2722
522 Ga0501045_0074795 3300049824 Bacteria 2494
523 Ga0501045_0157287 3300049824 Bacteria 1691
524 nmdc:mga00v17_10272_c1 3300050491 Bacteria 5104
525 nmdc:mga00v17_42382_c1 3300050491 Bacteria 2737
526 nmdc:mga0yw44_148546_c1 3300050492 Bacteria 1527
527 nmdc:mga0yw44_2016_c1 3300050492 Bacteria 8448
528 nmdc:mga0yw44_91558_c1 3300050492 Bacteria 1923
529 nmdc:mga05p37_112166_c1 3300050507 Bacteria 3353
530 nmdc:mga05p37_308751_c1 3300050507 Bacteria 1876
531 nmdc:mga05p37_326668_c1 3300050507 Bacteria 1814
532 nmdc:mga05p37_33091_c1 3300050507 Bacteria 6332
533 nmdc:mga05p37_4163_c1 3300050507 Bacteria 16897
534 nmdc:mga05p37_447033_c1 3300050507 Archaea 1497
535 nmdc:mga05p37_454498_c1 3300050507 Bacteria 1482
536 nmdc:mga05p37_49566_c1 3300050507 Bacteria 5165
537 nmdc:mga05p37_606_c1 3300050507 Bacteria 39578
538 nmdc:mga05p37_6818_c2 3300050507 Bacteria 6371
539 nmdc:mga05p37_744860_c1 3300050507 Bacteria 1081
540 nmdc:mga09592_10070_c1 3300050508 Bacteria 7687
541 nmdc:mga09592_154257_c1 3300050508 Bacteria 1982
542 nmdc:mga09592_168115_c1 3300050508 Bacteria 1896
543 nmdc:mga09592_302185_c1 3300050508 Bacteria 1387
544 nmdc:mga09592_403918_c1 3300050508 Bacteria 1181
545 nmdc:mga09592_47796_c1 3300050508 Bacteria 3606
546 nmdc:mga09592_66600_c1 3300050508 Bacteria 3053
547 nmdc:mga09592_74_c1 3300050508 Bacteria 56650
548 nmdc:mga09592_7708_c1 3300050508 Bacteria 8749
549 nmdc:mga09592_85397_c1 3300050508 Bacteria 2693
550 nmdc:mga09592_9247_c1 3300050508 Bacteria 8017
551 nmdc:mga0qj67_19102_c1 3300050509 Bacteria 5233
552 nmdc:mga0qj67_20519_c1 3300050509 Bacteria 5061
553 nmdc:mga0qj67_229459_c1 3300050509 Bacteria 1507
554 nmdc:mga0qj67_26_c1 3300050509 Bacteria 103914
555 nmdc:mga0qj67_291618_c1 3300050509 Bacteria 1322
556 nmdc:mga0qj67_336777_c1 3300050509 Bacteria 1221
557 nmdc:mga0qj67_3416_c1 3300050509 Bacteria 11457
558 nmdc:mga0qj67_3827_c1 3300050509 Bacteria 10875
559 nmdc:mga0qj67_5354_c1 3300050509 Bacteria 9366
560 nmdc:mga0qj67_72344_c1 3300050509 Bacteria 2753
561 nmdc:mga06r32_12495_c1 3300050510 Bacteria 7664
562 nmdc:mga06r32_176987_c1 3300050510 Bacteria 2118
563 nmdc:mga06r32_194_c1 3300050510 Bacteria 36791
564 nmdc:mga06r32_235815_c1 3300050510 Bacteria 1817
565 nmdc:mga06r32_328029_c1 3300050510 Bacteria 1516
566 nmdc:mga06r32_482844_c1 3300050510 Bacteria 1217
567 nmdc:mga06r32_523966_c1 3300050510 Bacteria 1161
568 nmdc:mga06r32_54839_c1 3300050510 Bacteria 3823
569 nmdc:mga06r32_5695_c1 3300050510 Bacteria 11218
570 nmdc:mga06r32_6900_c1 3300050510 Bacteria 10210
571 nmdc:mga08y16_21354_c1 3300050511 Bacteria 6837
572 nmdc:mga08y16_283881_c1 3300050511 Bacteria 1707
573 nmdc:mga08y16_87610_c1 3300050511 Bacteria 3244
574 nmdc:mga0a205_11_c1 3300050515 Bacteria 121735
575 nmdc:mga0a205_138788_c1 3300050515 Bacteria 2331
576 Ga0501084_0000406 3300054114 Bacteria 33222
577 Ga0501084_0006528 3300054114 Bacteria 9585
578 Ga0501084_0011489 3300054114 Bacteria 7332
579 Ga0501084_0029453 3300054114 Bacteria 4592
580 Ga0501084_0040424 3300054114 Bacteria 3901
581 Ga0501084_0052238 3300054114 Bacteria 3420
582 Ga0501084_0057588 3300054114 Bacteria 3252
583 Ga0501084_0059602 3300054114 Bacteria 3195
584 Ga0501084_0119124 3300054114 Bacteria 2219
585 Ga0501084_0128495 3300054114 Bacteria 2133
586 Ga0501084_0135643 3300054114 Bacteria 2072
587 Ga0501084_0182537 3300054114 Unclassified 1771
588 Ga0590077_013545 3300059426 Bacteria 1696
589 Ga0501082_0009961 3300060353 Bacteria 8196
590 Ga0501082_0025968 3300060353 Bacteria 5048
591 Ga0501082_0029817 3300060353 Bacteria 4699
592 Ga0501082_0030952 3300060353 Bacteria 4613
593 Ga0501082_0053382 3300060353 Bacteria 3484
594 Ga0501082_0090809 3300060353 Bacteria 2637
595 Ga0501082_0119198 3300060353 Bacteria 2287
596 Ga0501082_0216251 3300060353 Bacteria 1667
597 Ga0501082_0389200 3300060353 Archaea 1216
598 Ga0501082_0477035 3300060353 Bacteria 1090
599 Ga0501082_0695089 3300060353 Bacteria 890
600 Ga0530510_0000817 3300061734 Bacteria 20371
601 Ga0530510_0006040 3300061734 Bacteria 8406
602 Ga0530510_0017791 3300061734 Bacteria 5038
603 Ga0530510_0022439 3300061734 Bacteria 4497
604 Ga0530510_0037274 3300061734 Bacteria 3506
605 Ga0530510_0044692 3300061734 Bacteria 3201
606 Ga0530510_0048151 3300061734 Bacteria 3080
607 Ga0530510_0055137 3300061734 Bacteria 2872
608 Ga0530510_0055272 3300061734 Bacteria 2868
609 Ga0530510_0057448 3300061734 Bacteria 2812
610 Ga0530510_0072305 3300061734 Bacteria 2503
611 Ga0530510_0099167 3300061734 Bacteria 2130
612 Ga0530510_0157125 3300061734 Bacteria 1681
613 Ga0530510_0183958 3300061734 Unclassified 1550
614 Ga0530510_0227963 3300061734 Bacteria 1385
615 Ga0530510_0239870 3300061734 Archaea 1349
616 2515495427 2515154088 Bacteria 5526283
617 2515720215 2515154129 Bacteria 5584369
618 2515758201 2515154137 Bacteria 5711575
619 2516084463 2515154202 Bacteria 5471270
620 2516089589 2515154203 Bacteria 5458536
621 2689961469 2687453737 Bacteria 11203906
622 2862386607 2862382967 Bacteria 10317375
623 2912761397 2912757875 Bacteria 7940295
624 8002781919 8002775197 Bacteria 10728764
625 8008567613 8008558824 Bacteria 10610750
626 Ga0070704_100295204
627 JGI24746J21847_1000145
628 JGI25407J50210_10001150
629 JGI25407J50210_10002672
630 JGI25407J50210_10003426
631 JGI25407J50210_10017961
632 Ga0070683_100037103
633 Ga0070691_10000012
634 Ga0070668_100353044
635 Ga0070669_100074338
636 Ga0070675_100089595
637 Ga0070674_100000008
638 Ga0070674_100000029
639 Ga0070705_100001466
640 Ga0070700_100005005
641 Ga0070700_100073745
642 Ga0070694_100047536
643 Ga0070678_100468967
644 Ga0070699_100309705
645 Ga0070684_100237938
646 Ga0070672_100000027
647 Ga0070696_100125450
648 Ga0070665_100065567
649 Ga0070665_100451433
650 Ga0070704_100023905
651 Ga0070704_100061902
652 Ga0070704_100080989
653 Ga0070704_100262977
654 Ga0070702_100083774
655 Ga0068852_100038998
656 Ga0068864_100000045
657 Ga0068866_10000001
658 Ga0068866_10000031
659 Ga0068866_10131050
660 Ga0081455_10008235
661 Ga0081455_10013627
662 Ga0081455_10039859
663 Ga0081455_10112710
664 Ga0081538_10000066
665 Ga0081538_10000118
666 Ga0081538_10000144
667 Ga0081538_10000195
668 Ga0081538_10000410
669 Ga0081538_10000465
670 Ga0081538_10000590
671 Ga0081538_10001536
672 Ga0081538_10001773
673 Ga0081538_10003848
674 Ga0081538_10004852
675 Ga0081538_10005772
676 Ga0081538_10008182
677 Ga0081538_10018231
678 Ga0081538_10018349
679 Ga0081538_10026541
680 Ga0081538_10035714
681 Ga0081538_10039390
682 Ga0081538_10079078
683 Ga0081539_10000030
684 Ga0075365_10000604
685 Ga0075365_10018240
686 Ga0075365_10108828
687 Ga0075365_10137346
688 Ga0075363_100001743
689 Ga0075363_100003534
690 Ga0075364_10010277
691 Ga0075364_10025509
692 Ga0075364_10131901
693 Ga0075432_10029584
694 Ga0075367_10087288
695 Ga0075370_10070857
696 Ga0075428_100000501
697 Ga0075428_100021417
698 Ga0075428_100021734
699 Ga0075428_100099809
700 Ga0075428_100121137
701 Ga0075428_100132543
702 Ga0075428_100150146
703 Ga0075428_100531636
704 Ga0075428_100598717
705 Ga0075430_100001364
706 Ga0075430_100005439
707 Ga0075430_100007364
708 Ga0075430_100010436
709 Ga0075430_100102920
710 Ga0075430_100113811
711 Ga0075430_100129055
712 Ga0075430_100271972
713 Ga0075431_100003573
714 Ga0075431_100004107
715 Ga0075431_100013507
716 Ga0075431_100070844
717 Ga0075431_100078906
718 Ga0075431_100147686
719 Ga0075431_100329772
720 Ga0075431_100463624
721 Ga0075433_10105512
722 Ga0075429_100002951
723 Ga0075429_100005755
724 Ga0075429_100010743
725 Ga0075429_100052382
726 Ga0075429_100081065
727 Ga0075429_100107895
728 Ga0075429_100125681
729 Ga0075429_100211906
730 Ga0111539_10008931
731 Ga0111539_10072585
732 Ga0111539_10083516
733 Ga0111539_10143957
734 Ga0111539_10152157
735 Ga0111539_10280975
736 Ga0111539_10552585
737 Ga0111539_10587120
738 Ga0105245_10177416
739 Ga0114129_10000194
740 Ga0114129_10024616
741 Ga0114129_10055754
742 Ga0114129_10062629
743 Ga0114129_10069788
744 Ga0114129_10096363
745 Ga0114129_10135363
746 Ga0114129_10802096
747 Ga0114129_10979013
748 Ga0105243_10004145
749 Ga0105243_10138116
750 Ga0105243_10159574
751 Ga0105243_10162950
752 Ga0105238_10445001
753 Ga0105249_10682683
754 Ga0105239_10134102
755 Ga0163163_10060170
756 Ga0157380_10003475
757 Ga0157380_10218142
758 Ga0157377_10082351
759 Ga0207642_10000031
760 Ga0207642_10000034
761 Ga0207680_10006858
762 Ga0207684_10585582
763 Ga0207660_10142158
764 Ga0207681_10111326
765 Ga0207659_10044493
766 Ga0207687_10160912
767 Ga0207706_10062514
768 Ga0207709_10001837
769 Ga0207709_10024913
770 Ga0207709_10086783
771 Ga0207709_10102172
772 Ga0207709_10127229
773 Ga0207669_10000004
774 Ga0207669_10000012
775 Ga0207704_10091449
776 Ga0207691_10000136
777 Ga0207661_10011700
778 Ga0207708_10087357
779 Ga0207676_10000016
780 Ga0207683_10195398
781 Ga0207428_10003693
782 Ga0207428_10008841
783 Ga0207428_10024093
784 Ga0268265_10570900
785 Ga0307408_100028093
786 Ga0307408_100272438
787 Ga0307405_10008347
788 Ga0307405_10076779
789 Ga0307405_10196225
790 Ga0307410_10039935
791 Ga0307410_10054867
792 Ga0307410_10160084
793 Ga0307410_10195077
794 Ga0307406_10045455
795 Ga0307407_10021434
796 Ga0307407_10187149
797 Ga0307412_10099039
798 Ga0307412_10119482
799 Ga0307409_100001863
800 Ga0307409_100006225
801 Ga0307409_100025947
802 Ga0307409_100107903
803 Ga0307409_100109040
804 Ga0307409_100222244
805 Ga0307409_100443047
806 Ga0307416_100003524
807 Ga0307416_100008175
808 Ga0307416_100027144
809 Ga0307416_100032563
810 Ga0307416_100067821
811 Ga0307416_100659099
812 Ga0307416_100724168
813 Ga0307414_10136695
814 Ga0307411_10180822
815 Ga0307411_10207240
816 Ga0307415_100001050
817 Ga0307415_100001186
818 Ga0307415_100004307
819 Ga0307415_100004867
820 Ga0307415_100007164
821 Ga0307415_100008872
822 Ga0307415_100030067
823 Ga0307415_100053582
824 Ga0307415_100146214
825 Ga0307415_100268874
826 Ga0395899_0004128
827 Ga0395899_0019673
828 Ga0395899_0045150
829 Ga0395899_0057195
830 Ga0395900_0002160
831 Ga0395900_0002341
832 Ga0395900_0005876
833 Ga0395900_0015224
834 Ga0395900_0023744
835 Ga0395900_0054393
836 Ga0395900_0060613
837 Ga0395900_0105998
838 Ga0395900_0146447
839 Ga0395900_0366643
840 Ga0395900_0493950
841 Ga0395898_0001770
842 Ga0395898_0004467
843 Ga0395898_0011798
844 Ga0395898_0013082
845 Ga0395898_0021050
846 Ga0395898_0021088
847 Ga0395898_0039892
848 Ga0395898_0068658
849 Ga0395898_0119856
850 Ga0395898_0163714
851 Ga0395898_0187238
852 Ga0395905_0001447
853 Ga0395905_0003203
854 Ga0395905_0004137
855 Ga0395905_0009107
856 Ga0395905_0014284
857 Ga0395905_0023982
858 Ga0395905_0118098
859 Ga0395905_0148689
860 Ga0395905_0246775
861 Ga0395905_0259754
862 Ga0395905_0446233
863 Ga0395901_0000659
864 Ga0395901_0001156
865 Ga0395901_0001461
866 Ga0395901_0002686
867 Ga0395901_0005938
868 Ga0395901_0006169
869 Ga0395901_0012842
870 Ga0395901_0021396
871 Ga0395901_0065618
872 Ga0395901_0088124
873 Ga0395901_0092322
874 Ga0395901_0250869
875 Ga0395901_0406018
876 Ga0439439_0000828
877 Ga0439461_0009872
878 Ga0451807_1101761
879 Ga0451853_1308288
880 Ga0439433_0003655
881 Ga0439442_018511
882 Ga0439448_0008136
883 Ga0439449_0017819
884 Ga0439450_000058
885 Ga0439454_006745
886 Ga0439462_0000074
887 Ga0439463_001968
888 Ga0450906_008404
889 Ga0450907_010490
890 Ga0450907_023336
891 Ga0439446_0007658
892 Ga0439458_0042021
893 Ga0439434_0030864
894 Ga0439464_0002822
895 Ga0439460_0001200
896 Ga0450916_000856
897 Ga0439440_0000325
898 Ga0495641_0033692
899 Ga0495620_0000951
900 Ga0495644_0000380
901 Ga0495656_0000391
902 Ga0495658_0004468
903 Ga0495670_0011634
904 Ga0495589_0064924
905 Ga0496106_0000081
906 Ga0496108_0003808
907 Ga0496109_0142767
908 Ga0496113_0011015
909 Ga0496113_0053694
910 Ga0496113_0072142
911 Ga0496121_0261703
912 Ga0501031_0002322
913 Ga0501031_0002959
914 Ga0501031_0015597
915 Ga0501031_0015922
916 Ga0501031_0023235
917 Ga0501031_0048863
918 Ga0501031_0072153
919 Ga0501032_0026681
920 Ga0501032_0027978
921 Ga0501032_0087127
922 Ga0501032_0158022
923 Ga0501033_0003256
924 Ga0501033_0003468
925 Ga0501033_0010597
926 Ga0501033_0038590
927 Ga0501033_0065906
928 Ga0501034_0122582
929 Ga0501036_0000308
930 Ga0501036_0023135
931 Ga0501036_0032074
932 Ga0501036_0056341
933 Ga0501036_0065872
934 Ga0501036_0083879
935 Ga0501036_0128383
936 Ga0501036_0215824
937 Ga0501036_0216333
938 Ga0501036_0381386
939 Ga0501037_0001734
940 Ga0501037_0130294
941 Ga0501037_0154519
942 Ga0501038_0039243
943 Ga0501038_0073679
944 Ga0501038_0126242
945 Ga0501038_0197851
946 Ga0501039_0004469
947 Ga0501039_0004706
948 Ga0501039_0005652
949 Ga0501039_0007849
950 Ga0501039_0028925
951 Ga0501039_0035876
952 Ga0501039_0049629
953 Ga0501039_0076511
954 Ga0501039_0106988
955 Ga0501039_0178139
956 Ga0501040_0006766
957 Ga0501040_0013691
958 Ga0501040_0020228
959 Ga0501040_0028589
960 Ga0501040_0044061
961 Ga0501040_0049469
962 Ga0501040_0050354
963 Ga0501040_0149850
964 Ga0501040_0272049
965 Ga0501040_0395343
966 Ga0501041_0008844
967 Ga0501041_0014386
968 Ga0501041_0069874
969 Ga0501041_0082353
970 Ga0501041_0084786
971 Ga0501041_0108561
972 Ga0501041_0140255
973 Ga0501041_0266183
974 Ga0501042_0001435
975 Ga0501042_0011998
976 Ga0501042_0018528
977 Ga0501042_0024229
978 Ga0501042_0033924
979 Ga0501042_0050337
980 Ga0501042_0055572
981 Ga0501042_0057598
982 Ga0501042_0080049
983 Ga0501042_0081052
984 Ga0501042_0110924
985 Ga0501042_0118942
986 Ga0501042_0150271
987 Ga0501042_0162951
988 Ga0501042_0273673
989 Ga0501043_0009524
990 Ga0501043_0010000
991 Ga0501043_0086608
992 Ga0501046_0003965
993 Ga0501046_0004588
994 Ga0501046_0007542
995 Ga0501046_0018224
996 Ga0501046_0019057
997 Ga0501046_0065245
998 Ga0501046_0284654
999 Ga0501047_0082872
1000 Ga0501047_0235044
1001 Ga0501048_0001957
1002 Ga0501048_0010335
1003 Ga0501048_0018651
1004 Ga0501048_0027313
1005 Ga0501048_0033221
1006 Ga0501048_0037479
1007 Ga0501048_0049748
1008 Ga0501048_0085567
1009 Ga0501048_0101149
1010 Ga0501048_0112136
1011 Ga0501048_0140456
1012 Ga0501048_0214404
1013 Ga0501048_0223906
1014 Ga0501068_0001237
1015 Ga0501068_0002162
1016 Ga0501068_0012369
1017 Ga0501068_0051187
1018 Ga0501069_0000404
1019 Ga0501069_0004675
1020 Ga0501069_0011611
1021 Ga0501069_0043559
1022 Ga0501069_0059811
1023 Ga0501069_0086218
1024 Ga0501070_0004679
1025 Ga0501070_0008333
1026 Ga0501070_0038687
1027 Ga0501070_0064647
1028 Ga0501070_0261625
1029 Ga0501071_0000057
1030 Ga0501071_0002187
1031 Ga0501071_0013391
1032 Ga0501071_0017704
1033 Ga0501071_0039690
1034 Ga0501071_0047019
1035 Ga0501071_0066448
1036 Ga0501071_0100479
1037 Ga0501071_0111763
1038 Ga0501071_0119860
1039 Ga0501071_0233677
1040 Ga0501071_0526314
1041 Ga0501072_0000387
1042 Ga0501072_0003064
1043 Ga0501072_0010763
1044 Ga0501072_0013708
1045 Ga0501072_0018450
1046 Ga0501072_0042878
1047 Ga0501072_0046348
1048 Ga0501072_0051584
1049 Ga0501072_0056744
1050 Ga0501072_0129603
1051 Ga0501072_0157930
1052 Ga0501072_0186547
1053 Ga0501072_0198522
1054 Ga0501072_0207390
1055 Ga0501072_0298383
1056 Ga0501072_0305964
1057 Ga0501072_0367732
1058 Ga0501073_0000148
1059 Ga0501073_0044561
1060 Ga0501073_0087460
1061 Ga0501073_0256740
1062 Ga0501074_0002850
1063 Ga0501074_0004135
1064 Ga0501074_0018304
1065 Ga0501074_0027513
1066 Ga0501074_0041591
1067 Ga0501074_0095009
1068 Ga0501075_0001751
1069 Ga0501075_0003671
1070 Ga0501075_0006571
1071 Ga0501075_0009069
1072 Ga0501075_0023151
1073 Ga0501075_0037341
1074 Ga0501075_0041240
1075 Ga0501075_0063510
1076 Ga0501075_0066731
1077 Ga0501075_0084073
1078 Ga0501075_0104390
1079 Ga0501075_0122821
1080 Ga0501075_0300619
1081 Ga0501075_0360198
1082 Ga0501075_0377590
1083 Ga0501075_0504594
1084 Ga0501076_0000937
1085 Ga0501076_0001062
1086 Ga0501076_0001698
1087 Ga0501076_0002718
1088 Ga0501076_0004892
1089 Ga0501076_0016966
1090 Ga0501076_0045097
1091 Ga0501076_0047216
1092 Ga0501076_0063413
1093 Ga0501076_0121674
1094 Ga0501076_0336864
1095 Ga0501077_0002813
1096 Ga0501077_0002902
1097 Ga0501077_0003502
1098 Ga0501077_0005954
1099 Ga0501077_0015792
1100 Ga0501077_0051251
1101 Ga0501077_0094406
1102 Ga0501077_0098607
1103 Ga0501077_0281924
1104 Ga0501079_0022675
1105 Ga0501079_0028111
1106 Ga0501079_0067668
1107 Ga0501079_0078268
1108 Ga0501079_0097360
1109 Ga0501079_0099595
1110 Ga0501079_0119392
1111 Ga0501079_0252657
1112 Ga0501080_0001415
1113 Ga0501080_0008113
1114 Ga0501080_0038465
1115 Ga0501080_0107531
1116 Ga0501080_0389080
1117 Ga0501080_0442550
1118 Ga0501081_0000659
1119 Ga0501081_0003256
1120 Ga0501081_0026484
1121 Ga0501081_0030276
1122 Ga0501081_0046167
1123 Ga0501081_0076159
1124 Ga0501081_0188110
1125 Ga0501083_0000209
1126 Ga0501083_0008208
1127 Ga0501083_0017973
1128 Ga0501083_0057178
1129 Ga0501083_0072870
1130 Ga0501083_0267951
1131 Ga0501035_0003290
1132 Ga0501035_0003920
1133 Ga0501035_0063563
1134 Ga0501035_0096607
1135 Ga0501035_0137441
1136 Ga0501035_0138965
1137 Ga0501044_0047858
1138 Ga0501044_0084680
1139 Ga0501045_0002829
1140 Ga0501045_0004026
1141 Ga0501045_0008330
1142 Ga0501045_0011887
1143 Ga0501045_0018176
1144 Ga0501045_0023716
1145 Ga0501045_0059896
1146 Ga0501045_0062944
1147 Ga0501045_0074795
1148 Ga0501045_0157287
1149 nmdc:mga00v17_10272_c1
1150 nmdc:mga00v17_42382_c1
1151 nmdc:mga0yw44_148546_c1
1152 nmdc:mga0yw44_2016_c1
1153 nmdc:mga0yw44_91558_c1
1154 nmdc:mga05p37_112166_c1
1155 nmdc:mga05p37_308751_c1
1156 nmdc:mga05p37_326668_c1
1157 nmdc:mga05p37_33091_c1
1158 nmdc:mga05p37_4163_c1
1159 nmdc:mga05p37_447033_c1
1160 nmdc:mga05p37_454498_c1
1161 nmdc:mga05p37_49566_c1
1162 nmdc:mga05p37_606_c1
1163 nmdc:mga05p37_6818_c2
1164 nmdc:mga05p37_744860_c1
1165 nmdc:mga09592_10070_c1
1166 nmdc:mga09592_154257_c1
1167 nmdc:mga09592_168115_c1
1168 nmdc:mga09592_302185_c1
1169 nmdc:mga09592_403918_c1
1170 nmdc:mga09592_47796_c1
1171 nmdc:mga09592_66600_c1
1172 nmdc:mga09592_74_c1
1173 nmdc:mga09592_7708_c1
1174 nmdc:mga09592_85397_c1
1175 nmdc:mga09592_9247_c1
1176 nmdc:mga0qj67_19102_c1
1177 nmdc:mga0qj67_20519_c1
1178 nmdc:mga0qj67_229459_c1
1179 nmdc:mga0qj67_26_c1
1180 nmdc:mga0qj67_291618_c1
1181 nmdc:mga0qj67_336777_c1
1182 nmdc:mga0qj67_3416_c1
1183 nmdc:mga0qj67_3827_c1
1184 nmdc:mga0qj67_5354_c1
1185 nmdc:mga0qj67_72344_c1
1186 nmdc:mga06r32_12495_c1
1187 nmdc:mga06r32_176987_c1
1188 nmdc:mga06r32_194_c1
1189 nmdc:mga06r32_235815_c1
1190 nmdc:mga06r32_328029_c1
1191 nmdc:mga06r32_482844_c1
1192 nmdc:mga06r32_523966_c1
1193 nmdc:mga06r32_54839_c1
1194 nmdc:mga06r32_5695_c1
1195 nmdc:mga06r32_6900_c1
1196 nmdc:mga08y16_21354_c1
1197 nmdc:mga08y16_283881_c1
1198 nmdc:mga08y16_87610_c1
1199 nmdc:mga0a205_11_c1
1200 nmdc:mga0a205_138788_c1
1201 Ga0501084_0000406
1202 Ga0501084_0006528
1203 Ga0501084_0011489
1204 Ga0501084_0029453
1205 Ga0501084_0040424
1206 Ga0501084_0052238
1207 Ga0501084_0057588
1208 Ga0501084_0059602
1209 Ga0501084_0119124
1210 Ga0501084_0128495
1211 Ga0501084_0135643
1212 Ga0501084_0182537
1213 Ga0590077_013545
1214 Ga0501082_0009961
1215 Ga0501082_0025968
1216 Ga0501082_0029817
1217 Ga0501082_0030952
1218 Ga0501082_0053382
1219 Ga0501082_0090809
1220 Ga0501082_0119198
1221 Ga0501082_0216251
1222 Ga0501082_0389200
1223 Ga0501082_0477035
1224 Ga0501082_0695089
1225 Ga0530510_0000817
1226 Ga0530510_0006040
1227 Ga0530510_0017791
1228 Ga0530510_0022439
1229 Ga0530510_0037274
1230 Ga0530510_0044692
1231 Ga0530510_0048151
1232 Ga0530510_0055137
1233 Ga0530510_0055272
1234 Ga0530510_0057448
1235 Ga0530510_0072305
1236 Ga0530510_0099167
1237 Ga0530510_0157125
1238 Ga0530510_0183958
1239 Ga0530510_0227963
1240 Ga0530510_0239870
1241 2515495427
1242 2515720215
1243 2515758201
1244 2516084463
1245 2516089589
1246 2689961469
1247 2862386607
1248 2912761397
1249 8002781919
1250 8008567613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

105

320

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8351 90 314
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8304 90 316
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.8292 88 311
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.8165 90 310
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.8141 90 310
ID Description Score Start End Superfamily
af_Q2FYP8_79_307_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9799 82 316 1.10.3720.10
af_Q2FYP8_79_307_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9715 82 316 1.10.3720.10
af_Q58419_14_276_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8925 27 310 1.10.3720.10
af_P9WG07_21_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8924 37 314 1.10.3720.10
af_Q58420_16_310_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8858 32 315 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A351FZB2-F1-model_v4 Phosphate transport system permease protein 0.9797 82 319 GO:0005315
GO:0005886
GO:0006817
AF-A0A6N8Z551-F1-model_v4 Phosphate transport system permease protein 0.9795 62 319 GO:0005315
GO:0005886
GO:0006817
AF-A0A6L7TKZ1-F1-model_v4 Phosphate transport system permease protein 0.976 34 319 GO:0005315
GO:0005886
GO:0006817
AF-A0A2R9SP61-F1-model_v4 Phosphate transport system permease protein 0.9758 68 318 GO:0005315
GO:0005886
GO:0006817
AF-A0A845EMP2-F1-model_v4 deleted 0.9757 50 318

Map