F470326

General Info

Members Datasets Scaffolds Average Seq Length
624 281 605 340

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939743619|2939747966
Length 341
Sequence LPAVSLVDVASYLPENRVPTDYFTQFSRSDRMAKNVMFRSPRYRHHVARDETAVDMVERAVAPLIDRHGADAISSVDVLLTHTQLPDNPVLGSGPEVARRLGLRPDWVIDVHNSGCASFVQMMALAQTILQSTDATTALIAATQNCAGQVFTQTAIRGLAHAPVPGDGCGVGLLTKSNDAPILGIECRTHPEFGGDMTFEAVPVSDRKYWEPGRGQVCVGFTESKITKVFARGNRLVPEVALAVCDRIGVQSTEVDTLVTNQPNRLFLRNWREAMQLTPEQHPDTFDECGNLFGAGIPVTLDTANRDGRIGNGSLVLMAAFAHAGDFAGAAAVRWGAGPTT

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2643221692 Nocardia sp. Root136 Isolate Unclassified
4 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
5 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
6 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
7 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
8 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
9 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
10 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
11 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
12 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
13 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
14 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
15 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
16 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
17 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
18 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
19 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
269 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
270 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
271 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
274 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
275 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
276 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
277 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
280 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
281 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.46
Nodule 0.16
Rhizoplane 13.14
Rhizosphere 68.27
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1008460 3300002070 Bacteria 1308
2 JGI24744J21845_10003176 3300002077 Bacteria 3370
3 JGI24744J21845_10003374 3300002077 Bacteria 3281
4 JGI24742J22300_10001095 3300002244 Bacteria 4199
5 JGI24742J22300_10007986 3300002244 Bacteria 1747
6 rootH2_10055264 3300003320 Bacteria 4895
7 Ga0070676_10078486 3300005328 Bacteria 1997
8 Ga0070690_100007228 3300005330 Bacteria 6355
9 Ga0070670_100363401 3300005331 Bacteria 1273
10 Ga0068869_100014974 3300005334 Bacteria 5187
11 Ga0068869_100131023 3300005334 Bacteria 1928
12 Ga0070680_100113503 3300005336 Bacteria 2257
13 Ga0070682_100004933 3300005337 Bacteria 7408
14 Ga0070682_100005684 3300005337 Bacteria 6950
15 Ga0070682_100045049 3300005337 Bacteria 2733
16 Ga0070682_100112696 3300005337 Bacteria 1815
17 Ga0068868_100002812 3300005338 Bacteria 12059
18 Ga0068868_100103672 3300005338 Bacteria 2304
19 Ga0070689_100013931 3300005340 Bacteria 5832
20 Ga0070691_10037706 3300005341 Bacteria 2281
21 Ga0070691_10067301 3300005341 Bacteria 1732
22 Ga0070687_100087761 3300005343 Bacteria 1713
23 Ga0070668_100010210 3300005347 Bacteria 6964
24 Ga0070668_100016794 3300005347 Bacteria 5473
25 Ga0070668_100027164 3300005347 Bacteria 4344
26 Ga0070669_100008103 3300005353 Bacteria 7508
27 Ga0070671_100005599 3300005355 Bacteria 10001
28 Ga0070674_100003739 3300005356 Bacteria 8583
29 Ga0070674_100007854 3300005356 Bacteria 6310
30 Ga0070674_100015283 3300005356 Bacteria 4789
31 Ga0070688_100020095 3300005365 Bacteria 3878
32 Ga0070688_100217326 3300005365 Bacteria 1345
33 Ga0070659_100229637 3300005366 Bacteria 1533
34 Ga0070667_100000074 3300005367 Bacteria 121299
35 Ga0070667_100000819 3300005367 Bacteria 29020
36 Ga0070667_100005546 3300005367 Bacteria 10529
37 Ga0070667_100038684 3300005367 Bacteria 4000
38 Ga0070667_100048784 3300005367 Bacteria 3564
39 Ga0070667_100070012 3300005367 Bacteria 2986
40 Ga0070667_100206502 3300005367 Bacteria 1744
41 Ga0070714_100016514 3300005435 Bacteria 5964
42 Ga0070714_100092138 3300005435 Bacteria 2656
43 Ga0070713_100013669 3300005436 Bacteria 6000
44 Ga0070701_10010922 3300005438 Bacteria 4036
45 Ga0070711_100000479 3300005439 Bacteria 20826
46 Ga0070711_100046250 3300005439 Bacteria 2964
47 Ga0070705_100100131 3300005440 Bacteria 1828
48 Ga0070700_100013522 3300005441 Bacteria 4585
49 Ga0070694_100022680 3300005444 Bacteria 4025
50 Ga0070663_100003214 3300005455 Bacteria 9390
51 Ga0070678_100000595 3300005456 Bacteria 17762
52 Ga0070678_100010151 3300005456 Bacteria 5737
53 Ga0070678_100063757 3300005456 Bacteria 2728
54 Ga0070662_100012622 3300005457 Bacteria 5605
55 Ga0070662_100151791 3300005457 Bacteria 1804
56 Ga0068867_100001973 3300005459 Bacteria 14304
57 Ga0068867_100011061 3300005459 Bacteria 6365
58 Ga0070697_100305112 3300005536 Bacteria 1369
59 Ga0068853_100079851 3300005539 Bacteria 2861
60 Ga0068853_100334730 3300005539 Bacteria 1405
61 Ga0070696_100012568 3300005546 Bacteria 5685
62 Ga0070696_100057899 3300005546 Bacteria 2705
63 Ga0070696_100180892 3300005546 Bacteria 1564
64 Ga0070693_100029203 3300005547 Bacteria 3006
65 Ga0070693_100151159 3300005547 Bacteria 1471
66 Ga0070665_100003609 3300005548 Bacteria 16390
67 Ga0070665_100005707 3300005548 Bacteria 12778
68 Ga0070665_100286620 3300005548 Bacteria 1649
69 Ga0070704_100000666 3300005549 Bacteria 16615
70 Ga0068855_100305947 3300005563 Bacteria 1760
71 Ga0068854_100003429 3300005578 Bacteria 9883
72 Ga0068854_100068457 3300005578 Bacteria 2589
73 Ga0070702_100013285 3300005615 Bacteria 4154
74 Ga0068852_100025822 3300005616 Bacteria 4765
75 Ga0068852_100131202 3300005616 Bacteria 2308
76 Ga0068852_100288684 3300005616 Bacteria 1584
77 Ga0068859_100000567 3300005617 Bacteria 36774
78 Ga0068859_100089377 3300005617 Bacteria 3130
79 Ga0068859_100104384 3300005617 Bacteria 2893
80 Ga0068864_100149884 3300005618 Bacteria 2112
81 Ga0068864_100294245 3300005618 Bacteria 1518
82 Ga0068866_10001353 3300005718 Bacteria 10600
83 Ga0068866_10014282 3300005718 Bacteria 3503
84 Ga0068866_10048584 3300005718 Bacteria 2146
85 Ga0068861_100009323 3300005719 Bacteria 6774
86 Ga0068861_100033053 3300005719 Bacteria 3814
87 Ga0068861_100037442 3300005719 Bacteria 3606
88 Ga0068861_100115039 3300005719 Bacteria 2161
89 Ga0068861_100116822 3300005719 Bacteria 2146
90 Ga0068870_10199720 3300005840 Bacteria 1212
91 Ga0068863_100001963 3300005841 Bacteria 20438
92 Ga0068863_100002994 3300005841 Bacteria 16700
93 Ga0068863_100020977 3300005841 Bacteria 6241
94 Ga0068863_100381004 3300005841 Bacteria 1377
95 Ga0068858_100015481 3300005842 Bacteria 7172
96 Ga0068858_100186781 3300005842 Bacteria 1958
97 Ga0068858_100295206 3300005842 Bacteria 1545
98 Ga0068860_100000276 3300005843 Bacteria 74447
99 Ga0068860_100011255 3300005843 Bacteria 8817
100 Ga0068860_100096650 3300005843 Bacteria 2815
101 Ga0068860_100161095 3300005843 Bacteria 2163
102 Ga0068862_100000065 3300005844 Bacteria 124435
103 Ga0068862_100014128 3300005844 Bacteria 6621
104 Ga0068862_100080181 3300005844 Bacteria 2830
105 Ga0068862_100271605 3300005844 Bacteria 1551
106 Ga0081455_10028642 3300005937 Bacteria 5088
107 Ga0081455_10047021 3300005937 Bacteria 3740
108 Ga0081455_10057811 3300005937 Bacteria 3285
109 Ga0081538_10114330 3300005981 Bacteria 1315
110 Ga0075365_10004777 3300006038 Bacteria 7227
111 Ga0075365_10005852 3300006038 Bacteria 6686
112 Ga0075365_10035342 3300006038 Bacteria 3232
113 Ga0075368_10030780 3300006042 Bacteria 2079
114 Ga0075363_100000288 3300006048 Bacteria 14614
115 Ga0075363_100002561 3300006048 Bacteria 7472
116 Ga0075363_100004789 3300006048 Bacteria 5967
117 Ga0075363_100016783 3300006048 Bacteria 3620
118 Ga0075363_100021825 3300006048 Bacteria 3231
119 Ga0075363_100174617 3300006048 Bacteria 1221
120 Ga0075363_100189972 3300006048 Bacteria 1171
121 Ga0075364_10001329 3300006051 Bacteria 13298
122 Ga0075364_10003515 3300006051 Bacteria 8921
123 Ga0075364_10012633 3300006051 Bacteria 5172
124 Ga0075364_10015309 3300006051 Bacteria 4755
125 Ga0070715_10004540 3300006163 Bacteria 4567
126 Ga0070715_10089612 3300006163 Bacteria 1412
127 Ga0070716_100270296 3300006173 Bacteria 1168
128 Ga0075369_10001566 3300006186 Bacteria 7846
129 Ga0075369_10003619 3300006186 Bacteria 5642
130 Ga0075369_10010696 3300006186 Bacteria 3595
131 Ga0075369_10016833 3300006186 Bacteria 2956
132 Ga0075369_10031663 3300006186 Bacteria 2234
133 Ga0097621_100096848 3300006237 Bacteria 2476
134 Ga0075370_10006073 3300006353 Bacteria 6052
135 Ga0075370_10026266 3300006353 Bacteria 3225
136 Ga0075370_10084524 3300006353 Bacteria 1826
137 Ga0068871_100021812 3300006358 Bacteria 4929
138 Ga0075428_100096970 3300006844 Bacteria 3214
139 Ga0075430_100003713 3300006846 Bacteria 12831
140 Ga0068865_100004490 3300006881 Bacteria 8423
141 Ga0068865_100010272 3300006881 Bacteria 5823
142 Ga0068865_100075469 3300006881 Bacteria 2404
143 Ga0097620_100000567 3300006931 Bacteria 36774
144 Ga0097620_100089380 3300006931 Bacteria 3130
145 Ga0097620_100104382 3300006931 Bacteria 2893
146 Ga0099795_10024563 3300007788 Bacteria 2012
147 Ga0105240_10362074 3300009093 Bacteria 1642
148 Ga0111539_10254263 3300009094 Bacteria 2046
149 Ga0105245_10004418 3300009098 Bacteria 12440
150 Ga0105245_10027287 3300009098 Bacteria 5031
151 Ga0105245_10047008 3300009098 Bacteria 3858
152 Ga0105245_10121636 3300009098 Bacteria 2439
153 Ga0105247_10000017 3300009101 Bacteria 260438
154 Ga0105247_10002837 3300009101 Bacteria 11562
155 Ga0105247_10007735 3300009101 Bacteria 6577
156 Ga0105247_10012541 3300009101 Bacteria 5091
157 Ga0105247_10031858 3300009101 Bacteria 3201
158 Ga0114129_10042705 3300009147 Bacteria 6382
159 Ga0105241_10083795 3300009174 Bacteria 2502
160 Ga0105242_10001113 3300009176 Bacteria 21179
161 Ga0105242_10159454 3300009176 Bacteria 1973
162 Ga0105248_10000849 3300009177 Bacteria 34381
163 Ga0105248_10003348 3300009177 Bacteria 17817
164 Ga0105248_10015685 3300009177 Bacteria 8350
165 Ga0105248_10019251 3300009177 Bacteria 7553
166 Ga0105248_10024808 3300009177 Bacteria 6668
167 Ga0105248_10098526 3300009177 Bacteria 3293
168 Ga0105238_10066892 3300009551 Bacteria 3594
169 Ga0105249_10000096 3300009553 Bacteria 121083
170 Ga0105249_10001976 3300009553 Bacteria 17791
171 Ga0105249_10021366 3300009553 Bacteria 5794
172 Ga0105249_10504700 3300009553 Bacteria 1255
173 Ga0099796_10044303 3300010159 Bacteria 1519
174 Ga0105239_10009981 3300010375 Bacteria 10657
175 Ga0105239_10010576 3300010375 Bacteria 10315
176 Ga0105239_10053334 3300010375 Bacteria 4436
177 Ga0105239_10123927 3300010375 Bacteria 2871
178 Ga0105239_10128759 3300010375 Bacteria 2814
179 Ga0105239_10345408 3300010375 Bacteria 1680
180 Ga0157369_10240144 3300013105 Bacteria 1893
181 Ga0157374_10020714 3300013296 Bacteria 5838
182 Ga0157374_10124598 3300013296 Bacteria 2490
183 Ga0157374_10196180 3300013296 Bacteria 1976
184 Ga0157378_10009136 3300013297 Bacteria 8626
185 Ga0157378_10030415 3300013297 Bacteria 4772
186 Ga0157378_10201189 3300013297 Bacteria 1884
187 Ga0163162_10013602 3300013306 Bacteria 7950
188 Ga0163162_10031526 3300013306 Bacteria 5258
189 Ga0163162_10048516 3300013306 Bacteria 4255
190 Ga0163162_10066920 3300013306 Bacteria 3642
191 Ga0163162_10314316 3300013306 Bacteria 1699
192 Ga0157372_10007458 3300013307 Bacteria 11634
193 Ga0157372_10111308 3300013307 Bacteria 3137
194 Ga0157372_10267066 3300013307 Bacteria 1987
195 Ga0157372_10747585 3300013307 Bacteria 1137
196 Ga0157375_10012726 3300013308 Bacteria 7468
197 Ga0157375_10059931 3300013308 Bacteria 3773
198 Ga0157375_10708006 3300013308 Bacteria 1160
199 Ga0163163_10016950 3300014325 Bacteria 6782
200 Ga0163163_10072408 3300014325 Bacteria 3435
201 Ga0157380_10000771 3300014326 Bacteria 20026
202 Ga0157380_10038702 3300014326 Bacteria 3704
203 Ga0157380_10073612 3300014326 Bacteria 2771
204 Ga0157377_10028544 3300014745 Bacteria 3004
205 Ga0157379_10006231 3300014968 Bacteria 10271
206 Ga0157379_10014378 3300014968 Bacteria 6944
207 Ga0163161_10002358 3300017792 Bacteria 13536
208 Ga0163161_10049212 3300017792 Bacteria 3046
209 Ga0213876_10004977 3300021384 Bacteria 7345
210 Ga0213876_10016221 3300021384 Bacteria 3938
211 Ga0213876_10089655 3300021384 Bacteria 1629
212 Ga0209051_1000051 3300025303 Bacteria 283620
213 Ga0207697_10082121 3300025315 Bacteria 1358
214 Ga0207692_10031217 3300025898 Bacteria 2549
215 Ga0207692_10047737 3300025898 Bacteria 2151
216 Ga0207642_10000124 3300025899 Bacteria 21177
217 Ga0207642_10004529 3300025899 Bacteria 4489
218 Ga0207710_10000033 3300025900 Bacteria 260531
219 Ga0207710_10003442 3300025900 Bacteria 7059
220 Ga0207710_10006703 3300025900 Bacteria 4908
221 Ga0207710_10021356 3300025900 Bacteria 2774
222 Ga0207688_10002685 3300025901 Bacteria 9627
223 Ga0207688_10008511 3300025901 Bacteria 5585
224 Ga0207688_10122961 3300025901 Bacteria 1516
225 Ga0207680_10084105 3300025903 Bacteria 2007
226 Ga0207647_10014995 3300025904 Bacteria 5326
227 Ga0207647_10060212 3300025904 Bacteria 2321
228 Ga0207685_10006064 3300025905 Bacteria 3257
229 Ga0207685_10029080 3300025905 Bacteria 1953
230 Ga0207699_10254478 3300025906 Bacteria 1211
231 Ga0207645_10023243 3300025907 Bacteria 4029
232 Ga0207645_10170548 3300025907 Bacteria 1426
233 Ga0207643_10101699 3300025908 Bacteria 1686
234 Ga0207693_10001826 3300025915 Bacteria 18674
235 Ga0207693_10018382 3300025915 Bacteria 5568
236 Ga0207663_10002536 3300025916 Bacteria 8787
237 Ga0207663_10021386 3300025916 Bacteria 3682
238 Ga0207663_10093628 3300025916 Bacteria 2000
239 Ga0207662_10005313 3300025918 Bacteria 6849
240 Ga0207662_10027919 3300025918 Bacteria 3259
241 Ga0207657_10040977 3300025919 Bacteria 4099
242 Ga0207681_10000849 3300025923 Bacteria 20076
243 Ga0207681_10058079 3300025923 Bacteria 2647
244 Ga0207681_10079363 3300025923 Bacteria 2312
245 Ga0207694_10101613 3300025924 Bacteria 2279
246 Ga0207687_10003894 3300025927 Bacteria 10024
247 Ga0207687_10006582 3300025927 Bacteria 7663
248 Ga0207700_10054780 3300025928 Bacteria 2995
249 Ga0207664_10088444 3300025929 Bacteria 2535
250 Ga0207664_10208304 3300025929 Bacteria 1691
251 Ga0207664_10248421 3300025929 Bacteria 1552
252 Ga0207644_10002040 3300025931 Bacteria 13075
253 Ga0207644_10109696 3300025931 Bacteria 2085
254 Ga0207690_10142329 3300025932 Bacteria 1769
255 Ga0207690_10186659 3300025932 Bacteria 1565
256 Ga0207706_10005962 3300025933 Bacteria 11336
257 Ga0207706_10007441 3300025933 Bacteria 10127
258 Ga0207686_10006545 3300025934 Bacteria 6273
259 Ga0207686_10063612 3300025934 Bacteria 2347
260 Ga0207709_10006328 3300025935 Bacteria 6646
261 Ga0207669_10001327 3300025937 Bacteria 10535
262 Ga0207669_10002064 3300025937 Bacteria 8507
263 Ga0207669_10017133 3300025937 Bacteria 3706
264 Ga0207669_10091587 3300025937 Bacteria 1981
265 Ga0207704_10000291 3300025938 Bacteria 23769
266 Ga0207704_10012701 3300025938 Bacteria 4185
267 Ga0207704_10013973 3300025938 Bacteria 4040
268 Ga0207704_10069343 3300025938 Bacteria 2227
269 Ga0207704_10229532 3300025938 Bacteria 1379
270 Ga0207665_10001751 3300025939 Bacteria 14560
271 Ga0207665_10009444 3300025939 Bacteria 6401
272 Ga0207665_10232623 3300025939 Bacteria 1355
273 Ga0207691_10054294 3300025940 Bacteria 3655
274 Ga0207711_10000661 3300025941 Bacteria 34348
275 Ga0207711_10022005 3300025941 Bacteria 5327
276 Ga0207711_10078440 3300025941 Bacteria 2881
277 Ga0207711_10087903 3300025941 Bacteria 2728
278 Ga0207689_10011177 3300025942 Bacteria 7703
279 Ga0207689_10019152 3300025942 Bacteria 5770
280 Ga0207689_10037450 3300025942 Bacteria 4023
281 Ga0207667_10153951 3300025949 Bacteria 2366
282 Ga0207651_10314517 3300025960 Bacteria 1307
283 Ga0207712_10000005 3300025961 Bacteria 608697
284 Ga0207712_10005062 3300025961 Bacteria 8346
285 Ga0207712_10066011 3300025961 Bacteria 2585
286 Ga0207668_10003268 3300025972 Bacteria 9504
287 Ga0207668_10053615 3300025972 Bacteria 2795
288 Ga0207668_10122312 3300025972 Bacteria 1973
289 Ga0207668_10165121 3300025972 Bacteria 1730
290 Ga0207668_10247697 3300025972 Bacteria 1445
291 Ga0207668_10334802 3300025972 Bacteria 1260
292 Ga0207640_10005157 3300025981 Bacteria 7105
293 Ga0207640_10012242 3300025981 Bacteria 4882
294 Ga0207640_10023783 3300025981 Bacteria 3687
295 Ga0207658_10000321 3300025986 Bacteria 48316
296 Ga0207658_10000743 3300025986 Bacteria 28083
297 Ga0207658_10002978 3300025986 Bacteria 12110
298 Ga0207658_10014287 3300025986 Bacteria 5437
299 Ga0207658_10029027 3300025986 Bacteria 3901
300 Ga0207658_10049977 3300025986 Bacteria 3075
301 Ga0207658_10210426 3300025986 Bacteria 1629
302 Ga0207677_10005648 3300026023 Bacteria 6802
303 Ga0207677_10070154 3300026023 Bacteria 2468
304 Ga0207677_10107477 3300026023 Bacteria 2069
305 Ga0207677_10228607 3300026023 Bacteria 1497
306 Ga0207703_10010452 3300026035 Bacteria 7258
307 Ga0207703_10076965 3300026035 Bacteria 2768
308 Ga0207703_10139183 3300026035 Bacteria 2105
309 Ga0207703_10177155 3300026035 Bacteria 1879
310 Ga0207639_10002547 3300026041 Bacteria 12235
311 Ga0207639_10086487 3300026041 Bacteria 2496
312 Ga0207678_10008103 3300026067 Bacteria 9266
313 Ga0207678_10011314 3300026067 Bacteria 7831
314 Ga0207678_10023448 3300026067 Bacteria 5398
315 Ga0207678_10232424 3300026067 Bacteria 1579
316 Ga0207708_10002264 3300026075 Bacteria 14185
317 Ga0207702_10086975 3300026078 Bacteria 2727
318 Ga0207641_10001342 3300026088 Bacteria 24372
319 Ga0207641_10005082 3300026088 Bacteria 11277
320 Ga0207641_10256282 3300026088 Bacteria 1636
321 Ga0207648_10002008 3300026089 Bacteria 22201
322 Ga0207648_10159828 3300026089 Bacteria 1990
323 Ga0207675_100003453 3300026118 Bacteria 15445
324 Ga0207675_100003650 3300026118 Bacteria 14998
325 Ga0207675_100041689 3300026118 Bacteria 4286
326 Ga0207675_100051444 3300026118 Bacteria 3844
327 Ga0207675_100196042 3300026118 Bacteria 1938
328 Ga0207675_100259950 3300026118 Bacteria 1682
329 Ga0207683_10003523 3300026121 Bacteria 13651
330 Ga0207683_10073010 3300026121 Bacteria 3035
331 Ga0207683_10085918 3300026121 Bacteria 2797
332 Ga0207698_10010560 3300026142 Bacteria 5944
333 Ga0207698_10063478 3300026142 Bacteria 2891
334 Ga0207698_10212030 3300026142 Bacteria 1743
335 Ga0268266_10002162 3300028379 Bacteria 21575
336 Ga0268266_10014326 3300028379 Bacteria 6818
337 Ga0268266_10042535 3300028379 Bacteria 3881
338 Ga0268265_10000022 3300028380 Bacteria 270788
339 Ga0268265_10055693 3300028380 Bacteria 3005
340 Ga0268265_10065580 3300028380 Bacteria 2803
341 Ga0268265_10102008 3300028380 Bacteria 2319
342 Ga0268265_10104994 3300028380 Bacteria 2291
343 Ga0268264_10000005 3300028381 Bacteria 934972
344 Ga0268264_10002955 3300028381 Bacteria 14764
345 Ga0268264_10074422 3300028381 Bacteria 2885
346 Ga0268264_10095476 3300028381 Bacteria 2573
347 Ga0265327_10005197 3300031251 Bacteria 11000
348 Ga0307410_10022955 3300031852 Bacteria 3868
349 Ga0307409_100055133 3300031995 Bacteria 3067
350 Ga0307416_100090236 3300032002 Bacteria 2627
351 Ga0307414_10110941 3300032004 Bacteria 2088
352 Ga0373938_0022222 3300034957 Bacteria 1294
353 Ga0373940_0040709 3300035088 Bacteria 1276
354 Ga0373952_0030916 3300035092 Bacteria 1188
355 Ga0373932_0018190 3300035112 Bacteria 1814
356 Ga0373939_0007230 3300035114 Bacteria 2694
357 Ga0373960_0015951 3300035121 Bacteria 1926
358 Ga0373962_0051657 3300035242 Bacteria 1186
359 Ga0373931_0023757 3300035691 Bacteria 3097
360 Ga0436364_0166911 3300037853 Bacteria 14228
361 Ga0436364_0255571 3300037853 Bacteria 10196
362 Ga0436364_1311241 3300037853 Bacteria 1478
363 Ga0436365_0200358 3300039437 Bacteria 1933
364 Ga0436365_0484364 3300039437 Bacteria 53953
365 Ga0436365_0790831 3300039437 Bacteria 15194
366 Ga0436365_0818913 3300039437 Bacteria 6536
367 Ga0439466_0061507 3300041411 Bacteria 1208
368 Ga0439465_0000060 3300041413 Bacteria 23285
369 Ga0439465_0016772 3300041413 Bacteria 2285
370 Ga0451853_0790618 3300041512 Bacteria 1530
371 Ga0439431_0003250 3300041997 Bacteria 3576
372 Ga0439445_0001642 3300042004 Bacteria 4897
373 Ga0439448_0001700 3300042005 Bacteria 5793
374 Ga0439434_0007526 3300042435 Bacteria 3191
375 Ga0439434_0027662 3300042435 Bacteria 1715
376 Ga0466969_0017537 3300044656 Bacteria 3736
377 Ga0466972_0025748 3300044658 Bacteria 2914
378 Ga0466965_0010739 3300044683 Bacteria 4281
379 Ga0466965_0013560 3300044683 Bacteria 3847
380 Ga0466965_0054711 3300044683 Bacteria 1985
381 Ga0466966_0007209 3300044684 Bacteria 7371
382 Ga0466966_0069996 3300044684 Bacteria 2200
383 Ga0466966_0113204 3300044684 Bacteria 1671
384 Ga0466966_0118801 3300044684 Bacteria 1625
385 Ga0466961_0000574 3300044693 Bacteria 23346
386 Ga0466961_0003256 3300044693 Bacteria 10107
387 Ga0466963_0000149 3300044694 Bacteria 27892
388 Ga0466963_0002039 3300044694 Bacteria 11121
389 Ga0466971_0001937 3300044719 Bacteria 8782
390 Ga0466971_0010315 3300044719 Bacteria 4081
391 Ga0466971_0054127 3300044719 Bacteria 1808
392 Ga0466968_0000969 3300044735 Bacteria 10088
393 Ga0466968_0023062 3300044735 Bacteria 2534
394 Ga0466968_0023100 3300044735 Bacteria 2531
395 Ga0466968_0044461 3300044735 Bacteria 1882
396 Ga0466970_0012473 3300044765 Bacteria 4346
397 Ga0466970_0021984 3300044765 Bacteria 3328
398 Ga0466957_0001716 3300044842 Bacteria 11531
399 Ga0466960_0000298 3300044901 Bacteria 17254
400 Ga0466960_0000457 3300044901 Bacteria 13982
401 Ga0466960_0004198 3300044901 Bacteria 5600
402 Ga0466959_0006355 3300045049 Bacteria 8177
403 Ga0466959_0037964 3300045049 Bacteria 3560
404 Ga0466959_0051753 3300045049 Bacteria 3010
405 Ga0466958_0009576 3300045836 Bacteria 5403
406 Ga0466958_0037843 3300045836 Bacteria 2892
407 Ga0466967_0001069 3300045976 Bacteria 15118
408 Ga0466967_0004355 3300045976 Bacteria 9530
409 Ga0466967_0019670 3300045976 Bacteria 5437
410 Ga0466967_0124981 3300045976 Bacteria 2382
411 Ga0466967_0175167 3300045976 Bacteria 2021
412 Ga0495629_0017955 3300046459 Bacteria 5071
413 Ga0495638_0006500 3300046460 Bacteria 8500
414 Ga0495638_0036648 3300046460 Bacteria 3123
415 Ga0495641_0006709 3300046461 Bacteria 7397
416 Ga0495641_0075763 3300046461 Bacteria 1508
417 Ga0495594_0070383 3300046499 Bacteria 1945
418 Ga0495630_0129607 3300046517 Bacteria 1915
419 Ga0495648_0018611 3300046524 Bacteria 4909
420 Ga0495652_0147064 3300046529 Bacteria 1846
421 Ga0495654_0079693 3300046530 Bacteria 1538
422 Ga0495665_0034359 3300046531 Bacteria 2711
423 Ga0495611_0034171 3300046648 Bacteria 2247
424 Ga0495613_0178529 3300046689 Bacteria 1504
425 Ga0495671_0063697 3300046692 Bacteria 1816
426 Ga0495649_0114982 3300046694 Bacteria 1425
427 Ga0495581_0012422 3300047315 Bacteria 4933
428 Ga0495604_0041713 3300047317 Bacteria 3598
429 Ga0495674_0031488 3300047319 Bacteria 4819
430 Ga0495672_0004144 3300047320 Bacteria 12050
431 Ga0495672_0022122 3300047320 Bacteria 4138
432 Ga0495672_0179321 3300047320 Bacteria 1074
433 Ga0495676_0185699 3300047321 Bacteria 1454
434 Ga0495683_0001402 3300047323 Bacteria 15917
435 Ga0495675_0004548 3300047444 Bacteria 8406
436 Ga0495673_0002432 3300047469 Bacteria 13116
437 Ga0496100_0000212 3300048903 Bacteria 32179
438 Ga0496100_0005227 3300048903 Bacteria 6972
439 Ga0496100_0006724 3300048903 Bacteria 6296
440 Ga0496100_0009399 3300048903 Bacteria 5496
441 Ga0496100_0057022 3300048903 Bacteria 2557
442 Ga0496100_0088963 3300048903 Bacteria 2103
443 Ga0496101_0000020 3300048904 Bacteria 218859
444 Ga0496101_0000075 3300048904 Bacteria 112785
445 Ga0496101_0000310 3300048904 Bacteria 33833
446 Ga0496101_0001415 3300048904 Bacteria 14347
447 Ga0496101_0026246 3300048904 Bacteria 4050
448 Ga0496101_0041333 3300048904 Bacteria 3287
449 Ga0496101_0043559 3300048904 Bacteria 3208
450 Ga0496101_0059960 3300048904 Bacteria 2759
451 Ga0496101_0105590 3300048904 Bacteria 2114
452 Ga0496102_0000003 3300048905 Bacteria 592263
453 Ga0496102_0000415 3300048905 Bacteria 49294
454 Ga0496102_0004064 3300048905 Bacteria 12406
455 Ga0496102_0004363 3300048905 Bacteria 11952
456 Ga0496102_0060517 3300048905 Bacteria 3463
457 Ga0496102_0327726 3300048905 Bacteria 1442
458 Ga0496102_0332709 3300048905 Bacteria 1430
459 Ga0496103_0000014 3300048906 Bacteria 290397
460 Ga0496103_0000093 3300048906 Bacteria 100010
461 Ga0496103_0000512 3300048906 Bacteria 31958
462 Ga0496103_0009139 3300048906 Bacteria 5869
463 Ga0496103_0011056 3300048906 Bacteria 5344
464 Ga0496103_0048073 3300048906 Bacteria 2636
465 Ga0496103_0049761 3300048906 Bacteria 2592
466 Ga0496103_0049985 3300048906 Bacteria 2586
467 Ga0496104_0004308 3300048907 Bacteria 12375
468 Ga0496105_0057576 3300048908 Bacteria 3209
469 Ga0496105_0076631 3300048908 Bacteria 2761
470 Ga0496105_0236676 3300048908 Bacteria 1483
471 Ga0496105_0255008 3300048908 Bacteria 1420
472 Ga0496106_0001024 3300048909 Bacteria 20542
473 Ga0496106_0001954 3300048909 Bacteria 15482
474 Ga0496106_0011011 3300048909 Bacteria 6685
475 Ga0496106_0035640 3300048909 Bacteria 3720
476 Ga0496106_0086509 3300048909 Bacteria 2414
477 Ga0496106_0092960 3300048909 Bacteria 2330
478 Ga0496106_0196793 3300048909 Bacteria 1603
479 Ga0496106_0242942 3300048909 Bacteria 1439
480 Ga0496107_0002866 3300048910 Bacteria 11401
481 Ga0496107_0005122 3300048910 Bacteria 8940
482 Ga0496107_0005597 3300048910 Bacteria 8604
483 Ga0496107_0011433 3300048910 Bacteria 6183
484 Ga0496107_0028877 3300048910 Bacteria 3944
485 Ga0496107_0030229 3300048910 Bacteria 3860
486 Ga0496107_0038963 3300048910 Bacteria 3409
487 Ga0496107_0274080 3300048910 Bacteria 1256
488 Ga0496108_0000405 3300048911 Bacteria 35593
489 Ga0496108_0001278 3300048911 Bacteria 19703
490 Ga0496108_0009737 3300048911 Bacteria 7787
491 Ga0496108_0020334 3300048911 Bacteria 5457
492 Ga0496108_0055522 3300048911 Bacteria 3326
493 Ga0496108_0063089 3300048911 Bacteria 3120
494 Ga0496109_0002338 3300048912 Bacteria 15809
495 Ga0496109_0081314 3300048912 Bacteria 2985
496 Ga0496109_0084265 3300048912 Bacteria 2932
497 Ga0496110_0013722 3300048913 Bacteria 6712
498 Ga0496110_0019778 3300048913 Bacteria 5672
499 Ga0496110_0121966 3300048913 Bacteria 2349
500 Ga0496110_0150566 3300048913 Bacteria 2107
501 Ga0496110_0488440 3300048913 Bacteria 1122
502 Ga0496111_0138468 3300048914 Bacteria 1803
503 Ga0496111_0185588 3300048914 Bacteria 1546
504 Ga0496112_0003670 3300048915 Bacteria 12794
505 Ga0496112_0019065 3300048915 Bacteria 6467
506 Ga0496112_0041498 3300048915 Bacteria 4503
507 Ga0496112_0078708 3300048915 Bacteria 3260
508 Ga0496112_0161744 3300048915 Bacteria 2205
509 Ga0496112_0223853 3300048915 Bacteria 1837
510 Ga0496113_0001800 3300048916 Bacteria 12155
511 Ga0496113_0066152 3300048916 Bacteria 2737
512 Ga0496114_0000181 3300048917 Bacteria 45025
513 Ga0496114_0002320 3300048917 Bacteria 14494
514 Ga0496114_0004074 3300048917 Bacteria 11288
515 Ga0496114_0023224 3300048917 Bacteria 5059
516 Ga0496115_0005302 3300048918 Bacteria 9378
517 Ga0496115_0009311 3300048918 Bacteria 7298
518 Ga0496115_0109886 3300048918 Bacteria 2264
519 Ga0496116_0000071 3300048919 Bacteria 244521
520 Ga0496116_0004420 3300048919 Bacteria 13422
521 Ga0496117_0000003 3300048920 Bacteria 1881097
522 Ga0496117_0021358 3300048920 Bacteria 5240
523 Ga0496117_0076871 3300048920 Bacteria 2211
524 Ga0496118_0000001 3300048921 Bacteria 1881100
525 Ga0496118_0000359 3300048921 Bacteria 77146
526 Ga0496118_0000488 3300048921 Bacteria 65611
527 Ga0496118_0004501 3300048921 Bacteria 16481
528 Ga0496119_0000266 3300048922 Bacteria 74075
529 Ga0496119_0002301 3300048922 Bacteria 21118
530 Ga0496119_0002624 3300048922 Bacteria 19518
531 Ga0496120_0000235 3300048923 Bacteria 94653
532 Ga0496120_0001188 3300048923 Bacteria 33095
533 Ga0496121_0000002 3300048924 Bacteria 1494588
534 Ga0496121_0000019 3300048924 Bacteria 499976
535 Ga0496121_0007092 3300048924 Bacteria 13602
536 Ga0496122_0000312 3300048925 Bacteria 107109
537 Ga0496122_0017076 3300048925 Bacteria 6810
538 Ga0496123_0003426 3300048926 Bacteria 17817
539 Ga0496123_0010722 3300048926 Bacteria 8052
540 Ga0496124_0000002 3300048927 Bacteria 1494588
541 Ga0496124_0008699 3300048927 Bacteria 10555
542 Ga0496125_0000002 3300048928 Bacteria 1480920
543 Ga0496125_0027604 3300048928 Bacteria 5143
544 Ga0496125_0061113 3300048928 Bacteria 3023
545 Ga0496126_0000011 3300048929 Bacteria 744275
546 Ga0496126_0000951 3300048929 Bacteria 49637
547 Ga0496126_0003151 3300048929 Bacteria 21253
548 Ga0496126_0003649 3300048929 Bacteria 19231
549 Ga0496126_0268165 3300048929 Bacteria 1417
550 Ga0501032_0000469 3300049569 Bacteria 32526
551 Ga0501032_0021556 3300049569 Bacteria 4478
552 Ga0501034_0009642 3300049571 Bacteria 10098
553 Ga0501034_0011897 3300049571 Bacteria 9002
554 Ga0501036_0016952 3300049572 Bacteria 6086
555 Ga0501037_0000234 3300049573 Bacteria 47815
556 Ga0501038_0004555 3300049574 Bacteria 12897
557 Ga0501039_0000113 3300049575 Bacteria 54895
558 Ga0501043_0000082 3300049579 Bacteria 84442
559 Ga0501047_0008566 3300049581 Bacteria 9652
560 Ga0501047_0097938 3300049581 Bacteria 2811
561 Ga0501070_0001505 3300049586 Bacteria 20787
562 Ga0501070_0029564 3300049586 Bacteria 4593
563 Ga0501080_0138139 3300049742 Bacteria 2254
564 Ga0501035_0056811 3300049822 Bacteria 3490
565 Ga0501044_0003845 3300049823 Bacteria 16843
566 nmdc:mga03683_29631_c1 3300050489 Bacteria 2183
567 nmdc:mga03n38_10904_c1 3300050490 Bacteria 3366
568 nmdc:mga03n38_126601_c1 3300050490 Bacteria 1261
569 nmdc:mga03n38_13589_c1 3300050490 Bacteria 3098
570 nmdc:mga03n38_16498_c1 3300050490 Bacteria 2873
571 nmdc:mga03n38_361_c1 3300050490 Bacteria 11123
572 nmdc:mga03n38_435_c1 3300050490 Bacteria 10412
573 nmdc:mga03n38_53162_c1 3300050490 Bacteria 1815
574 nmdc:mga00v17_27848_c1 3300050491 Bacteria 3303
575 nmdc:mga00v17_5879_c1 3300050491 Bacteria 6479
576 nmdc:mga00v17_6485_c1 3300050491 Bacteria 6210
577 nmdc:mga0yw44_26928_c1 3300050492 Bacteria 3288
578 nmdc:mga0yw44_512_c1 3300050492 Bacteria 13855
579 nmdc:mga0k408_38942_c1 3300050493 Bacteria 2729
580 nmdc:mga06z11_33799_c1 3300050494 Bacteria 2504
581 nmdc:mga07m45_1418_c1 3300050496 Bacteria 10985
582 nmdc:mga07m45_70652_c1 3300050496 Bacteria 1986
583 nmdc:mga05p37_28521_c1 3300050507 Bacteria 6806
584 nmdc:mga0qj67_41963_c1 3300050509 Bacteria 3600
585 nmdc:mga0sz30_11029_c1 3300050516 Bacteria 3476
586 nmdc:mga0sz30_12864_c1 3300050516 Bacteria 3264
587 nmdc:mga0sz30_1921_c1 3300050516 Bacteria 7424
588 nmdc:mga0sz30_3093_c1 3300050516 Bacteria 5963
589 Ga0500610_0006674 3300053079 Bacteria 4864
590 Ga0500635_0012608 3300053080 Bacteria 2432
591 Ga0500635_0018800 3300053080 Bacteria 2092
592 Ga0495655_0007628 3300053083 Bacteria 2020
593 Ga0500643_003479 3300053087 Bacteria 7573
594 Ga0500646_0034793 3300053090 Bacteria 1398
595 Ga0500650_0102349 3300053098 Bacteria 1340
596 Ga0500556_0006131 3300053104 Bacteria 3409
597 Ga0500556_0089210 3300053104 Bacteria 1175
598 Ga0500562_015944 3300053108 Bacteria 1930
599 Ga0500652_009892 3300053131 Bacteria 3245
600 Ga0500652_070942 3300053131 Bacteria 1443
601 Ga0500559_0052838 3300053136 Bacteria 1797
602 Ga0500577_0016682 3300053142 Bacteria 2322
603 Ga0500645_000438 3300053730 Bacteria 28443
604 Ga0466962_0014254 3300061719 Bacteria 3830
605 Ga0466962_0034106 3300061719 Bacteria 2435

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_0105590 Ga0496101_0105590_17_889 290
2 3300021384 Ga0213876_10016221 Ga0213876_100162212 297
3 3300047317 Ga0495604_0041713 Ga0495604_0041713_2627_3532 300
4 3300061719 Ga0466962_0014254 Ga0466962_0014254_12_917 301
5 3300039437 Ga0436365_0818913 Ga0436365_0818913_3472_4404 306
6 3300025315 Ga0207697_10082121 Ga0207697_100821211 308
7 3300035088 Ga0373940_0040709 Ga0373940_0040709_16_993 325
8 3300053104 Ga0500556_0089210 Ga0500556_0089210_11_1024 325
9 3300005347 Ga0070668_100016794 Ga0070668_1000167946 332
10 3300009553 Ga0105249_10504700 Ga0105249_105047001 332
11 3300013296 Ga0157374_10196180 Ga0157374_101961802 332
12 3300021384 Ga0213876_10004977 Ga0213876_100049778 332
13 3300025972 Ga0207668_10334802 Ga0207668_103348022 332
14 3300039437 Ga0436365_0790831 Ga0436365_0790831_8066_9100 332
15 3300044658 Ga0466972_0025748 Ga0466972_0025748_1092_2090 332
16 3300044683 Ga0466965_0010739 Ga0466965_0010739_480_1478 332
17 3300044684 Ga0466966_0118801 Ga0466966_0118801_326_1324 332
18 3300044719 Ga0466971_0054127 Ga0466971_0054127_574_1572 332
19 3300044735 Ga0466968_0044461 Ga0466968_0044461_687_1685 332
20 3300046460 Ga0495638_0006500 Ga0495638_0006500_1473_2498 332
21 3300048906 Ga0496103_0009139 Ga0496103_0009139_312_1310 332
22 3300048909 Ga0496106_0196793 Ga0496106_0196793_11_1009 332
23 3300053079 Ga0500610_0006674 Ga0500610_0006674_648_1673 332
24 3300053104 Ga0500556_0006131 Ga0500556_0006131_1251_2276 332
25 3300053108 Ga0500562_015944 Ga0500562_015944_142_1191 332
26 3300053142 Ga0500577_0016682 Ga0500577_0016682_894_1919 332
27 3300061719 Ga0466962_0034106 Ga0466962_0034106_1351_2349 332
28 iso_pu_bacteria 2929212328 2929213795 332
29 iso_pu_bacteria 2643221692 2644517968 333
30 iso_pu_bacteria 2842134933 2842140435 333
31 3300005337 Ga0070682_100045049 Ga0070682_1000450492 335
32 3300005367 Ga0070667_100038684 Ga0070667_1000386842 335
33 3300005719 Ga0068861_100115039 Ga0068861_1001150391 335
34 3300005841 Ga0068863_100020977 Ga0068863_1000209775 335
35 3300005937 Ga0081455_10028642 Ga0081455_100286427 335
36 3300005981 Ga0081538_10114330 Ga0081538_101143301 335
37 3300006038 Ga0075365_10004777 Ga0075365_100047773 335
38 3300006048 Ga0075363_100002561 Ga0075363_1000025615 335
39 3300010375 Ga0105239_10345408 Ga0105239_103454082 335
40 3300025934 Ga0207686_10063612 Ga0207686_100636123 335
41 3300025937 Ga0207669_10091587 Ga0207669_100915872 335
42 3300025941 Ga0207711_10078440 Ga0207711_100784402 335
43 3300025961 Ga0207712_10066011 Ga0207712_100660113 335
44 3300025986 Ga0207658_10210426 Ga0207658_102104262 335
45 3300026067 Ga0207678_10232424 Ga0207678_102324242 335
46 3300026088 Ga0207641_10256282 Ga0207641_102562822 335
47 3300044656 Ga0466969_0017537 Ga0466969_0017537_28_1044 335
48 3300044683 Ga0466965_0013560 Ga0466965_0013560_1741_2757 335
49 3300044684 Ga0466966_0007209 Ga0466966_0007209_1078_2094 335
50 3300044693 Ga0466961_0000574 Ga0466961_0000574_13617_14633 335
51 3300044694 Ga0466963_0000149 Ga0466963_0000149_3742_4758 335
52 3300044719 Ga0466971_0001937 Ga0466971_0001937_2823_3839 335
53 3300044735 Ga0466968_0000969 Ga0466968_0000969_2745_3758 335
54 3300044765 Ga0466970_0012473 Ga0466970_0012473_706_1719 335
55 3300044765 Ga0466970_0021984 Ga0466970_0021984_2231_3247 335
56 3300044842 Ga0466957_0001716 Ga0466957_0001716_9438_10454 335
57 3300044901 Ga0466960_0000457 Ga0466960_0000457_529_1542 335
58 3300045049 Ga0466959_0006355 Ga0466959_0006355_1078_2094 335
59 3300045049 Ga0466959_0051753 Ga0466959_0051753_1544_2551 335
60 3300045836 Ga0466958_0009576 Ga0466958_0009576_4217_5233 335
61 3300045976 Ga0466967_0019670 Ga0466967_0019670_3253_4266 335
62 3300047321 Ga0495676_0185699 Ga0495676_0185699_197_1204 335
63 3300048903 Ga0496100_0088963 Ga0496100_0088963_407_1426 335
64 3300048906 Ga0496103_0048073 Ga0496103_0048073_1617_2624 335
65 3300048911 Ga0496108_0055522 Ga0496108_0055522_1700_2707 335
66 3300048912 Ga0496109_0084265 Ga0496109_0084265_1383_2390 335
67 3300048914 Ga0496111_0185588 Ga0496111_0185588_430_1437 335
68 3300048915 Ga0496112_0019065 Ga0496112_0019065_5026_6045 335
69 3300048915 Ga0496112_0161744 Ga0496112_0161744_668_1675 335
70 3300048916 Ga0496113_0001800 Ga0496113_0001800_9882_10901 335
71 3300048916 Ga0496113_0066152 Ga0496113_0066152_958_1965 335
72 3300048925 Ga0496122_0017076 Ga0496122_0017076_1933_2952 335
73 3300048926 Ga0496123_0010722 Ga0496123_0010722_2938_3957 335
74 3300048929 Ga0496126_0268165 Ga0496126_0268165_289_1308 335
75 3300050490 nmdc:mga03n38_10904_c1 nmdc:mga03n38_10904_c1_1596_2603 335
76 iso_pu_bacteria 2643221715 2644635718 335
77 iso_pu_bacteria 2738541264 2738664281 335
78 iso_pu_bacteria 2738541356 2739143416 335
79 iso_pu_bacteria 2919713450 2919715092 335
80 3300002077 JGI24744J21845_10003176 JGI24744J21845_100031763 336
81 3300002244 JGI24742J22300_10007986 JGI24742J22300_100079862 336
82 3300005328 Ga0070676_10078486 Ga0070676_100784862 336
83 3300005334 Ga0068869_100131023 Ga0068869_1001310232 336
84 3300005337 Ga0070682_100112696 Ga0070682_1001126962 336
85 3300005340 Ga0070689_100013931 Ga0070689_1000139315 336
86 3300005341 Ga0070691_10037706 Ga0070691_100377062 336
87 3300005365 Ga0070688_100020095 Ga0070688_1000200952 336
88 3300005366 Ga0070659_100229637 Ga0070659_1002296372 336
89 3300005367 Ga0070667_100206502 Ga0070667_1002065022 336
90 3300005438 Ga0070701_10010922 Ga0070701_100109222 336
91 3300005439 Ga0070711_100046250 Ga0070711_1000462501 336
92 3300005456 Ga0070678_100063757 Ga0070678_1000637572 336
93 3300005459 Ga0068867_100011061 Ga0068867_1000110613 336
94 3300005539 Ga0068853_100334730 Ga0068853_1003347302 336
95 3300005546 Ga0070696_100057899 Ga0070696_1000578992 336
96 3300005547 Ga0070693_100151159 Ga0070693_1001511592 336
97 3300005563 Ga0068855_100305947 Ga0068855_1003059472 336
98 3300005616 Ga0068852_100025822 Ga0068852_1000258222 336
99 3300005617 Ga0068859_100104384 Ga0068859_1001043842 336
100 3300005718 Ga0068866_10014282 Ga0068866_100142822 336
101 3300005840 Ga0068870_10199720 Ga0068870_101997202 336
102 3300005842 Ga0068858_100295206 Ga0068858_1002952062 336
103 3300005843 Ga0068860_100161095 Ga0068860_1001610952 336
104 3300005844 Ga0068862_100080181 Ga0068862_1000801812 336
105 3300006038 Ga0075365_10005852 Ga0075365_100058526 336
106 3300006042 Ga0075368_10030780 Ga0075368_100307803 336
107 3300006048 Ga0075363_100000288 Ga0075363_10000028812 336
108 3300006048 Ga0075363_100016783 Ga0075363_1000167833 336
109 3300006048 Ga0075363_100021825 Ga0075363_1000218252 336
110 3300006051 Ga0075364_10003515 Ga0075364_100035156 336
111 3300006051 Ga0075364_10012633 Ga0075364_100126336 336
112 3300006051 Ga0075364_10015309 Ga0075364_100153092 336
113 3300006163 Ga0070715_10089612 Ga0070715_100896122 336
114 3300006186 Ga0075369_10001566 Ga0075369_100015663 336
115 3300006186 Ga0075369_10003619 Ga0075369_100036194 336
116 3300006186 Ga0075369_10016833 Ga0075369_100168332 336
117 3300006237 Ga0097621_100096848 Ga0097621_1000968483 336
118 3300006353 Ga0075370_10006073 Ga0075370_100060733 336
119 3300006844 Ga0075428_100096970 Ga0075428_1000969704 336
120 3300006846 Ga0075430_100003713 Ga0075430_1000037134 336
121 3300006931 Ga0097620_100104382 Ga0097620_1001043822 336
122 3300007788 Ga0099795_10024563 Ga0099795_100245631 336
123 3300009093 Ga0105240_10362074 Ga0105240_103620742 336
124 3300009098 Ga0105245_10027287 Ga0105245_100272873 336
125 3300009101 Ga0105247_10031858 Ga0105247_100318583 336
126 3300009147 Ga0114129_10042705 Ga0114129_100427054 336
127 3300009177 Ga0105248_10015685 Ga0105248_100156854 336
128 3300010159 Ga0099796_10044303 Ga0099796_100443032 336
129 3300010375 Ga0105239_10053334 Ga0105239_100533343 336
130 3300013105 Ga0157369_10240144 Ga0157369_102401442 336
131 3300013306 Ga0163162_10066920 Ga0163162_100669203 336
132 3300013307 Ga0157372_10747585 Ga0157372_107475852 336
133 3300014326 Ga0157380_10038702 Ga0157380_100387022 336
134 3300014968 Ga0157379_10014378 Ga0157379_100143787 336
135 3300017792 Ga0163161_10049212 Ga0163161_100492122 336
136 3300021384 Ga0213876_10089655 Ga0213876_100896552 336
137 3300025898 Ga0207692_10031217 Ga0207692_100312173 336
138 3300025899 Ga0207642_10004529 Ga0207642_100045292 336
139 3300025900 Ga0207710_10021356 Ga0207710_100213563 336
140 3300025901 Ga0207688_10122961 Ga0207688_101229612 336
141 3300025903 Ga0207680_10084105 Ga0207680_100841052 336
142 3300025904 Ga0207647_10014995 Ga0207647_100149952 336
143 3300025907 Ga0207645_10023243 Ga0207645_100232432 336
144 3300025908 Ga0207643_10101699 Ga0207643_101016991 336
145 3300025916 Ga0207663_10021386 Ga0207663_100213863 336
146 3300025918 Ga0207662_10027919 Ga0207662_100279193 336
147 3300025919 Ga0207657_10040977 Ga0207657_100409773 336
148 3300025923 Ga0207681_10058079 Ga0207681_100580792 336
149 3300025924 Ga0207694_10101613 Ga0207694_101016132 336
150 3300025927 Ga0207687_10006582 Ga0207687_100065827 336
151 3300025929 Ga0207664_10208304 Ga0207664_102083042 336
152 3300025931 Ga0207644_10109696 Ga0207644_101096962 336
153 3300025932 Ga0207690_10142329 Ga0207690_101423292 336
154 3300025933 Ga0207706_10007441 Ga0207706_1000744110 336
155 3300025934 Ga0207686_10006545 Ga0207686_100065454 336
156 3300025937 Ga0207669_10001327 Ga0207669_100013277 336
157 3300025938 Ga0207704_10012701 Ga0207704_100127013 336
158 3300025938 Ga0207704_10069343 Ga0207704_100693431 336
159 3300025939 Ga0207665_10009444 Ga0207665_100094442 336
160 3300025941 Ga0207711_10022005 Ga0207711_100220054 336
161 3300025942 Ga0207689_10037450 Ga0207689_100374502 336
162 3300025949 Ga0207667_10153951 Ga0207667_101539512 336
163 3300025972 Ga0207668_10053615 Ga0207668_100536152 336
164 3300025981 Ga0207640_10012242 Ga0207640_100122423 336
165 3300025986 Ga0207658_10029027 Ga0207658_100290273 336
166 3300026023 Ga0207677_10070154 Ga0207677_100701542 336
167 3300026041 Ga0207639_10086487 Ga0207639_100864873 336
168 3300026067 Ga0207678_10008103 Ga0207678_100081033 336
169 3300026067 Ga0207678_10023448 Ga0207678_100234482 336
170 3300026118 Ga0207675_100003650 Ga0207675_1000036508 336
171 3300026121 Ga0207683_10073010 Ga0207683_100730102 336
172 3300026142 Ga0207698_10063478 Ga0207698_100634782 336
173 3300028380 Ga0268265_10102008 Ga0268265_101020082 336
174 3300028381 Ga0268264_10095476 Ga0268264_100954762 336
175 3300031852 Ga0307410_10022955 Ga0307410_100229553 336
176 3300031995 Ga0307409_100055133 Ga0307409_1000551332 336
177 3300032002 Ga0307416_100090236 Ga0307416_1000902362 336
178 3300032004 Ga0307414_10110941 Ga0307414_101109412 336
179 3300034957 Ga0373938_0022222 Ga0373938_0022222_73_1083 336
180 3300035092 Ga0373952_0030916 Ga0373952_0030916_119_1129 336
181 3300035112 Ga0373932_0018190 Ga0373932_0018190_547_1557 336
182 3300035114 Ga0373939_0007230 Ga0373939_0007230_664_1674 336
183 3300035121 Ga0373960_0015951 Ga0373960_0015951_125_1135 336
184 3300035691 Ga0373931_0023757 Ga0373931_0023757_311_1321 336
185 3300041512 Ga0451853_0790618 Ga0451853_0790618_263_1273 336
186 3300045976 Ga0466967_0175167 Ga0466967_0175167_749_1759 336
187 3300046499 Ga0495594_0070383 Ga0495594_0070383_20_1030 336
188 3300047320 Ga0495672_0022122 Ga0495672_0022122_2788_3798 336
189 3300048903 Ga0496100_0057022 Ga0496100_0057022_1492_2502 336
190 3300048904 Ga0496101_0059960 Ga0496101_0059960_175_1185 336
191 3300048905 Ga0496102_0060517 Ga0496102_0060517_1576_2586 336
192 3300048908 Ga0496105_0057576 Ga0496105_0057576_718_1737 336
193 3300048908 Ga0496105_0236676 Ga0496105_0236676_83_1093 336
194 3300048910 Ga0496107_0030229 Ga0496107_0030229_309_1319 336
195 3300048911 Ga0496108_0020334 Ga0496108_0020334_2075_3085 336
196 3300048913 Ga0496110_0121966 Ga0496110_0121966_167_1177 336
197 3300048913 Ga0496110_0488440 Ga0496110_0488440_82_1092 336
198 3300048915 Ga0496112_0003670 Ga0496112_0003670_8443_9453 336
199 3300048917 Ga0496114_0023224 Ga0496114_0023224_1511_2521 336
200 3300048918 Ga0496115_0109886 Ga0496115_0109886_785_1795 336
201 3300050490 nmdc:mga03n38_13589_c1 nmdc:mga03n38_13589_c1_1696_2706 336
202 3300050490 nmdc:mga03n38_435_c1 nmdc:mga03n38_435_c1_7348_8358 336
203 3300050490 nmdc:mga03n38_53162_c1 nmdc:mga03n38_53162_c1_446_1456 336
204 3300050491 nmdc:mga00v17_27848_c1 nmdc:mga00v17_27848_c1_392_1402 336
205 3300050491 nmdc:mga00v17_5879_c1 nmdc:mga00v17_5879_c1_5455_6465 336
206 3300050491 nmdc:mga00v17_6485_c1 nmdc:mga00v17_6485_c1_434_1444 336
207 3300050492 nmdc:mga0yw44_512_c1 nmdc:mga0yw44_512_c1_10077_11087 336
208 3300050494 nmdc:mga06z11_33799_c1 nmdc:mga06z11_33799_c1_1270_2280 336
209 3300050496 nmdc:mga07m45_70652_c1 nmdc:mga07m45_70652_c1_263_1273 336
210 3300050507 nmdc:mga05p37_28521_c1 nmdc:mga05p37_28521_c1_4968_5978 336
211 3300050509 nmdc:mga0qj67_41963_c1 nmdc:mga0qj67_41963_c1_2021_3031 336
212 3300050516 nmdc:mga0sz30_12864_c1 nmdc:mga0sz30_12864_c1_749_1759 336
213 3300050516 nmdc:mga0sz30_1921_c1 nmdc:mga0sz30_1921_c1_6153_7163 336
214 3300053083 Ga0495655_0007628 Ga0495655_0007628_807_1817 336
215 iso_pu_bacteria 2547132424 2548699733 336
216 iso_pu_bacteria 2551306166 2552111563 336
217 iso_pu_bacteria 2738541274 2738704803 336
218 iso_pu_bacteria 2738543028 2739329972 336
219 iso_pu_bacteria 2902799365 2902803486 336
220 3300003320 rootH2_10055264 rootH2_100552644 337
221 3300005367 Ga0070667_100000074 Ga0070667_10000007472 337
222 3300005548 Ga0070665_100005707 Ga0070665_1000057078 337
223 3300005617 Ga0068859_100000567 Ga0068859_10000056726 337
224 3300005841 Ga0068863_100001963 Ga0068863_1000019637 337
225 3300005843 Ga0068860_100000276 Ga0068860_10000027631 337
226 3300005844 Ga0068862_100000065 Ga0068862_10000006575 337
227 3300006931 Ga0097620_100000567 Ga0097620_10000056726 337
228 3300009101 Ga0105247_10000017 Ga0105247_1000001751 337
229 3300009177 Ga0105248_10000849 Ga0105248_1000084931 337
230 3300009553 Ga0105249_10000096 Ga0105249_1000009651 337
231 3300014325 Ga0163163_10072408 Ga0163163_100724082 337
232 3300025900 Ga0207710_10000033 Ga0207710_10000033214 337
233 3300025923 Ga0207681_10000849 Ga0207681_100008493 337
234 3300025941 Ga0207711_10000661 Ga0207711_100006614 337
235 3300025961 Ga0207712_10000005 Ga0207712_10000005308 337
236 3300025986 Ga0207658_10000321 Ga0207658_1000032136 337
237 3300026035 Ga0207703_10010452 Ga0207703_100104526 337
238 3300026088 Ga0207641_10001342 Ga0207641_1000134210 337
239 3300028379 Ga0268266_10014326 Ga0268266_100143266 337
240 3300028380 Ga0268265_10000022 Ga0268265_1000002254 337
241 3300028381 Ga0268264_10000005 Ga0268264_10000005304 337
242 3300048904 Ga0496101_0043559 Ga0496101_0043559_1877_2890 337
243 3300048905 Ga0496102_0000415 Ga0496102_0000415_47420_48433 337
244 3300048906 Ga0496103_0000093 Ga0496103_0000093_25271_26284 337
245 3300048919 Ga0496116_0004420 Ga0496116_0004420_6203_7216 337
246 3300048920 Ga0496117_0021358 Ga0496117_0021358_3366_4379 337
247 3300048921 Ga0496118_0000488 Ga0496118_0000488_19182_20195 337
248 3300048922 Ga0496119_0002624 Ga0496119_0002624_7035_8048 337
249 3300048923 Ga0496120_0001188 Ga0496120_0001188_11626_12639 337
250 3300048924 Ga0496121_0007092 Ga0496121_0007092_454_1467 337
251 3300048927 Ga0496124_0008699 Ga0496124_0008699_6812_7825 337
252 3300048928 Ga0496125_0061113 Ga0496125_0061113_817_1830 337
253 3300048929 Ga0496126_0003151 Ga0496126_0003151_13330_14343 337
254 iso_pu_bacteria 2902792274 2902793004 337
255 3300006048 Ga0075363_100174617 Ga0075363_1001746172 338
256 3300050490 nmdc:mga03n38_126601_c1 nmdc:mga03n38_126601_c1_99_1118 338
257 iso_pu_bacteria 2738543011 2739240319 338
258 iso_pu_bacteria 2889300758 2889302746 338
259 iso_pu_bacteria 2902810491 2902813677 338
260 iso_pu_bacteria 2939743619 2939747966 338
261 3300005331 Ga0070670_100363401 Ga0070670_1003634012 339
262 3300005338 Ga0068868_100103672 Ga0068868_1001036722 339
263 3300005347 Ga0070668_100027164 Ga0070668_1000271641 339
264 3300005355 Ga0070671_100005599 Ga0070671_1000055998 339
265 3300005356 Ga0070674_100007854 Ga0070674_1000078543 339
266 3300005356 Ga0070674_100015283 Ga0070674_1000152834 339
267 3300005365 Ga0070688_100217326 Ga0070688_1002173261 339
268 3300005367 Ga0070667_100000819 Ga0070667_1000008192 339
269 3300005367 Ga0070667_100048784 Ga0070667_1000487842 339
270 3300005367 Ga0070667_100070012 Ga0070667_1000700122 339
271 3300005435 Ga0070714_100016514 Ga0070714_1000165145 339
272 3300005435 Ga0070714_100092138 Ga0070714_1000921382 339
273 3300005436 Ga0070713_100013669 Ga0070713_1000136696 339
274 3300005440 Ga0070705_100100131 Ga0070705_1001001312 339
275 3300005456 Ga0070678_100010151 Ga0070678_1000101512 339
276 3300005457 Ga0070662_100151791 Ga0070662_1001517912 339
277 3300005539 Ga0068853_100079851 Ga0068853_1000798512 339
278 3300005546 Ga0070696_100180892 Ga0070696_1001808922 339
279 3300005547 Ga0070693_100029203 Ga0070693_1000292033 339
280 3300005548 Ga0070665_100003609 Ga0070665_1000036096 339
281 3300005578 Ga0068854_100068457 Ga0068854_1000684572 339
282 3300005615 Ga0070702_100013285 Ga0070702_1000132853 339
283 3300005616 Ga0068852_100131202 Ga0068852_1001312022 339
284 3300005618 Ga0068864_100149884 Ga0068864_1001498843 339
285 3300005618 Ga0068864_100294245 Ga0068864_1002942452 339
286 3300005718 Ga0068866_10048584 Ga0068866_100485842 339
287 3300005719 Ga0068861_100037442 Ga0068861_1000374423 339
288 3300005719 Ga0068861_100116822 Ga0068861_1001168222 339
289 3300005841 Ga0068863_100002994 Ga0068863_10000299412 339
290 3300005842 Ga0068858_100186781 Ga0068858_1001867812 339
291 3300005843 Ga0068860_100096650 Ga0068860_1000966502 339
292 3300005844 Ga0068862_100014128 Ga0068862_1000141285 339
293 3300006048 Ga0075363_100004789 Ga0075363_1000047895 339
294 3300006051 Ga0075364_10001329 Ga0075364_100013295 339
295 3300006173 Ga0070716_100270296 Ga0070716_1002702962 339
296 3300006353 Ga0075370_10084524 Ga0075370_100845241 339
297 3300006881 Ga0068865_100004490 Ga0068865_1000044906 339
298 3300006881 Ga0068865_100075469 Ga0068865_1000754692 339
299 3300009098 Ga0105245_10047008 Ga0105245_100470084 339
300 3300009101 Ga0105247_10007735 Ga0105247_100077354 339
301 3300009101 Ga0105247_10012541 Ga0105247_100125414 339
302 3300009176 Ga0105242_10159454 Ga0105242_101594542 339
303 3300009177 Ga0105248_10019251 Ga0105248_100192518 339
304 3300009177 Ga0105248_10024808 Ga0105248_100248082 339
305 3300009177 Ga0105248_10098526 Ga0105248_100985262 339
306 3300009553 Ga0105249_10021366 Ga0105249_100213663 339
307 3300010375 Ga0105239_10123927 Ga0105239_101239272 339
308 3300013296 Ga0157374_10020714 Ga0157374_100207143 339
309 3300013297 Ga0157378_10030415 Ga0157378_100304154 339
310 3300013306 Ga0163162_10031526 Ga0163162_100315264 339
311 3300013306 Ga0163162_10048516 Ga0163162_100485163 339
312 3300013307 Ga0157372_10111308 Ga0157372_101113083 339
313 3300013308 Ga0157375_10012726 Ga0157375_100127263 339
314 3300013308 Ga0157375_10708006 Ga0157375_107080061 339
315 3300014325 Ga0163163_10016950 Ga0163163_100169507 339
316 3300014326 Ga0157380_10073612 Ga0157380_100736122 339
317 3300014745 Ga0157377_10028544 Ga0157377_100285443 339
318 3300025303 Ga0209051_1000051 Ga0209051_1000051109 339
319 3300025900 Ga0207710_10006703 Ga0207710_100067032 339
320 3300025901 Ga0207688_10008511 Ga0207688_100085112 339
321 3300025904 Ga0207647_10060212 Ga0207647_100602122 339
322 3300025907 Ga0207645_10170548 Ga0207645_101705482 339
323 3300025928 Ga0207700_10054780 Ga0207700_100547802 339
324 3300025929 Ga0207664_10088444 Ga0207664_100884442 339
325 3300025931 Ga0207644_10002040 Ga0207644_100020407 339
326 3300025937 Ga0207669_10017133 Ga0207669_100171333 339
327 3300025938 Ga0207704_10013973 Ga0207704_100139732 339
328 3300025938 Ga0207704_10229532 Ga0207704_102295322 339
329 3300025939 Ga0207665_10232623 Ga0207665_102326231 339
330 3300025942 Ga0207689_10019152 Ga0207689_100191522 339
331 3300025960 Ga0207651_10314517 Ga0207651_103145171 339
332 3300025972 Ga0207668_10165121 Ga0207668_101651212 339
333 3300025972 Ga0207668_10247697 Ga0207668_102476972 339
334 3300025981 Ga0207640_10023783 Ga0207640_100237832 339
335 3300025986 Ga0207658_10000743 Ga0207658_1000074324 339
336 3300025986 Ga0207658_10002978 Ga0207658_1000297810 339
337 3300025986 Ga0207658_10049977 Ga0207658_100499773 339
338 3300026023 Ga0207677_10107477 Ga0207677_101074772 339
339 3300026035 Ga0207703_10139183 Ga0207703_101391832 339
340 3300026035 Ga0207703_10177155 Ga0207703_101771552 339
341 3300026078 Ga0207702_10086975 Ga0207702_100869752 339
342 3300026088 Ga0207641_10005082 Ga0207641_1000508212 339
343 3300026089 Ga0207648_10159828 Ga0207648_101598282 339
344 3300026118 Ga0207675_100041689 Ga0207675_1000416893 339
345 3300026118 Ga0207675_100259950 Ga0207675_1002599502 339
346 3300026121 Ga0207683_10085918 Ga0207683_100859182 339
347 3300026142 Ga0207698_10212030 Ga0207698_102120302 339
348 3300028379 Ga0268266_10002162 Ga0268266_1000216212 339
349 3300028380 Ga0268265_10055693 Ga0268265_100556932 339
350 3300028381 Ga0268264_10074422 Ga0268264_100744222 339
351 3300031251 Ga0265327_10005197 Ga0265327_1000519710 339
352 3300037853 Ga0436364_0166911 Ga0436364_0166911_6332_7363 339
353 3300037853 Ga0436364_0255571 Ga0436364_0255571_3169_4188 339
354 3300037853 Ga0436364_1311241 Ga0436364_1311241_359_1378 339
355 3300039437 Ga0436365_0200358 Ga0436365_0200358_653_1684 339
356 3300039437 Ga0436365_0484364 Ga0436365_0484364_7961_8980 339
357 3300041413 Ga0439465_0016772 Ga0439465_0016772_1189_2232 339
358 3300041997 Ga0439431_0003250 Ga0439431_0003250_184_1227 339
359 3300042005 Ga0439448_0001700 Ga0439448_0001700_1973_2992 339
360 3300042435 Ga0439434_0007526 Ga0439434_0007526_1645_2688 339
361 3300044683 Ga0466965_0054711 Ga0466965_0054711_168_1187 339
362 3300044684 Ga0466966_0069996 Ga0466966_0069996_1033_2058 339
363 3300044694 Ga0466963_0002039 Ga0466963_0002039_3736_4755 339
364 3300044719 Ga0466971_0010315 Ga0466971_0010315_724_1743 339
365 3300044735 Ga0466968_0023062 Ga0466968_0023062_330_1355 339
366 3300044901 Ga0466960_0004198 Ga0466960_0004198_4361_5380 339
367 3300045049 Ga0466959_0037964 Ga0466959_0037964_1136_2161 339
368 3300045836 Ga0466958_0037843 Ga0466958_0037843_442_1467 339
369 3300045976 Ga0466967_0001069 Ga0466967_0001069_9728_10747 339
370 3300045976 Ga0466967_0004355 Ga0466967_0004355_4976_5995 339
371 3300046461 Ga0495641_0075763 Ga0495641_0075763_283_1311 339
372 3300046529 Ga0495652_0147064 Ga0495652_0147064_90_1118 339
373 3300046694 Ga0495649_0114982 Ga0495649_0114982_214_1233 339
374 3300047320 Ga0495672_0179321 Ga0495672_0179321_34_1053 339
375 3300048903 Ga0496100_0000212 Ga0496100_0000212_28921_29940 339
376 3300048903 Ga0496100_0009399 Ga0496100_0009399_2713_3732 339
377 3300048904 Ga0496101_0000020 Ga0496101_0000020_142389_143408 339
378 3300048904 Ga0496101_0001415 Ga0496101_0001415_10050_11069 339
379 3300048904 Ga0496101_0026246 Ga0496101_0026246_2713_3732 339
380 3300048905 Ga0496102_0004064 Ga0496102_0004064_7731_8750 339
381 3300048905 Ga0496102_0004363 Ga0496102_0004363_10811_11830 339
382 3300048905 Ga0496102_0327726 Ga0496102_0327726_217_1236 339
383 3300048906 Ga0496103_0000512 Ga0496103_0000512_25529_26548 339
384 3300048906 Ga0496103_0049985 Ga0496103_0049985_657_1676 339
385 3300048907 Ga0496104_0004308 Ga0496104_0004308_9617_10636 339
386 3300048908 Ga0496105_0255008 Ga0496105_0255008_350_1369 339
387 3300048909 Ga0496106_0001024 Ga0496106_0001024_10959_11978 339
388 3300048909 Ga0496106_0011011 Ga0496106_0011011_4713_5732 339
389 3300048909 Ga0496106_0086509 Ga0496106_0086509_1201_2220 339
390 3300048909 Ga0496106_0242942 Ga0496106_0242942_19_1038 339
391 3300048910 Ga0496107_0002866 Ga0496107_0002866_10344_11363 339
392 3300048910 Ga0496107_0005597 Ga0496107_0005597_7038_8057 339
393 3300048910 Ga0496107_0274080 Ga0496107_0274080_207_1226 339
394 3300048911 Ga0496108_0000405 Ga0496108_0000405_13624_14643 339
395 3300048911 Ga0496108_0001278 Ga0496108_0001278_6541_7560 339
396 3300048911 Ga0496108_0063089 Ga0496108_0063089_184_1203 339
397 3300048912 Ga0496109_0002338 Ga0496109_0002338_11134_12153 339
398 3300048912 Ga0496109_0081314 Ga0496109_0081314_1029_2048 339
399 3300048913 Ga0496110_0013722 Ga0496110_0013722_192_1211 339
400 3300048913 Ga0496110_0019778 Ga0496110_0019778_1090_2109 339
401 3300048913 Ga0496110_0150566 Ga0496110_0150566_1057_2076 339
402 3300048914 Ga0496111_0138468 Ga0496111_0138468_226_1245 339
403 3300048915 Ga0496112_0041498 Ga0496112_0041498_2645_3679 339
404 3300048915 Ga0496112_0078708 Ga0496112_0078708_593_1612 339
405 3300048917 Ga0496114_0000181 Ga0496114_0000181_28537_29556 339
406 3300048917 Ga0496114_0004074 Ga0496114_0004074_4175_5194 339
407 3300048920 Ga0496117_0076871 Ga0496117_0076871_829_1848 339
408 3300048921 Ga0496118_0000359 Ga0496118_0000359_46762_47781 339
409 3300048921 Ga0496118_0004501 Ga0496118_0004501_13634_14653 339
410 3300048922 Ga0496119_0002301 Ga0496119_0002301_9537_10556 339
411 3300048924 Ga0496121_0000002 Ga0496121_0000002_848913_849932 339
412 3300048925 Ga0496122_0000312 Ga0496122_0000312_75423_76442 339
413 3300048926 Ga0496123_0003426 Ga0496123_0003426_5684_6703 339
414 3300048927 Ga0496124_0000002 Ga0496124_0000002_644657_645676 339
415 3300048928 Ga0496125_0000002 Ga0496125_0000002_848913_849932 339
416 3300048928 Ga0496125_0027604 Ga0496125_0027604_2538_3572 339
417 3300048929 Ga0496126_0000011 Ga0496126_0000011_644657_645676 339
418 3300048929 Ga0496126_0003649 Ga0496126_0003649_17122_18156 339
419 3300048929 Ga0496126_0003649 Ga0496126_0003649_4261_5280 339
420 3300049569 Ga0501032_0021556 Ga0501032_0021556_1782_2801 339
421 3300049571 Ga0501034_0011897 Ga0501034_0011897_1401_2420 339
422 3300049581 Ga0501047_0008566 Ga0501047_0008566_1953_2972 339
423 3300049822 Ga0501035_0056811 Ga0501035_0056811_1826_2845 339
424 3300049823 Ga0501044_0003845 Ga0501044_0003845_5699_6718 339
425 3300050490 nmdc:mga03n38_361_c1 nmdc:mga03n38_361_c1_2810_3844 339
426 3300050516 nmdc:mga0sz30_3093_c1 nmdc:mga0sz30_3093_c1_4696_5730 339
427 3300053090 Ga0500646_0034793 Ga0500646_0034793_134_1156 339
428 3300005337 Ga0070682_100005684 Ga0070682_1000056845 340
429 3300005617 Ga0068859_100089377 Ga0068859_1000893773 340
430 3300005719 Ga0068861_100033053 Ga0068861_1000330534 340
431 3300005937 Ga0081455_10057811 Ga0081455_100578114 340
432 3300006038 Ga0075365_10035342 Ga0075365_100353422 340
433 3300006048 Ga0075363_100189972 Ga0075363_1001899721 340
434 3300006186 Ga0075369_10010696 Ga0075369_100106962 340
435 3300006186 Ga0075369_10031663 Ga0075369_100316633 340
436 3300006353 Ga0075370_10026266 Ga0075370_100262663 340
437 3300006931 Ga0097620_100089380 Ga0097620_1000893803 340
438 3300009098 Ga0105245_10121636 Ga0105245_101216362 340
439 3300009551 Ga0105238_10066892 Ga0105238_100668922 340
440 3300010375 Ga0105239_10128759 Ga0105239_101287592 340
441 3300013297 Ga0157378_10201189 Ga0157378_102011892 340
442 3300013306 Ga0163162_10314316 Ga0163162_103143162 340
443 3300013307 Ga0157372_10267066 Ga0157372_102670662 340
444 3300013308 Ga0157375_10059931 Ga0157375_100599312 340
445 3300025898 Ga0207692_10047737 Ga0207692_100477372 340
446 3300025905 Ga0207685_10006064 Ga0207685_100060643 340
447 3300025906 Ga0207699_10254478 Ga0207699_102544782 340
448 3300025915 Ga0207693_10018382 Ga0207693_100183824 340
449 3300025916 Ga0207663_10093628 Ga0207663_100936282 340
450 3300025932 Ga0207690_10186659 Ga0207690_101866592 340
451 3300025972 Ga0207668_10122312 Ga0207668_101223122 340
452 3300026023 Ga0207677_10228607 Ga0207677_102286072 340
453 3300026118 Ga0207675_100051444 Ga0207675_1000514444 340
454 3300026118 Ga0207675_100196042 Ga0207675_1001960422 340
455 3300028380 Ga0268265_10065580 Ga0268265_100655802 340
456 3300041413 Ga0439465_0000060 Ga0439465_0000060_5911_6933 340
457 3300042004 Ga0439445_0001642 Ga0439445_0001642_1693_2715 340
458 3300044684 Ga0466966_0113204 Ga0466966_0113204_617_1654 340
459 3300044693 Ga0466961_0003256 Ga0466961_0003256_6165_7211 340
460 3300044735 Ga0466968_0023100 Ga0466968_0023100_296_1342 340
461 3300044901 Ga0466960_0000298 Ga0466960_0000298_5091_6125 340
462 3300045976 Ga0466967_0124981 Ga0466967_0124981_1133_2179 340
463 3300046459 Ga0495629_0017955 Ga0495629_0017955_2067_3101 340
464 3300046460 Ga0495638_0036648 Ga0495638_0036648_418_1452 340
465 3300046461 Ga0495641_0006709 Ga0495641_0006709_3167_4201 340
466 3300046517 Ga0495630_0129607 Ga0495630_0129607_459_1493 340
467 3300046531 Ga0495665_0034359 Ga0495665_0034359_875_1909 340
468 3300046689 Ga0495613_0178529 Ga0495613_0178529_95_1129 340
469 3300047315 Ga0495581_0012422 Ga0495581_0012422_2911_3945 340
470 3300047319 Ga0495674_0031488 Ga0495674_0031488_697_1731 340
471 3300047323 Ga0495683_0001402 Ga0495683_0001402_14728_15768 340
472 3300048905 Ga0496102_0332709 Ga0496102_0332709_156_1178 340
473 3300048906 Ga0496103_0049761 Ga0496103_0049761_602_1624 340
474 3300048909 Ga0496106_0092960 Ga0496106_0092960_714_1736 340
475 3300048910 Ga0496107_0038963 Ga0496107_0038963_410_1432 340
476 3300048911 Ga0496108_0009737 Ga0496108_0009737_5559_6581 340
477 3300048915 Ga0496112_0223853 Ga0496112_0223853_269_1291 340
478 3300049569 Ga0501032_0000469 Ga0501032_0000469_16516_17553 340
479 3300049571 Ga0501034_0009642 Ga0501034_0009642_5070_6107 340
480 3300049572 Ga0501036_0016952 Ga0501036_0016952_4961_5998 340
481 3300049573 Ga0501037_0000234 Ga0501037_0000234_39669_40706 340
482 3300049574 Ga0501038_0004555 Ga0501038_0004555_10769_11806 340
483 3300049575 Ga0501039_0000113 Ga0501039_0000113_39763_40800 340
484 3300049579 Ga0501043_0000082 Ga0501043_0000082_30035_31072 340
485 3300049586 Ga0501070_0001505 Ga0501070_0001505_8979_10016 340
486 3300049586 Ga0501070_0029564 Ga0501070_0029564_706_1740 340
487 3300049742 Ga0501080_0138139 Ga0501080_0138139_1088_2122 340
488 3300050489 nmdc:mga03683_29631_c1 nmdc:mga03683_29631_c1_254_1276 340
489 3300050490 nmdc:mga03n38_16498_c1 nmdc:mga03n38_16498_c1_1567_2589 340
490 3300050492 nmdc:mga0yw44_26928_c1 nmdc:mga0yw44_26928_c1_2101_3135 340
491 3300050493 nmdc:mga0k408_38942_c1 nmdc:mga0k408_38942_c1_720_1742 340
492 3300050496 nmdc:mga07m45_1418_c1 nmdc:mga07m45_1418_c1_248_1270 340
493 3300050516 nmdc:mga0sz30_11029_c1 nmdc:mga0sz30_11029_c1_1592_2614 340
494 3300053080 Ga0500635_0012608 Ga0500635_0012608_1180_2202 340
495 3300053080 Ga0500635_0018800 Ga0500635_0018800_448_1491 340
496 3300053131 Ga0500652_009892 Ga0500652_009892_245_1288 340
497 3300053131 Ga0500652_070942 Ga0500652_070942_382_1404 340
498 3300053136 Ga0500559_0052838 Ga0500559_0052838_126_1169 340
499 3300053730 Ga0500645_000438 Ga0500645_000438_2476_3519 340
500 iso_pu_bacteria 2939582691 2939589096 340
501 3300005841 Ga0068863_100381004 Ga0068863_1003810042 341
502 3300010375 Ga0105239_10009981 Ga0105239_1000998111 341
503 3300046524 Ga0495648_0018611 Ga0495648_0018611_3003_4040 341
504 3300046530 Ga0495654_0079693 Ga0495654_0079693_85_1122 341
505 3300046648 Ga0495611_0034171 Ga0495611_0034171_43_1080 341
506 3300046692 Ga0495671_0063697 Ga0495671_0063697_297_1334 341
507 3300047320 Ga0495672_0004144 Ga0495672_0004144_1146_2183 341
508 3300047444 Ga0495675_0004548 Ga0495675_0004548_459_1493 341
509 3300047469 Ga0495673_0002432 Ga0495673_0002432_10085_11122 341
510 3300048903 Ga0496100_0005227 Ga0496100_0005227_5757_6782 341
511 3300048904 Ga0496101_0000075 Ga0496101_0000075_84590_85615 341
512 3300048904 Ga0496101_0000310 Ga0496101_0000310_23931_24980 341
513 3300048905 Ga0496102_0000003 Ga0496102_0000003_198203_199228 341
514 3300048906 Ga0496103_0000014 Ga0496103_0000014_91388_92413 341
515 3300048908 Ga0496105_0076631 Ga0496105_0076631_582_1631 341
516 3300048909 Ga0496106_0001954 Ga0496106_0001954_3290_4339 341
517 3300048910 Ga0496107_0005122 Ga0496107_0005122_6501_7550 341
518 3300048910 Ga0496107_0028877 Ga0496107_0028877_2713_3738 341
519 3300048917 Ga0496114_0002320 Ga0496114_0002320_12750_13799 341
520 3300048918 Ga0496115_0009311 Ga0496115_0009311_1762_2811 341
521 3300048919 Ga0496116_0000071 Ga0496116_0000071_197338_198363 341
522 3300048920 Ga0496117_0000003 Ga0496117_0000003_393036_394061 341
523 3300048921 Ga0496118_0000001 Ga0496118_0000001_393039_394064 341
524 3300048922 Ga0496119_0000266 Ga0496119_0000266_61580_62605 341
525 3300048923 Ga0496120_0000235 Ga0496120_0000235_46133_47158 341
526 3300048924 Ga0496121_0000019 Ga0496121_0000019_207646_208671 341
527 3300048929 Ga0496126_0000951 Ga0496126_0000951_46138_47163 341
528 3300049581 Ga0501047_0097938 Ga0501047_0097938_1519_2544 341
529 3300053087 Ga0500643_003479 Ga0500643_003479_3009_4046 341
530 3300053098 Ga0500650_0102349 Ga0500650_0102349_152_1189 341
531 3300005937 Ga0081455_10047021 Ga0081455_100470213 348
532 3300041411 Ga0439466_0061507 Ga0439466_0061507_78_1124 348
533 3300042435 Ga0439434_0027662 Ga0439434_0027662_601_1647 348
534 3300002070 JGI24750J21931_1008460 JGI24750J21931_10084602 350
535 3300002077 JGI24744J21845_10003374 JGI24744J21845_100033742 350
536 3300002244 JGI24742J22300_10001095 JGI24742J22300_100010952 350
537 3300005330 Ga0070690_100007228 Ga0070690_1000072283 350
538 3300005334 Ga0068869_100014974 Ga0068869_1000149742 350
539 3300005336 Ga0070680_100113503 Ga0070680_1001135031 350
540 3300005337 Ga0070682_100004933 Ga0070682_1000049332 350
541 3300005338 Ga0068868_100002812 Ga0068868_1000028129 350
542 3300005341 Ga0070691_10067301 Ga0070691_100673011 350
543 3300005343 Ga0070687_100087761 Ga0070687_1000877612 350
544 3300005347 Ga0070668_100010210 Ga0070668_1000102101 350
545 3300005353 Ga0070669_100008103 Ga0070669_1000081038 350
546 3300005356 Ga0070674_100003739 Ga0070674_10000373910 350
547 3300005367 Ga0070667_100005546 Ga0070667_10000554611 350
548 3300005439 Ga0070711_100000479 Ga0070711_1000004797 350
549 3300005441 Ga0070700_100013522 Ga0070700_1000135225 350
550 3300005444 Ga0070694_100022680 Ga0070694_1000226803 350
551 3300005455 Ga0070663_100003214 Ga0070663_1000032148 350
552 3300005456 Ga0070678_100000595 Ga0070678_10000059510 350
553 3300005457 Ga0070662_100012622 Ga0070662_1000126221 350
554 3300005459 Ga0068867_100001973 Ga0068867_10000197310 350
555 3300005536 Ga0070697_100305112 Ga0070697_1003051122 350
556 3300005546 Ga0070696_100012568 Ga0070696_1000125682 350
557 3300005548 Ga0070665_100286620 Ga0070665_1002866202 350
558 3300005549 Ga0070704_100000666 Ga0070704_10000066612 350
559 3300005578 Ga0068854_100003429 Ga0068854_1000034299 350
560 3300005616 Ga0068852_100288684 Ga0068852_1002886842 350
561 3300005718 Ga0068866_10001353 Ga0068866_100013536 350
562 3300005719 Ga0068861_100009323 Ga0068861_1000093233 350
563 3300005842 Ga0068858_100015481 Ga0068858_1000154812 350
564 3300005843 Ga0068860_100011255 Ga0068860_1000112553 350
565 3300005844 Ga0068862_100271605 Ga0068862_1002716052 350
566 3300006163 Ga0070715_10004540 Ga0070715_100045403 350
567 3300006358 Ga0068871_100021812 Ga0068871_1000218125 350
568 3300006881 Ga0068865_100010272 Ga0068865_1000102724 350
569 3300009094 Ga0111539_10254263 Ga0111539_102542632 350
570 3300009098 Ga0105245_10004418 Ga0105245_100044189 350
571 3300009101 Ga0105247_10002837 Ga0105247_100028373 350
572 3300009174 Ga0105241_10083795 Ga0105241_100837952 350
573 3300009176 Ga0105242_10001113 Ga0105242_1000111318 350
574 3300009177 Ga0105248_10003348 Ga0105248_1000334812 350
575 3300009553 Ga0105249_10001976 Ga0105249_1000197618 350
576 3300010375 Ga0105239_10010576 Ga0105239_1001057611 350
577 3300013296 Ga0157374_10124598 Ga0157374_101245983 350
578 3300013297 Ga0157378_10009136 Ga0157378_100091369 350
579 3300013306 Ga0163162_10013602 Ga0163162_100136025 350
580 3300013307 Ga0157372_10007458 Ga0157372_100074587 350
581 3300014326 Ga0157380_10000771 Ga0157380_100007718 350
582 3300014968 Ga0157379_10006231 Ga0157379_1000623111 350
583 3300017792 Ga0163161_10002358 Ga0163161_100023587 350
584 3300025899 Ga0207642_10000124 Ga0207642_1000012418 350
585 3300025900 Ga0207710_10003442 Ga0207710_100034428 350
586 3300025901 Ga0207688_10002685 Ga0207688_100026853 350
587 3300025905 Ga0207685_10029080 Ga0207685_100290803 350
588 3300025915 Ga0207693_10001826 Ga0207693_100018268 350
589 3300025916 Ga0207663_10002536 Ga0207663_100025362 350
590 3300025918 Ga0207662_10005313 Ga0207662_100053134 350
591 3300025923 Ga0207681_10079363 Ga0207681_100793632 350
592 3300025927 Ga0207687_10003894 Ga0207687_100038946 350
593 3300025929 Ga0207664_10248421 Ga0207664_102484212 350
594 3300025933 Ga0207706_10005962 Ga0207706_100059628 350
595 3300025935 Ga0207709_10006328 Ga0207709_100063282 350
596 3300025937 Ga0207669_10002064 Ga0207669_100020645 350
597 3300025938 Ga0207704_10000291 Ga0207704_1000029118 350
598 3300025939 Ga0207665_10001751 Ga0207665_1000175113 350
599 3300025940 Ga0207691_10054294 Ga0207691_100542943 350
600 3300025941 Ga0207711_10087903 Ga0207711_100879032 350
601 3300025942 Ga0207689_10011177 Ga0207689_100111775 350
602 3300025961 Ga0207712_10005062 Ga0207712_100050622 350
603 3300025972 Ga0207668_10003268 Ga0207668_100032687 350
604 3300025981 Ga0207640_10005157 Ga0207640_100051578 350
605 3300025986 Ga0207658_10014287 Ga0207658_100142874 350
606 3300026023 Ga0207677_10005648 Ga0207677_100056488 350
607 3300026035 Ga0207703_10076965 Ga0207703_100769653 350
608 3300026041 Ga0207639_10002547 Ga0207639_100025478 350
609 3300026067 Ga0207678_10011314 Ga0207678_100113148 350
610 3300026075 Ga0207708_10002264 Ga0207708_100022649 350
611 3300026089 Ga0207648_10002008 Ga0207648_100020087 350
612 3300026118 Ga0207675_100003453 Ga0207675_10000345311 350
613 3300026121 Ga0207683_10003523 Ga0207683_1000352310 350
614 3300026142 Ga0207698_10010560 Ga0207698_100105603 350
615 3300028379 Ga0268266_10042535 Ga0268266_100425352 350
616 3300028380 Ga0268265_10104994 Ga0268265_101049941 350
617 3300028381 Ga0268264_10002955 Ga0268264_100029552 350
618 3300035242 Ga0373962_0051657 Ga0373962_0051657_24_1097 350
619 3300048903 Ga0496100_0006724 Ga0496100_0006724_552_1625 350
620 3300048904 Ga0496101_0041333 Ga0496101_0041333_2038_3090 350
621 3300048906 Ga0496103_0011056 Ga0496103_0011056_617_1690 350
622 3300048909 Ga0496106_0035640 Ga0496106_0035640_153_1226 350
623 3300048910 Ga0496107_0011433 Ga0496107_0011433_4971_6044 350
624 3300048918 Ga0496115_0005302 Ga0496115_0005302_6874_7947 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

245

335

0.96

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

109

191

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hnk-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii, apo tetragonal form 0.8999 6 336
4x9o-assembly1.cif.gz_B beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate 0.8956 4 340
1hnk-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii, apo tetragonal form 0.8936 6 336
4x0o-assembly1.cif.gz_A beta-ketoacyl-(acyl carrier protein) synthase iii-2 (fabh2) from vibrio cholerae soaked with acetyl-coa 0.8919 4 344
4wzu-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-(acyl carrier protein) synthase iii-2 (fabh2) from vibrio cholerae 0.8912 4 340
ID Description Score Start End Superfamily
1hnkA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9491 239 336 3.40.47.10
1hn9A02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8968 185 336 3.40.47.10
2ebdB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8958 181 336 3.40.47.10
4x9oB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8956 4 340 3.40.47.10
2ebdB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8898 181 336 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A101AQQ3-F1-model_v4 deleted 0.9849 6 339
AF-A0A101AQQ3-F1-model_v4 deleted 0.9733 6 339
AF-X8C9R0-F1-model_v4 3-Oxoacyl-[acyl-carrier-(ACP)] synthase III family protein 0.9698 4 217 GO:0004315
GO:0006633
GO:0044550
AF-A0A351GHW3-F1-model_v4 3-oxoacyl-ACP synthase 0.9659 227 336 GO:0016746
AF-W7J4G5-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180) 0.9657 221 336 GO:0017000
GO:0033818
GO:0044550

Feature Viewer

pLDDT pTM Quality
90.31 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map