F470326
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 624 | 281 | 605 | 340 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2939743619|2939747966 |
| Length | 341 |
| Sequence | LPAVSLVDVASYLPENRVPTDYFTQFSRSDRMAKNVMFRSPRYRHHVARDETAVDMVERAVAPLIDRHGADAISSVDVLLTHTQLPDNPVLGSGPEVARRLGLRPDWVIDVHNSGCASFVQMMALAQTILQSTDATTALIAATQNCAGQVFTQTAIRGLAHAPVPGDGCGVGLLTKSNDAPILGIECRTHPEFGGDMTFEAVPVSDRKYWEPGRGQVCVGFTESKITKVFARGNRLVPEVALAVCDRIGVQSTEVDTLVTNQPNRLFLRNWREAMQLTPEQHPDTFDECGNLFGAGIPVTLDTANRDGRIGNGSLVLMAAFAHAGDFAGAAAVRWGAGPTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 3 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 4 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 5 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 6 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 7 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 8 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 9 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 10 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 11 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 12 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 13 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 14 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 15 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 16 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 17 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 18 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 19 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 20 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 21 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 171 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 173 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 179 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 180 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 181 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 182 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 183 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 184 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 185 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 186 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 187 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 235 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 236 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 237 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 238 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 239 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 240 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 241 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 242 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 243 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 244 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 245 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 246 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 247 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 260 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 261 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 262 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 263 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 264 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 269 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 270 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 271 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 273 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 274 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 275 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 276 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 277 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 278 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 279 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 280 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 281 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.12 |
| Metatranscriptomes | 0 |
| Isolates | 2.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.46 |
| Nodule | 0.16 |
| Rhizoplane | 13.14 |
| Rhizosphere | 68.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1008460 | 3300002070 | Bacteria | 1308 |
| 2 | JGI24744J21845_10003176 | 3300002077 | Bacteria | 3370 |
| 3 | JGI24744J21845_10003374 | 3300002077 | Bacteria | 3281 |
| 4 | JGI24742J22300_10001095 | 3300002244 | Bacteria | 4199 |
| 5 | JGI24742J22300_10007986 | 3300002244 | Bacteria | 1747 |
| 6 | rootH2_10055264 | 3300003320 | Bacteria | 4895 |
| 7 | Ga0070676_10078486 | 3300005328 | Bacteria | 1997 |
| 8 | Ga0070690_100007228 | 3300005330 | Bacteria | 6355 |
| 9 | Ga0070670_100363401 | 3300005331 | Bacteria | 1273 |
| 10 | Ga0068869_100014974 | 3300005334 | Bacteria | 5187 |
| 11 | Ga0068869_100131023 | 3300005334 | Bacteria | 1928 |
| 12 | Ga0070680_100113503 | 3300005336 | Bacteria | 2257 |
| 13 | Ga0070682_100004933 | 3300005337 | Bacteria | 7408 |
| 14 | Ga0070682_100005684 | 3300005337 | Bacteria | 6950 |
| 15 | Ga0070682_100045049 | 3300005337 | Bacteria | 2733 |
| 16 | Ga0070682_100112696 | 3300005337 | Bacteria | 1815 |
| 17 | Ga0068868_100002812 | 3300005338 | Bacteria | 12059 |
| 18 | Ga0068868_100103672 | 3300005338 | Bacteria | 2304 |
| 19 | Ga0070689_100013931 | 3300005340 | Bacteria | 5832 |
| 20 | Ga0070691_10037706 | 3300005341 | Bacteria | 2281 |
| 21 | Ga0070691_10067301 | 3300005341 | Bacteria | 1732 |
| 22 | Ga0070687_100087761 | 3300005343 | Bacteria | 1713 |
| 23 | Ga0070668_100010210 | 3300005347 | Bacteria | 6964 |
| 24 | Ga0070668_100016794 | 3300005347 | Bacteria | 5473 |
| 25 | Ga0070668_100027164 | 3300005347 | Bacteria | 4344 |
| 26 | Ga0070669_100008103 | 3300005353 | Bacteria | 7508 |
| 27 | Ga0070671_100005599 | 3300005355 | Bacteria | 10001 |
| 28 | Ga0070674_100003739 | 3300005356 | Bacteria | 8583 |
| 29 | Ga0070674_100007854 | 3300005356 | Bacteria | 6310 |
| 30 | Ga0070674_100015283 | 3300005356 | Bacteria | 4789 |
| 31 | Ga0070688_100020095 | 3300005365 | Bacteria | 3878 |
| 32 | Ga0070688_100217326 | 3300005365 | Bacteria | 1345 |
| 33 | Ga0070659_100229637 | 3300005366 | Bacteria | 1533 |
| 34 | Ga0070667_100000074 | 3300005367 | Bacteria | 121299 |
| 35 | Ga0070667_100000819 | 3300005367 | Bacteria | 29020 |
| 36 | Ga0070667_100005546 | 3300005367 | Bacteria | 10529 |
| 37 | Ga0070667_100038684 | 3300005367 | Bacteria | 4000 |
| 38 | Ga0070667_100048784 | 3300005367 | Bacteria | 3564 |
| 39 | Ga0070667_100070012 | 3300005367 | Bacteria | 2986 |
| 40 | Ga0070667_100206502 | 3300005367 | Bacteria | 1744 |
| 41 | Ga0070714_100016514 | 3300005435 | Bacteria | 5964 |
| 42 | Ga0070714_100092138 | 3300005435 | Bacteria | 2656 |
| 43 | Ga0070713_100013669 | 3300005436 | Bacteria | 6000 |
| 44 | Ga0070701_10010922 | 3300005438 | Bacteria | 4036 |
| 45 | Ga0070711_100000479 | 3300005439 | Bacteria | 20826 |
| 46 | Ga0070711_100046250 | 3300005439 | Bacteria | 2964 |
| 47 | Ga0070705_100100131 | 3300005440 | Bacteria | 1828 |
| 48 | Ga0070700_100013522 | 3300005441 | Bacteria | 4585 |
| 49 | Ga0070694_100022680 | 3300005444 | Bacteria | 4025 |
| 50 | Ga0070663_100003214 | 3300005455 | Bacteria | 9390 |
| 51 | Ga0070678_100000595 | 3300005456 | Bacteria | 17762 |
| 52 | Ga0070678_100010151 | 3300005456 | Bacteria | 5737 |
| 53 | Ga0070678_100063757 | 3300005456 | Bacteria | 2728 |
| 54 | Ga0070662_100012622 | 3300005457 | Bacteria | 5605 |
| 55 | Ga0070662_100151791 | 3300005457 | Bacteria | 1804 |
| 56 | Ga0068867_100001973 | 3300005459 | Bacteria | 14304 |
| 57 | Ga0068867_100011061 | 3300005459 | Bacteria | 6365 |
| 58 | Ga0070697_100305112 | 3300005536 | Bacteria | 1369 |
| 59 | Ga0068853_100079851 | 3300005539 | Bacteria | 2861 |
| 60 | Ga0068853_100334730 | 3300005539 | Bacteria | 1405 |
| 61 | Ga0070696_100012568 | 3300005546 | Bacteria | 5685 |
| 62 | Ga0070696_100057899 | 3300005546 | Bacteria | 2705 |
| 63 | Ga0070696_100180892 | 3300005546 | Bacteria | 1564 |
| 64 | Ga0070693_100029203 | 3300005547 | Bacteria | 3006 |
| 65 | Ga0070693_100151159 | 3300005547 | Bacteria | 1471 |
| 66 | Ga0070665_100003609 | 3300005548 | Bacteria | 16390 |
| 67 | Ga0070665_100005707 | 3300005548 | Bacteria | 12778 |
| 68 | Ga0070665_100286620 | 3300005548 | Bacteria | 1649 |
| 69 | Ga0070704_100000666 | 3300005549 | Bacteria | 16615 |
| 70 | Ga0068855_100305947 | 3300005563 | Bacteria | 1760 |
| 71 | Ga0068854_100003429 | 3300005578 | Bacteria | 9883 |
| 72 | Ga0068854_100068457 | 3300005578 | Bacteria | 2589 |
| 73 | Ga0070702_100013285 | 3300005615 | Bacteria | 4154 |
| 74 | Ga0068852_100025822 | 3300005616 | Bacteria | 4765 |
| 75 | Ga0068852_100131202 | 3300005616 | Bacteria | 2308 |
| 76 | Ga0068852_100288684 | 3300005616 | Bacteria | 1584 |
| 77 | Ga0068859_100000567 | 3300005617 | Bacteria | 36774 |
| 78 | Ga0068859_100089377 | 3300005617 | Bacteria | 3130 |
| 79 | Ga0068859_100104384 | 3300005617 | Bacteria | 2893 |
| 80 | Ga0068864_100149884 | 3300005618 | Bacteria | 2112 |
| 81 | Ga0068864_100294245 | 3300005618 | Bacteria | 1518 |
| 82 | Ga0068866_10001353 | 3300005718 | Bacteria | 10600 |
| 83 | Ga0068866_10014282 | 3300005718 | Bacteria | 3503 |
| 84 | Ga0068866_10048584 | 3300005718 | Bacteria | 2146 |
| 85 | Ga0068861_100009323 | 3300005719 | Bacteria | 6774 |
| 86 | Ga0068861_100033053 | 3300005719 | Bacteria | 3814 |
| 87 | Ga0068861_100037442 | 3300005719 | Bacteria | 3606 |
| 88 | Ga0068861_100115039 | 3300005719 | Bacteria | 2161 |
| 89 | Ga0068861_100116822 | 3300005719 | Bacteria | 2146 |
| 90 | Ga0068870_10199720 | 3300005840 | Bacteria | 1212 |
| 91 | Ga0068863_100001963 | 3300005841 | Bacteria | 20438 |
| 92 | Ga0068863_100002994 | 3300005841 | Bacteria | 16700 |
| 93 | Ga0068863_100020977 | 3300005841 | Bacteria | 6241 |
| 94 | Ga0068863_100381004 | 3300005841 | Bacteria | 1377 |
| 95 | Ga0068858_100015481 | 3300005842 | Bacteria | 7172 |
| 96 | Ga0068858_100186781 | 3300005842 | Bacteria | 1958 |
| 97 | Ga0068858_100295206 | 3300005842 | Bacteria | 1545 |
| 98 | Ga0068860_100000276 | 3300005843 | Bacteria | 74447 |
| 99 | Ga0068860_100011255 | 3300005843 | Bacteria | 8817 |
| 100 | Ga0068860_100096650 | 3300005843 | Bacteria | 2815 |
| 101 | Ga0068860_100161095 | 3300005843 | Bacteria | 2163 |
| 102 | Ga0068862_100000065 | 3300005844 | Bacteria | 124435 |
| 103 | Ga0068862_100014128 | 3300005844 | Bacteria | 6621 |
| 104 | Ga0068862_100080181 | 3300005844 | Bacteria | 2830 |
| 105 | Ga0068862_100271605 | 3300005844 | Bacteria | 1551 |
| 106 | Ga0081455_10028642 | 3300005937 | Bacteria | 5088 |
| 107 | Ga0081455_10047021 | 3300005937 | Bacteria | 3740 |
| 108 | Ga0081455_10057811 | 3300005937 | Bacteria | 3285 |
| 109 | Ga0081538_10114330 | 3300005981 | Bacteria | 1315 |
| 110 | Ga0075365_10004777 | 3300006038 | Bacteria | 7227 |
| 111 | Ga0075365_10005852 | 3300006038 | Bacteria | 6686 |
| 112 | Ga0075365_10035342 | 3300006038 | Bacteria | 3232 |
| 113 | Ga0075368_10030780 | 3300006042 | Bacteria | 2079 |
| 114 | Ga0075363_100000288 | 3300006048 | Bacteria | 14614 |
| 115 | Ga0075363_100002561 | 3300006048 | Bacteria | 7472 |
| 116 | Ga0075363_100004789 | 3300006048 | Bacteria | 5967 |
| 117 | Ga0075363_100016783 | 3300006048 | Bacteria | 3620 |
| 118 | Ga0075363_100021825 | 3300006048 | Bacteria | 3231 |
| 119 | Ga0075363_100174617 | 3300006048 | Bacteria | 1221 |
| 120 | Ga0075363_100189972 | 3300006048 | Bacteria | 1171 |
| 121 | Ga0075364_10001329 | 3300006051 | Bacteria | 13298 |
| 122 | Ga0075364_10003515 | 3300006051 | Bacteria | 8921 |
| 123 | Ga0075364_10012633 | 3300006051 | Bacteria | 5172 |
| 124 | Ga0075364_10015309 | 3300006051 | Bacteria | 4755 |
| 125 | Ga0070715_10004540 | 3300006163 | Bacteria | 4567 |
| 126 | Ga0070715_10089612 | 3300006163 | Bacteria | 1412 |
| 127 | Ga0070716_100270296 | 3300006173 | Bacteria | 1168 |
| 128 | Ga0075369_10001566 | 3300006186 | Bacteria | 7846 |
| 129 | Ga0075369_10003619 | 3300006186 | Bacteria | 5642 |
| 130 | Ga0075369_10010696 | 3300006186 | Bacteria | 3595 |
| 131 | Ga0075369_10016833 | 3300006186 | Bacteria | 2956 |
| 132 | Ga0075369_10031663 | 3300006186 | Bacteria | 2234 |
| 133 | Ga0097621_100096848 | 3300006237 | Bacteria | 2476 |
| 134 | Ga0075370_10006073 | 3300006353 | Bacteria | 6052 |
| 135 | Ga0075370_10026266 | 3300006353 | Bacteria | 3225 |
| 136 | Ga0075370_10084524 | 3300006353 | Bacteria | 1826 |
| 137 | Ga0068871_100021812 | 3300006358 | Bacteria | 4929 |
| 138 | Ga0075428_100096970 | 3300006844 | Bacteria | 3214 |
| 139 | Ga0075430_100003713 | 3300006846 | Bacteria | 12831 |
| 140 | Ga0068865_100004490 | 3300006881 | Bacteria | 8423 |
| 141 | Ga0068865_100010272 | 3300006881 | Bacteria | 5823 |
| 142 | Ga0068865_100075469 | 3300006881 | Bacteria | 2404 |
| 143 | Ga0097620_100000567 | 3300006931 | Bacteria | 36774 |
| 144 | Ga0097620_100089380 | 3300006931 | Bacteria | 3130 |
| 145 | Ga0097620_100104382 | 3300006931 | Bacteria | 2893 |
| 146 | Ga0099795_10024563 | 3300007788 | Bacteria | 2012 |
| 147 | Ga0105240_10362074 | 3300009093 | Bacteria | 1642 |
| 148 | Ga0111539_10254263 | 3300009094 | Bacteria | 2046 |
| 149 | Ga0105245_10004418 | 3300009098 | Bacteria | 12440 |
| 150 | Ga0105245_10027287 | 3300009098 | Bacteria | 5031 |
| 151 | Ga0105245_10047008 | 3300009098 | Bacteria | 3858 |
| 152 | Ga0105245_10121636 | 3300009098 | Bacteria | 2439 |
| 153 | Ga0105247_10000017 | 3300009101 | Bacteria | 260438 |
| 154 | Ga0105247_10002837 | 3300009101 | Bacteria | 11562 |
| 155 | Ga0105247_10007735 | 3300009101 | Bacteria | 6577 |
| 156 | Ga0105247_10012541 | 3300009101 | Bacteria | 5091 |
| 157 | Ga0105247_10031858 | 3300009101 | Bacteria | 3201 |
| 158 | Ga0114129_10042705 | 3300009147 | Bacteria | 6382 |
| 159 | Ga0105241_10083795 | 3300009174 | Bacteria | 2502 |
| 160 | Ga0105242_10001113 | 3300009176 | Bacteria | 21179 |
| 161 | Ga0105242_10159454 | 3300009176 | Bacteria | 1973 |
| 162 | Ga0105248_10000849 | 3300009177 | Bacteria | 34381 |
| 163 | Ga0105248_10003348 | 3300009177 | Bacteria | 17817 |
| 164 | Ga0105248_10015685 | 3300009177 | Bacteria | 8350 |
| 165 | Ga0105248_10019251 | 3300009177 | Bacteria | 7553 |
| 166 | Ga0105248_10024808 | 3300009177 | Bacteria | 6668 |
| 167 | Ga0105248_10098526 | 3300009177 | Bacteria | 3293 |
| 168 | Ga0105238_10066892 | 3300009551 | Bacteria | 3594 |
| 169 | Ga0105249_10000096 | 3300009553 | Bacteria | 121083 |
| 170 | Ga0105249_10001976 | 3300009553 | Bacteria | 17791 |
| 171 | Ga0105249_10021366 | 3300009553 | Bacteria | 5794 |
| 172 | Ga0105249_10504700 | 3300009553 | Bacteria | 1255 |
| 173 | Ga0099796_10044303 | 3300010159 | Bacteria | 1519 |
| 174 | Ga0105239_10009981 | 3300010375 | Bacteria | 10657 |
| 175 | Ga0105239_10010576 | 3300010375 | Bacteria | 10315 |
| 176 | Ga0105239_10053334 | 3300010375 | Bacteria | 4436 |
| 177 | Ga0105239_10123927 | 3300010375 | Bacteria | 2871 |
| 178 | Ga0105239_10128759 | 3300010375 | Bacteria | 2814 |
| 179 | Ga0105239_10345408 | 3300010375 | Bacteria | 1680 |
| 180 | Ga0157369_10240144 | 3300013105 | Bacteria | 1893 |
| 181 | Ga0157374_10020714 | 3300013296 | Bacteria | 5838 |
| 182 | Ga0157374_10124598 | 3300013296 | Bacteria | 2490 |
| 183 | Ga0157374_10196180 | 3300013296 | Bacteria | 1976 |
| 184 | Ga0157378_10009136 | 3300013297 | Bacteria | 8626 |
| 185 | Ga0157378_10030415 | 3300013297 | Bacteria | 4772 |
| 186 | Ga0157378_10201189 | 3300013297 | Bacteria | 1884 |
| 187 | Ga0163162_10013602 | 3300013306 | Bacteria | 7950 |
| 188 | Ga0163162_10031526 | 3300013306 | Bacteria | 5258 |
| 189 | Ga0163162_10048516 | 3300013306 | Bacteria | 4255 |
| 190 | Ga0163162_10066920 | 3300013306 | Bacteria | 3642 |
| 191 | Ga0163162_10314316 | 3300013306 | Bacteria | 1699 |
| 192 | Ga0157372_10007458 | 3300013307 | Bacteria | 11634 |
| 193 | Ga0157372_10111308 | 3300013307 | Bacteria | 3137 |
| 194 | Ga0157372_10267066 | 3300013307 | Bacteria | 1987 |
| 195 | Ga0157372_10747585 | 3300013307 | Bacteria | 1137 |
| 196 | Ga0157375_10012726 | 3300013308 | Bacteria | 7468 |
| 197 | Ga0157375_10059931 | 3300013308 | Bacteria | 3773 |
| 198 | Ga0157375_10708006 | 3300013308 | Bacteria | 1160 |
| 199 | Ga0163163_10016950 | 3300014325 | Bacteria | 6782 |
| 200 | Ga0163163_10072408 | 3300014325 | Bacteria | 3435 |
| 201 | Ga0157380_10000771 | 3300014326 | Bacteria | 20026 |
| 202 | Ga0157380_10038702 | 3300014326 | Bacteria | 3704 |
| 203 | Ga0157380_10073612 | 3300014326 | Bacteria | 2771 |
| 204 | Ga0157377_10028544 | 3300014745 | Bacteria | 3004 |
| 205 | Ga0157379_10006231 | 3300014968 | Bacteria | 10271 |
| 206 | Ga0157379_10014378 | 3300014968 | Bacteria | 6944 |
| 207 | Ga0163161_10002358 | 3300017792 | Bacteria | 13536 |
| 208 | Ga0163161_10049212 | 3300017792 | Bacteria | 3046 |
| 209 | Ga0213876_10004977 | 3300021384 | Bacteria | 7345 |
| 210 | Ga0213876_10016221 | 3300021384 | Bacteria | 3938 |
| 211 | Ga0213876_10089655 | 3300021384 | Bacteria | 1629 |
| 212 | Ga0209051_1000051 | 3300025303 | Bacteria | 283620 |
| 213 | Ga0207697_10082121 | 3300025315 | Bacteria | 1358 |
| 214 | Ga0207692_10031217 | 3300025898 | Bacteria | 2549 |
| 215 | Ga0207692_10047737 | 3300025898 | Bacteria | 2151 |
| 216 | Ga0207642_10000124 | 3300025899 | Bacteria | 21177 |
| 217 | Ga0207642_10004529 | 3300025899 | Bacteria | 4489 |
| 218 | Ga0207710_10000033 | 3300025900 | Bacteria | 260531 |
| 219 | Ga0207710_10003442 | 3300025900 | Bacteria | 7059 |
| 220 | Ga0207710_10006703 | 3300025900 | Bacteria | 4908 |
| 221 | Ga0207710_10021356 | 3300025900 | Bacteria | 2774 |
| 222 | Ga0207688_10002685 | 3300025901 | Bacteria | 9627 |
| 223 | Ga0207688_10008511 | 3300025901 | Bacteria | 5585 |
| 224 | Ga0207688_10122961 | 3300025901 | Bacteria | 1516 |
| 225 | Ga0207680_10084105 | 3300025903 | Bacteria | 2007 |
| 226 | Ga0207647_10014995 | 3300025904 | Bacteria | 5326 |
| 227 | Ga0207647_10060212 | 3300025904 | Bacteria | 2321 |
| 228 | Ga0207685_10006064 | 3300025905 | Bacteria | 3257 |
| 229 | Ga0207685_10029080 | 3300025905 | Bacteria | 1953 |
| 230 | Ga0207699_10254478 | 3300025906 | Bacteria | 1211 |
| 231 | Ga0207645_10023243 | 3300025907 | Bacteria | 4029 |
| 232 | Ga0207645_10170548 | 3300025907 | Bacteria | 1426 |
| 233 | Ga0207643_10101699 | 3300025908 | Bacteria | 1686 |
| 234 | Ga0207693_10001826 | 3300025915 | Bacteria | 18674 |
| 235 | Ga0207693_10018382 | 3300025915 | Bacteria | 5568 |
| 236 | Ga0207663_10002536 | 3300025916 | Bacteria | 8787 |
| 237 | Ga0207663_10021386 | 3300025916 | Bacteria | 3682 |
| 238 | Ga0207663_10093628 | 3300025916 | Bacteria | 2000 |
| 239 | Ga0207662_10005313 | 3300025918 | Bacteria | 6849 |
| 240 | Ga0207662_10027919 | 3300025918 | Bacteria | 3259 |
| 241 | Ga0207657_10040977 | 3300025919 | Bacteria | 4099 |
| 242 | Ga0207681_10000849 | 3300025923 | Bacteria | 20076 |
| 243 | Ga0207681_10058079 | 3300025923 | Bacteria | 2647 |
| 244 | Ga0207681_10079363 | 3300025923 | Bacteria | 2312 |
| 245 | Ga0207694_10101613 | 3300025924 | Bacteria | 2279 |
| 246 | Ga0207687_10003894 | 3300025927 | Bacteria | 10024 |
| 247 | Ga0207687_10006582 | 3300025927 | Bacteria | 7663 |
| 248 | Ga0207700_10054780 | 3300025928 | Bacteria | 2995 |
| 249 | Ga0207664_10088444 | 3300025929 | Bacteria | 2535 |
| 250 | Ga0207664_10208304 | 3300025929 | Bacteria | 1691 |
| 251 | Ga0207664_10248421 | 3300025929 | Bacteria | 1552 |
| 252 | Ga0207644_10002040 | 3300025931 | Bacteria | 13075 |
| 253 | Ga0207644_10109696 | 3300025931 | Bacteria | 2085 |
| 254 | Ga0207690_10142329 | 3300025932 | Bacteria | 1769 |
| 255 | Ga0207690_10186659 | 3300025932 | Bacteria | 1565 |
| 256 | Ga0207706_10005962 | 3300025933 | Bacteria | 11336 |
| 257 | Ga0207706_10007441 | 3300025933 | Bacteria | 10127 |
| 258 | Ga0207686_10006545 | 3300025934 | Bacteria | 6273 |
| 259 | Ga0207686_10063612 | 3300025934 | Bacteria | 2347 |
| 260 | Ga0207709_10006328 | 3300025935 | Bacteria | 6646 |
| 261 | Ga0207669_10001327 | 3300025937 | Bacteria | 10535 |
| 262 | Ga0207669_10002064 | 3300025937 | Bacteria | 8507 |
| 263 | Ga0207669_10017133 | 3300025937 | Bacteria | 3706 |
| 264 | Ga0207669_10091587 | 3300025937 | Bacteria | 1981 |
| 265 | Ga0207704_10000291 | 3300025938 | Bacteria | 23769 |
| 266 | Ga0207704_10012701 | 3300025938 | Bacteria | 4185 |
| 267 | Ga0207704_10013973 | 3300025938 | Bacteria | 4040 |
| 268 | Ga0207704_10069343 | 3300025938 | Bacteria | 2227 |
| 269 | Ga0207704_10229532 | 3300025938 | Bacteria | 1379 |
| 270 | Ga0207665_10001751 | 3300025939 | Bacteria | 14560 |
| 271 | Ga0207665_10009444 | 3300025939 | Bacteria | 6401 |
| 272 | Ga0207665_10232623 | 3300025939 | Bacteria | 1355 |
| 273 | Ga0207691_10054294 | 3300025940 | Bacteria | 3655 |
| 274 | Ga0207711_10000661 | 3300025941 | Bacteria | 34348 |
| 275 | Ga0207711_10022005 | 3300025941 | Bacteria | 5327 |
| 276 | Ga0207711_10078440 | 3300025941 | Bacteria | 2881 |
| 277 | Ga0207711_10087903 | 3300025941 | Bacteria | 2728 |
| 278 | Ga0207689_10011177 | 3300025942 | Bacteria | 7703 |
| 279 | Ga0207689_10019152 | 3300025942 | Bacteria | 5770 |
| 280 | Ga0207689_10037450 | 3300025942 | Bacteria | 4023 |
| 281 | Ga0207667_10153951 | 3300025949 | Bacteria | 2366 |
| 282 | Ga0207651_10314517 | 3300025960 | Bacteria | 1307 |
| 283 | Ga0207712_10000005 | 3300025961 | Bacteria | 608697 |
| 284 | Ga0207712_10005062 | 3300025961 | Bacteria | 8346 |
| 285 | Ga0207712_10066011 | 3300025961 | Bacteria | 2585 |
| 286 | Ga0207668_10003268 | 3300025972 | Bacteria | 9504 |
| 287 | Ga0207668_10053615 | 3300025972 | Bacteria | 2795 |
| 288 | Ga0207668_10122312 | 3300025972 | Bacteria | 1973 |
| 289 | Ga0207668_10165121 | 3300025972 | Bacteria | 1730 |
| 290 | Ga0207668_10247697 | 3300025972 | Bacteria | 1445 |
| 291 | Ga0207668_10334802 | 3300025972 | Bacteria | 1260 |
| 292 | Ga0207640_10005157 | 3300025981 | Bacteria | 7105 |
| 293 | Ga0207640_10012242 | 3300025981 | Bacteria | 4882 |
| 294 | Ga0207640_10023783 | 3300025981 | Bacteria | 3687 |
| 295 | Ga0207658_10000321 | 3300025986 | Bacteria | 48316 |
| 296 | Ga0207658_10000743 | 3300025986 | Bacteria | 28083 |
| 297 | Ga0207658_10002978 | 3300025986 | Bacteria | 12110 |
| 298 | Ga0207658_10014287 | 3300025986 | Bacteria | 5437 |
| 299 | Ga0207658_10029027 | 3300025986 | Bacteria | 3901 |
| 300 | Ga0207658_10049977 | 3300025986 | Bacteria | 3075 |
| 301 | Ga0207658_10210426 | 3300025986 | Bacteria | 1629 |
| 302 | Ga0207677_10005648 | 3300026023 | Bacteria | 6802 |
| 303 | Ga0207677_10070154 | 3300026023 | Bacteria | 2468 |
| 304 | Ga0207677_10107477 | 3300026023 | Bacteria | 2069 |
| 305 | Ga0207677_10228607 | 3300026023 | Bacteria | 1497 |
| 306 | Ga0207703_10010452 | 3300026035 | Bacteria | 7258 |
| 307 | Ga0207703_10076965 | 3300026035 | Bacteria | 2768 |
| 308 | Ga0207703_10139183 | 3300026035 | Bacteria | 2105 |
| 309 | Ga0207703_10177155 | 3300026035 | Bacteria | 1879 |
| 310 | Ga0207639_10002547 | 3300026041 | Bacteria | 12235 |
| 311 | Ga0207639_10086487 | 3300026041 | Bacteria | 2496 |
| 312 | Ga0207678_10008103 | 3300026067 | Bacteria | 9266 |
| 313 | Ga0207678_10011314 | 3300026067 | Bacteria | 7831 |
| 314 | Ga0207678_10023448 | 3300026067 | Bacteria | 5398 |
| 315 | Ga0207678_10232424 | 3300026067 | Bacteria | 1579 |
| 316 | Ga0207708_10002264 | 3300026075 | Bacteria | 14185 |
| 317 | Ga0207702_10086975 | 3300026078 | Bacteria | 2727 |
| 318 | Ga0207641_10001342 | 3300026088 | Bacteria | 24372 |
| 319 | Ga0207641_10005082 | 3300026088 | Bacteria | 11277 |
| 320 | Ga0207641_10256282 | 3300026088 | Bacteria | 1636 |
| 321 | Ga0207648_10002008 | 3300026089 | Bacteria | 22201 |
| 322 | Ga0207648_10159828 | 3300026089 | Bacteria | 1990 |
| 323 | Ga0207675_100003453 | 3300026118 | Bacteria | 15445 |
| 324 | Ga0207675_100003650 | 3300026118 | Bacteria | 14998 |
| 325 | Ga0207675_100041689 | 3300026118 | Bacteria | 4286 |
| 326 | Ga0207675_100051444 | 3300026118 | Bacteria | 3844 |
| 327 | Ga0207675_100196042 | 3300026118 | Bacteria | 1938 |
| 328 | Ga0207675_100259950 | 3300026118 | Bacteria | 1682 |
| 329 | Ga0207683_10003523 | 3300026121 | Bacteria | 13651 |
| 330 | Ga0207683_10073010 | 3300026121 | Bacteria | 3035 |
| 331 | Ga0207683_10085918 | 3300026121 | Bacteria | 2797 |
| 332 | Ga0207698_10010560 | 3300026142 | Bacteria | 5944 |
| 333 | Ga0207698_10063478 | 3300026142 | Bacteria | 2891 |
| 334 | Ga0207698_10212030 | 3300026142 | Bacteria | 1743 |
| 335 | Ga0268266_10002162 | 3300028379 | Bacteria | 21575 |
| 336 | Ga0268266_10014326 | 3300028379 | Bacteria | 6818 |
| 337 | Ga0268266_10042535 | 3300028379 | Bacteria | 3881 |
| 338 | Ga0268265_10000022 | 3300028380 | Bacteria | 270788 |
| 339 | Ga0268265_10055693 | 3300028380 | Bacteria | 3005 |
| 340 | Ga0268265_10065580 | 3300028380 | Bacteria | 2803 |
| 341 | Ga0268265_10102008 | 3300028380 | Bacteria | 2319 |
| 342 | Ga0268265_10104994 | 3300028380 | Bacteria | 2291 |
| 343 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 344 | Ga0268264_10002955 | 3300028381 | Bacteria | 14764 |
| 345 | Ga0268264_10074422 | 3300028381 | Bacteria | 2885 |
| 346 | Ga0268264_10095476 | 3300028381 | Bacteria | 2573 |
| 347 | Ga0265327_10005197 | 3300031251 | Bacteria | 11000 |
| 348 | Ga0307410_10022955 | 3300031852 | Bacteria | 3868 |
| 349 | Ga0307409_100055133 | 3300031995 | Bacteria | 3067 |
| 350 | Ga0307416_100090236 | 3300032002 | Bacteria | 2627 |
| 351 | Ga0307414_10110941 | 3300032004 | Bacteria | 2088 |
| 352 | Ga0373938_0022222 | 3300034957 | Bacteria | 1294 |
| 353 | Ga0373940_0040709 | 3300035088 | Bacteria | 1276 |
| 354 | Ga0373952_0030916 | 3300035092 | Bacteria | 1188 |
| 355 | Ga0373932_0018190 | 3300035112 | Bacteria | 1814 |
| 356 | Ga0373939_0007230 | 3300035114 | Bacteria | 2694 |
| 357 | Ga0373960_0015951 | 3300035121 | Bacteria | 1926 |
| 358 | Ga0373962_0051657 | 3300035242 | Bacteria | 1186 |
| 359 | Ga0373931_0023757 | 3300035691 | Bacteria | 3097 |
| 360 | Ga0436364_0166911 | 3300037853 | Bacteria | 14228 |
| 361 | Ga0436364_0255571 | 3300037853 | Bacteria | 10196 |
| 362 | Ga0436364_1311241 | 3300037853 | Bacteria | 1478 |
| 363 | Ga0436365_0200358 | 3300039437 | Bacteria | 1933 |
| 364 | Ga0436365_0484364 | 3300039437 | Bacteria | 53953 |
| 365 | Ga0436365_0790831 | 3300039437 | Bacteria | 15194 |
| 366 | Ga0436365_0818913 | 3300039437 | Bacteria | 6536 |
| 367 | Ga0439466_0061507 | 3300041411 | Bacteria | 1208 |
| 368 | Ga0439465_0000060 | 3300041413 | Bacteria | 23285 |
| 369 | Ga0439465_0016772 | 3300041413 | Bacteria | 2285 |
| 370 | Ga0451853_0790618 | 3300041512 | Bacteria | 1530 |
| 371 | Ga0439431_0003250 | 3300041997 | Bacteria | 3576 |
| 372 | Ga0439445_0001642 | 3300042004 | Bacteria | 4897 |
| 373 | Ga0439448_0001700 | 3300042005 | Bacteria | 5793 |
| 374 | Ga0439434_0007526 | 3300042435 | Bacteria | 3191 |
| 375 | Ga0439434_0027662 | 3300042435 | Bacteria | 1715 |
| 376 | Ga0466969_0017537 | 3300044656 | Bacteria | 3736 |
| 377 | Ga0466972_0025748 | 3300044658 | Bacteria | 2914 |
| 378 | Ga0466965_0010739 | 3300044683 | Bacteria | 4281 |
| 379 | Ga0466965_0013560 | 3300044683 | Bacteria | 3847 |
| 380 | Ga0466965_0054711 | 3300044683 | Bacteria | 1985 |
| 381 | Ga0466966_0007209 | 3300044684 | Bacteria | 7371 |
| 382 | Ga0466966_0069996 | 3300044684 | Bacteria | 2200 |
| 383 | Ga0466966_0113204 | 3300044684 | Bacteria | 1671 |
| 384 | Ga0466966_0118801 | 3300044684 | Bacteria | 1625 |
| 385 | Ga0466961_0000574 | 3300044693 | Bacteria | 23346 |
| 386 | Ga0466961_0003256 | 3300044693 | Bacteria | 10107 |
| 387 | Ga0466963_0000149 | 3300044694 | Bacteria | 27892 |
| 388 | Ga0466963_0002039 | 3300044694 | Bacteria | 11121 |
| 389 | Ga0466971_0001937 | 3300044719 | Bacteria | 8782 |
| 390 | Ga0466971_0010315 | 3300044719 | Bacteria | 4081 |
| 391 | Ga0466971_0054127 | 3300044719 | Bacteria | 1808 |
| 392 | Ga0466968_0000969 | 3300044735 | Bacteria | 10088 |
| 393 | Ga0466968_0023062 | 3300044735 | Bacteria | 2534 |
| 394 | Ga0466968_0023100 | 3300044735 | Bacteria | 2531 |
| 395 | Ga0466968_0044461 | 3300044735 | Bacteria | 1882 |
| 396 | Ga0466970_0012473 | 3300044765 | Bacteria | 4346 |
| 397 | Ga0466970_0021984 | 3300044765 | Bacteria | 3328 |
| 398 | Ga0466957_0001716 | 3300044842 | Bacteria | 11531 |
| 399 | Ga0466960_0000298 | 3300044901 | Bacteria | 17254 |
| 400 | Ga0466960_0000457 | 3300044901 | Bacteria | 13982 |
| 401 | Ga0466960_0004198 | 3300044901 | Bacteria | 5600 |
| 402 | Ga0466959_0006355 | 3300045049 | Bacteria | 8177 |
| 403 | Ga0466959_0037964 | 3300045049 | Bacteria | 3560 |
| 404 | Ga0466959_0051753 | 3300045049 | Bacteria | 3010 |
| 405 | Ga0466958_0009576 | 3300045836 | Bacteria | 5403 |
| 406 | Ga0466958_0037843 | 3300045836 | Bacteria | 2892 |
| 407 | Ga0466967_0001069 | 3300045976 | Bacteria | 15118 |
| 408 | Ga0466967_0004355 | 3300045976 | Bacteria | 9530 |
| 409 | Ga0466967_0019670 | 3300045976 | Bacteria | 5437 |
| 410 | Ga0466967_0124981 | 3300045976 | Bacteria | 2382 |
| 411 | Ga0466967_0175167 | 3300045976 | Bacteria | 2021 |
| 412 | Ga0495629_0017955 | 3300046459 | Bacteria | 5071 |
| 413 | Ga0495638_0006500 | 3300046460 | Bacteria | 8500 |
| 414 | Ga0495638_0036648 | 3300046460 | Bacteria | 3123 |
| 415 | Ga0495641_0006709 | 3300046461 | Bacteria | 7397 |
| 416 | Ga0495641_0075763 | 3300046461 | Bacteria | 1508 |
| 417 | Ga0495594_0070383 | 3300046499 | Bacteria | 1945 |
| 418 | Ga0495630_0129607 | 3300046517 | Bacteria | 1915 |
| 419 | Ga0495648_0018611 | 3300046524 | Bacteria | 4909 |
| 420 | Ga0495652_0147064 | 3300046529 | Bacteria | 1846 |
| 421 | Ga0495654_0079693 | 3300046530 | Bacteria | 1538 |
| 422 | Ga0495665_0034359 | 3300046531 | Bacteria | 2711 |
| 423 | Ga0495611_0034171 | 3300046648 | Bacteria | 2247 |
| 424 | Ga0495613_0178529 | 3300046689 | Bacteria | 1504 |
| 425 | Ga0495671_0063697 | 3300046692 | Bacteria | 1816 |
| 426 | Ga0495649_0114982 | 3300046694 | Bacteria | 1425 |
| 427 | Ga0495581_0012422 | 3300047315 | Bacteria | 4933 |
| 428 | Ga0495604_0041713 | 3300047317 | Bacteria | 3598 |
| 429 | Ga0495674_0031488 | 3300047319 | Bacteria | 4819 |
| 430 | Ga0495672_0004144 | 3300047320 | Bacteria | 12050 |
| 431 | Ga0495672_0022122 | 3300047320 | Bacteria | 4138 |
| 432 | Ga0495672_0179321 | 3300047320 | Bacteria | 1074 |
| 433 | Ga0495676_0185699 | 3300047321 | Bacteria | 1454 |
| 434 | Ga0495683_0001402 | 3300047323 | Bacteria | 15917 |
| 435 | Ga0495675_0004548 | 3300047444 | Bacteria | 8406 |
| 436 | Ga0495673_0002432 | 3300047469 | Bacteria | 13116 |
| 437 | Ga0496100_0000212 | 3300048903 | Bacteria | 32179 |
| 438 | Ga0496100_0005227 | 3300048903 | Bacteria | 6972 |
| 439 | Ga0496100_0006724 | 3300048903 | Bacteria | 6296 |
| 440 | Ga0496100_0009399 | 3300048903 | Bacteria | 5496 |
| 441 | Ga0496100_0057022 | 3300048903 | Bacteria | 2557 |
| 442 | Ga0496100_0088963 | 3300048903 | Bacteria | 2103 |
| 443 | Ga0496101_0000020 | 3300048904 | Bacteria | 218859 |
| 444 | Ga0496101_0000075 | 3300048904 | Bacteria | 112785 |
| 445 | Ga0496101_0000310 | 3300048904 | Bacteria | 33833 |
| 446 | Ga0496101_0001415 | 3300048904 | Bacteria | 14347 |
| 447 | Ga0496101_0026246 | 3300048904 | Bacteria | 4050 |
| 448 | Ga0496101_0041333 | 3300048904 | Bacteria | 3287 |
| 449 | Ga0496101_0043559 | 3300048904 | Bacteria | 3208 |
| 450 | Ga0496101_0059960 | 3300048904 | Bacteria | 2759 |
| 451 | Ga0496101_0105590 | 3300048904 | Bacteria | 2114 |
| 452 | Ga0496102_0000003 | 3300048905 | Bacteria | 592263 |
| 453 | Ga0496102_0000415 | 3300048905 | Bacteria | 49294 |
| 454 | Ga0496102_0004064 | 3300048905 | Bacteria | 12406 |
| 455 | Ga0496102_0004363 | 3300048905 | Bacteria | 11952 |
| 456 | Ga0496102_0060517 | 3300048905 | Bacteria | 3463 |
| 457 | Ga0496102_0327726 | 3300048905 | Bacteria | 1442 |
| 458 | Ga0496102_0332709 | 3300048905 | Bacteria | 1430 |
| 459 | Ga0496103_0000014 | 3300048906 | Bacteria | 290397 |
| 460 | Ga0496103_0000093 | 3300048906 | Bacteria | 100010 |
| 461 | Ga0496103_0000512 | 3300048906 | Bacteria | 31958 |
| 462 | Ga0496103_0009139 | 3300048906 | Bacteria | 5869 |
| 463 | Ga0496103_0011056 | 3300048906 | Bacteria | 5344 |
| 464 | Ga0496103_0048073 | 3300048906 | Bacteria | 2636 |
| 465 | Ga0496103_0049761 | 3300048906 | Bacteria | 2592 |
| 466 | Ga0496103_0049985 | 3300048906 | Bacteria | 2586 |
| 467 | Ga0496104_0004308 | 3300048907 | Bacteria | 12375 |
| 468 | Ga0496105_0057576 | 3300048908 | Bacteria | 3209 |
| 469 | Ga0496105_0076631 | 3300048908 | Bacteria | 2761 |
| 470 | Ga0496105_0236676 | 3300048908 | Bacteria | 1483 |
| 471 | Ga0496105_0255008 | 3300048908 | Bacteria | 1420 |
| 472 | Ga0496106_0001024 | 3300048909 | Bacteria | 20542 |
| 473 | Ga0496106_0001954 | 3300048909 | Bacteria | 15482 |
| 474 | Ga0496106_0011011 | 3300048909 | Bacteria | 6685 |
| 475 | Ga0496106_0035640 | 3300048909 | Bacteria | 3720 |
| 476 | Ga0496106_0086509 | 3300048909 | Bacteria | 2414 |
| 477 | Ga0496106_0092960 | 3300048909 | Bacteria | 2330 |
| 478 | Ga0496106_0196793 | 3300048909 | Bacteria | 1603 |
| 479 | Ga0496106_0242942 | 3300048909 | Bacteria | 1439 |
| 480 | Ga0496107_0002866 | 3300048910 | Bacteria | 11401 |
| 481 | Ga0496107_0005122 | 3300048910 | Bacteria | 8940 |
| 482 | Ga0496107_0005597 | 3300048910 | Bacteria | 8604 |
| 483 | Ga0496107_0011433 | 3300048910 | Bacteria | 6183 |
| 484 | Ga0496107_0028877 | 3300048910 | Bacteria | 3944 |
| 485 | Ga0496107_0030229 | 3300048910 | Bacteria | 3860 |
| 486 | Ga0496107_0038963 | 3300048910 | Bacteria | 3409 |
| 487 | Ga0496107_0274080 | 3300048910 | Bacteria | 1256 |
| 488 | Ga0496108_0000405 | 3300048911 | Bacteria | 35593 |
| 489 | Ga0496108_0001278 | 3300048911 | Bacteria | 19703 |
| 490 | Ga0496108_0009737 | 3300048911 | Bacteria | 7787 |
| 491 | Ga0496108_0020334 | 3300048911 | Bacteria | 5457 |
| 492 | Ga0496108_0055522 | 3300048911 | Bacteria | 3326 |
| 493 | Ga0496108_0063089 | 3300048911 | Bacteria | 3120 |
| 494 | Ga0496109_0002338 | 3300048912 | Bacteria | 15809 |
| 495 | Ga0496109_0081314 | 3300048912 | Bacteria | 2985 |
| 496 | Ga0496109_0084265 | 3300048912 | Bacteria | 2932 |
| 497 | Ga0496110_0013722 | 3300048913 | Bacteria | 6712 |
| 498 | Ga0496110_0019778 | 3300048913 | Bacteria | 5672 |
| 499 | Ga0496110_0121966 | 3300048913 | Bacteria | 2349 |
| 500 | Ga0496110_0150566 | 3300048913 | Bacteria | 2107 |
| 501 | Ga0496110_0488440 | 3300048913 | Bacteria | 1122 |
| 502 | Ga0496111_0138468 | 3300048914 | Bacteria | 1803 |
| 503 | Ga0496111_0185588 | 3300048914 | Bacteria | 1546 |
| 504 | Ga0496112_0003670 | 3300048915 | Bacteria | 12794 |
| 505 | Ga0496112_0019065 | 3300048915 | Bacteria | 6467 |
| 506 | Ga0496112_0041498 | 3300048915 | Bacteria | 4503 |
| 507 | Ga0496112_0078708 | 3300048915 | Bacteria | 3260 |
| 508 | Ga0496112_0161744 | 3300048915 | Bacteria | 2205 |
| 509 | Ga0496112_0223853 | 3300048915 | Bacteria | 1837 |
| 510 | Ga0496113_0001800 | 3300048916 | Bacteria | 12155 |
| 511 | Ga0496113_0066152 | 3300048916 | Bacteria | 2737 |
| 512 | Ga0496114_0000181 | 3300048917 | Bacteria | 45025 |
| 513 | Ga0496114_0002320 | 3300048917 | Bacteria | 14494 |
| 514 | Ga0496114_0004074 | 3300048917 | Bacteria | 11288 |
| 515 | Ga0496114_0023224 | 3300048917 | Bacteria | 5059 |
| 516 | Ga0496115_0005302 | 3300048918 | Bacteria | 9378 |
| 517 | Ga0496115_0009311 | 3300048918 | Bacteria | 7298 |
| 518 | Ga0496115_0109886 | 3300048918 | Bacteria | 2264 |
| 519 | Ga0496116_0000071 | 3300048919 | Bacteria | 244521 |
| 520 | Ga0496116_0004420 | 3300048919 | Bacteria | 13422 |
| 521 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 522 | Ga0496117_0021358 | 3300048920 | Bacteria | 5240 |
| 523 | Ga0496117_0076871 | 3300048920 | Bacteria | 2211 |
| 524 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 525 | Ga0496118_0000359 | 3300048921 | Bacteria | 77146 |
| 526 | Ga0496118_0000488 | 3300048921 | Bacteria | 65611 |
| 527 | Ga0496118_0004501 | 3300048921 | Bacteria | 16481 |
| 528 | Ga0496119_0000266 | 3300048922 | Bacteria | 74075 |
| 529 | Ga0496119_0002301 | 3300048922 | Bacteria | 21118 |
| 530 | Ga0496119_0002624 | 3300048922 | Bacteria | 19518 |
| 531 | Ga0496120_0000235 | 3300048923 | Bacteria | 94653 |
| 532 | Ga0496120_0001188 | 3300048923 | Bacteria | 33095 |
| 533 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 534 | Ga0496121_0000019 | 3300048924 | Bacteria | 499976 |
| 535 | Ga0496121_0007092 | 3300048924 | Bacteria | 13602 |
| 536 | Ga0496122_0000312 | 3300048925 | Bacteria | 107109 |
| 537 | Ga0496122_0017076 | 3300048925 | Bacteria | 6810 |
| 538 | Ga0496123_0003426 | 3300048926 | Bacteria | 17817 |
| 539 | Ga0496123_0010722 | 3300048926 | Bacteria | 8052 |
| 540 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 541 | Ga0496124_0008699 | 3300048927 | Bacteria | 10555 |
| 542 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 543 | Ga0496125_0027604 | 3300048928 | Bacteria | 5143 |
| 544 | Ga0496125_0061113 | 3300048928 | Bacteria | 3023 |
| 545 | Ga0496126_0000011 | 3300048929 | Bacteria | 744275 |
| 546 | Ga0496126_0000951 | 3300048929 | Bacteria | 49637 |
| 547 | Ga0496126_0003151 | 3300048929 | Bacteria | 21253 |
| 548 | Ga0496126_0003649 | 3300048929 | Bacteria | 19231 |
| 549 | Ga0496126_0268165 | 3300048929 | Bacteria | 1417 |
| 550 | Ga0501032_0000469 | 3300049569 | Bacteria | 32526 |
| 551 | Ga0501032_0021556 | 3300049569 | Bacteria | 4478 |
| 552 | Ga0501034_0009642 | 3300049571 | Bacteria | 10098 |
| 553 | Ga0501034_0011897 | 3300049571 | Bacteria | 9002 |
| 554 | Ga0501036_0016952 | 3300049572 | Bacteria | 6086 |
| 555 | Ga0501037_0000234 | 3300049573 | Bacteria | 47815 |
| 556 | Ga0501038_0004555 | 3300049574 | Bacteria | 12897 |
| 557 | Ga0501039_0000113 | 3300049575 | Bacteria | 54895 |
| 558 | Ga0501043_0000082 | 3300049579 | Bacteria | 84442 |
| 559 | Ga0501047_0008566 | 3300049581 | Bacteria | 9652 |
| 560 | Ga0501047_0097938 | 3300049581 | Bacteria | 2811 |
| 561 | Ga0501070_0001505 | 3300049586 | Bacteria | 20787 |
| 562 | Ga0501070_0029564 | 3300049586 | Bacteria | 4593 |
| 563 | Ga0501080_0138139 | 3300049742 | Bacteria | 2254 |
| 564 | Ga0501035_0056811 | 3300049822 | Bacteria | 3490 |
| 565 | Ga0501044_0003845 | 3300049823 | Bacteria | 16843 |
| 566 | nmdc:mga03683_29631_c1 | 3300050489 | Bacteria | 2183 |
| 567 | nmdc:mga03n38_10904_c1 | 3300050490 | Bacteria | 3366 |
| 568 | nmdc:mga03n38_126601_c1 | 3300050490 | Bacteria | 1261 |
| 569 | nmdc:mga03n38_13589_c1 | 3300050490 | Bacteria | 3098 |
| 570 | nmdc:mga03n38_16498_c1 | 3300050490 | Bacteria | 2873 |
| 571 | nmdc:mga03n38_361_c1 | 3300050490 | Bacteria | 11123 |
| 572 | nmdc:mga03n38_435_c1 | 3300050490 | Bacteria | 10412 |
| 573 | nmdc:mga03n38_53162_c1 | 3300050490 | Bacteria | 1815 |
| 574 | nmdc:mga00v17_27848_c1 | 3300050491 | Bacteria | 3303 |
| 575 | nmdc:mga00v17_5879_c1 | 3300050491 | Bacteria | 6479 |
| 576 | nmdc:mga00v17_6485_c1 | 3300050491 | Bacteria | 6210 |
| 577 | nmdc:mga0yw44_26928_c1 | 3300050492 | Bacteria | 3288 |
| 578 | nmdc:mga0yw44_512_c1 | 3300050492 | Bacteria | 13855 |
| 579 | nmdc:mga0k408_38942_c1 | 3300050493 | Bacteria | 2729 |
| 580 | nmdc:mga06z11_33799_c1 | 3300050494 | Bacteria | 2504 |
| 581 | nmdc:mga07m45_1418_c1 | 3300050496 | Bacteria | 10985 |
| 582 | nmdc:mga07m45_70652_c1 | 3300050496 | Bacteria | 1986 |
| 583 | nmdc:mga05p37_28521_c1 | 3300050507 | Bacteria | 6806 |
| 584 | nmdc:mga0qj67_41963_c1 | 3300050509 | Bacteria | 3600 |
| 585 | nmdc:mga0sz30_11029_c1 | 3300050516 | Bacteria | 3476 |
| 586 | nmdc:mga0sz30_12864_c1 | 3300050516 | Bacteria | 3264 |
| 587 | nmdc:mga0sz30_1921_c1 | 3300050516 | Bacteria | 7424 |
| 588 | nmdc:mga0sz30_3093_c1 | 3300050516 | Bacteria | 5963 |
| 589 | Ga0500610_0006674 | 3300053079 | Bacteria | 4864 |
| 590 | Ga0500635_0012608 | 3300053080 | Bacteria | 2432 |
| 591 | Ga0500635_0018800 | 3300053080 | Bacteria | 2092 |
| 592 | Ga0495655_0007628 | 3300053083 | Bacteria | 2020 |
| 593 | Ga0500643_003479 | 3300053087 | Bacteria | 7573 |
| 594 | Ga0500646_0034793 | 3300053090 | Bacteria | 1398 |
| 595 | Ga0500650_0102349 | 3300053098 | Bacteria | 1340 |
| 596 | Ga0500556_0006131 | 3300053104 | Bacteria | 3409 |
| 597 | Ga0500556_0089210 | 3300053104 | Bacteria | 1175 |
| 598 | Ga0500562_015944 | 3300053108 | Bacteria | 1930 |
| 599 | Ga0500652_009892 | 3300053131 | Bacteria | 3245 |
| 600 | Ga0500652_070942 | 3300053131 | Bacteria | 1443 |
| 601 | Ga0500559_0052838 | 3300053136 | Bacteria | 1797 |
| 602 | Ga0500577_0016682 | 3300053142 | Bacteria | 2322 |
| 603 | Ga0500645_000438 | 3300053730 | Bacteria | 28443 |
| 604 | Ga0466962_0014254 | 3300061719 | Bacteria | 3830 |
| 605 | Ga0466962_0034106 | 3300061719 | Bacteria | 2435 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048904 | Ga0496101_0105590 | Ga0496101_0105590_17_889 | 290 |
| 2 | 3300021384 | Ga0213876_10016221 | Ga0213876_100162212 | 297 |
| 3 | 3300047317 | Ga0495604_0041713 | Ga0495604_0041713_2627_3532 | 300 |
| 4 | 3300061719 | Ga0466962_0014254 | Ga0466962_0014254_12_917 | 301 |
| 5 | 3300039437 | Ga0436365_0818913 | Ga0436365_0818913_3472_4404 | 306 |
| 6 | 3300025315 | Ga0207697_10082121 | Ga0207697_100821211 | 308 |
| 7 | 3300035088 | Ga0373940_0040709 | Ga0373940_0040709_16_993 | 325 |
| 8 | 3300053104 | Ga0500556_0089210 | Ga0500556_0089210_11_1024 | 325 |
| 9 | 3300005347 | Ga0070668_100016794 | Ga0070668_1000167946 | 332 |
| 10 | 3300009553 | Ga0105249_10504700 | Ga0105249_105047001 | 332 |
| 11 | 3300013296 | Ga0157374_10196180 | Ga0157374_101961802 | 332 |
| 12 | 3300021384 | Ga0213876_10004977 | Ga0213876_100049778 | 332 |
| 13 | 3300025972 | Ga0207668_10334802 | Ga0207668_103348022 | 332 |
| 14 | 3300039437 | Ga0436365_0790831 | Ga0436365_0790831_8066_9100 | 332 |
| 15 | 3300044658 | Ga0466972_0025748 | Ga0466972_0025748_1092_2090 | 332 |
| 16 | 3300044683 | Ga0466965_0010739 | Ga0466965_0010739_480_1478 | 332 |
| 17 | 3300044684 | Ga0466966_0118801 | Ga0466966_0118801_326_1324 | 332 |
| 18 | 3300044719 | Ga0466971_0054127 | Ga0466971_0054127_574_1572 | 332 |
| 19 | 3300044735 | Ga0466968_0044461 | Ga0466968_0044461_687_1685 | 332 |
| 20 | 3300046460 | Ga0495638_0006500 | Ga0495638_0006500_1473_2498 | 332 |
| 21 | 3300048906 | Ga0496103_0009139 | Ga0496103_0009139_312_1310 | 332 |
| 22 | 3300048909 | Ga0496106_0196793 | Ga0496106_0196793_11_1009 | 332 |
| 23 | 3300053079 | Ga0500610_0006674 | Ga0500610_0006674_648_1673 | 332 |
| 24 | 3300053104 | Ga0500556_0006131 | Ga0500556_0006131_1251_2276 | 332 |
| 25 | 3300053108 | Ga0500562_015944 | Ga0500562_015944_142_1191 | 332 |
| 26 | 3300053142 | Ga0500577_0016682 | Ga0500577_0016682_894_1919 | 332 |
| 27 | 3300061719 | Ga0466962_0034106 | Ga0466962_0034106_1351_2349 | 332 |
| 28 | iso_pu_bacteria | 2929212328 | 2929213795 | 332 |
| 29 | iso_pu_bacteria | 2643221692 | 2644517968 | 333 |
| 30 | iso_pu_bacteria | 2842134933 | 2842140435 | 333 |
| 31 | 3300005337 | Ga0070682_100045049 | Ga0070682_1000450492 | 335 |
| 32 | 3300005367 | Ga0070667_100038684 | Ga0070667_1000386842 | 335 |
| 33 | 3300005719 | Ga0068861_100115039 | Ga0068861_1001150391 | 335 |
| 34 | 3300005841 | Ga0068863_100020977 | Ga0068863_1000209775 | 335 |
| 35 | 3300005937 | Ga0081455_10028642 | Ga0081455_100286427 | 335 |
| 36 | 3300005981 | Ga0081538_10114330 | Ga0081538_101143301 | 335 |
| 37 | 3300006038 | Ga0075365_10004777 | Ga0075365_100047773 | 335 |
| 38 | 3300006048 | Ga0075363_100002561 | Ga0075363_1000025615 | 335 |
| 39 | 3300010375 | Ga0105239_10345408 | Ga0105239_103454082 | 335 |
| 40 | 3300025934 | Ga0207686_10063612 | Ga0207686_100636123 | 335 |
| 41 | 3300025937 | Ga0207669_10091587 | Ga0207669_100915872 | 335 |
| 42 | 3300025941 | Ga0207711_10078440 | Ga0207711_100784402 | 335 |
| 43 | 3300025961 | Ga0207712_10066011 | Ga0207712_100660113 | 335 |
| 44 | 3300025986 | Ga0207658_10210426 | Ga0207658_102104262 | 335 |
| 45 | 3300026067 | Ga0207678_10232424 | Ga0207678_102324242 | 335 |
| 46 | 3300026088 | Ga0207641_10256282 | Ga0207641_102562822 | 335 |
| 47 | 3300044656 | Ga0466969_0017537 | Ga0466969_0017537_28_1044 | 335 |
| 48 | 3300044683 | Ga0466965_0013560 | Ga0466965_0013560_1741_2757 | 335 |
| 49 | 3300044684 | Ga0466966_0007209 | Ga0466966_0007209_1078_2094 | 335 |
| 50 | 3300044693 | Ga0466961_0000574 | Ga0466961_0000574_13617_14633 | 335 |
| 51 | 3300044694 | Ga0466963_0000149 | Ga0466963_0000149_3742_4758 | 335 |
| 52 | 3300044719 | Ga0466971_0001937 | Ga0466971_0001937_2823_3839 | 335 |
| 53 | 3300044735 | Ga0466968_0000969 | Ga0466968_0000969_2745_3758 | 335 |
| 54 | 3300044765 | Ga0466970_0012473 | Ga0466970_0012473_706_1719 | 335 |
| 55 | 3300044765 | Ga0466970_0021984 | Ga0466970_0021984_2231_3247 | 335 |
| 56 | 3300044842 | Ga0466957_0001716 | Ga0466957_0001716_9438_10454 | 335 |
| 57 | 3300044901 | Ga0466960_0000457 | Ga0466960_0000457_529_1542 | 335 |
| 58 | 3300045049 | Ga0466959_0006355 | Ga0466959_0006355_1078_2094 | 335 |
| 59 | 3300045049 | Ga0466959_0051753 | Ga0466959_0051753_1544_2551 | 335 |
| 60 | 3300045836 | Ga0466958_0009576 | Ga0466958_0009576_4217_5233 | 335 |
| 61 | 3300045976 | Ga0466967_0019670 | Ga0466967_0019670_3253_4266 | 335 |
| 62 | 3300047321 | Ga0495676_0185699 | Ga0495676_0185699_197_1204 | 335 |
| 63 | 3300048903 | Ga0496100_0088963 | Ga0496100_0088963_407_1426 | 335 |
| 64 | 3300048906 | Ga0496103_0048073 | Ga0496103_0048073_1617_2624 | 335 |
| 65 | 3300048911 | Ga0496108_0055522 | Ga0496108_0055522_1700_2707 | 335 |
| 66 | 3300048912 | Ga0496109_0084265 | Ga0496109_0084265_1383_2390 | 335 |
| 67 | 3300048914 | Ga0496111_0185588 | Ga0496111_0185588_430_1437 | 335 |
| 68 | 3300048915 | Ga0496112_0019065 | Ga0496112_0019065_5026_6045 | 335 |
| 69 | 3300048915 | Ga0496112_0161744 | Ga0496112_0161744_668_1675 | 335 |
| 70 | 3300048916 | Ga0496113_0001800 | Ga0496113_0001800_9882_10901 | 335 |
| 71 | 3300048916 | Ga0496113_0066152 | Ga0496113_0066152_958_1965 | 335 |
| 72 | 3300048925 | Ga0496122_0017076 | Ga0496122_0017076_1933_2952 | 335 |
| 73 | 3300048926 | Ga0496123_0010722 | Ga0496123_0010722_2938_3957 | 335 |
| 74 | 3300048929 | Ga0496126_0268165 | Ga0496126_0268165_289_1308 | 335 |
| 75 | 3300050490 | nmdc:mga03n38_10904_c1 | nmdc:mga03n38_10904_c1_1596_2603 | 335 |
| 76 | iso_pu_bacteria | 2643221715 | 2644635718 | 335 |
| 77 | iso_pu_bacteria | 2738541264 | 2738664281 | 335 |
| 78 | iso_pu_bacteria | 2738541356 | 2739143416 | 335 |
| 79 | iso_pu_bacteria | 2919713450 | 2919715092 | 335 |
| 80 | 3300002077 | JGI24744J21845_10003176 | JGI24744J21845_100031763 | 336 |
| 81 | 3300002244 | JGI24742J22300_10007986 | JGI24742J22300_100079862 | 336 |
| 82 | 3300005328 | Ga0070676_10078486 | Ga0070676_100784862 | 336 |
| 83 | 3300005334 | Ga0068869_100131023 | Ga0068869_1001310232 | 336 |
| 84 | 3300005337 | Ga0070682_100112696 | Ga0070682_1001126962 | 336 |
| 85 | 3300005340 | Ga0070689_100013931 | Ga0070689_1000139315 | 336 |
| 86 | 3300005341 | Ga0070691_10037706 | Ga0070691_100377062 | 336 |
| 87 | 3300005365 | Ga0070688_100020095 | Ga0070688_1000200952 | 336 |
| 88 | 3300005366 | Ga0070659_100229637 | Ga0070659_1002296372 | 336 |
| 89 | 3300005367 | Ga0070667_100206502 | Ga0070667_1002065022 | 336 |
| 90 | 3300005438 | Ga0070701_10010922 | Ga0070701_100109222 | 336 |
| 91 | 3300005439 | Ga0070711_100046250 | Ga0070711_1000462501 | 336 |
| 92 | 3300005456 | Ga0070678_100063757 | Ga0070678_1000637572 | 336 |
| 93 | 3300005459 | Ga0068867_100011061 | Ga0068867_1000110613 | 336 |
| 94 | 3300005539 | Ga0068853_100334730 | Ga0068853_1003347302 | 336 |
| 95 | 3300005546 | Ga0070696_100057899 | Ga0070696_1000578992 | 336 |
| 96 | 3300005547 | Ga0070693_100151159 | Ga0070693_1001511592 | 336 |
| 97 | 3300005563 | Ga0068855_100305947 | Ga0068855_1003059472 | 336 |
| 98 | 3300005616 | Ga0068852_100025822 | Ga0068852_1000258222 | 336 |
| 99 | 3300005617 | Ga0068859_100104384 | Ga0068859_1001043842 | 336 |
| 100 | 3300005718 | Ga0068866_10014282 | Ga0068866_100142822 | 336 |
| 101 | 3300005840 | Ga0068870_10199720 | Ga0068870_101997202 | 336 |
| 102 | 3300005842 | Ga0068858_100295206 | Ga0068858_1002952062 | 336 |
| 103 | 3300005843 | Ga0068860_100161095 | Ga0068860_1001610952 | 336 |
| 104 | 3300005844 | Ga0068862_100080181 | Ga0068862_1000801812 | 336 |
| 105 | 3300006038 | Ga0075365_10005852 | Ga0075365_100058526 | 336 |
| 106 | 3300006042 | Ga0075368_10030780 | Ga0075368_100307803 | 336 |
| 107 | 3300006048 | Ga0075363_100000288 | Ga0075363_10000028812 | 336 |
| 108 | 3300006048 | Ga0075363_100016783 | Ga0075363_1000167833 | 336 |
| 109 | 3300006048 | Ga0075363_100021825 | Ga0075363_1000218252 | 336 |
| 110 | 3300006051 | Ga0075364_10003515 | Ga0075364_100035156 | 336 |
| 111 | 3300006051 | Ga0075364_10012633 | Ga0075364_100126336 | 336 |
| 112 | 3300006051 | Ga0075364_10015309 | Ga0075364_100153092 | 336 |
| 113 | 3300006163 | Ga0070715_10089612 | Ga0070715_100896122 | 336 |
| 114 | 3300006186 | Ga0075369_10001566 | Ga0075369_100015663 | 336 |
| 115 | 3300006186 | Ga0075369_10003619 | Ga0075369_100036194 | 336 |
| 116 | 3300006186 | Ga0075369_10016833 | Ga0075369_100168332 | 336 |
| 117 | 3300006237 | Ga0097621_100096848 | Ga0097621_1000968483 | 336 |
| 118 | 3300006353 | Ga0075370_10006073 | Ga0075370_100060733 | 336 |
| 119 | 3300006844 | Ga0075428_100096970 | Ga0075428_1000969704 | 336 |
| 120 | 3300006846 | Ga0075430_100003713 | Ga0075430_1000037134 | 336 |
| 121 | 3300006931 | Ga0097620_100104382 | Ga0097620_1001043822 | 336 |
| 122 | 3300007788 | Ga0099795_10024563 | Ga0099795_100245631 | 336 |
| 123 | 3300009093 | Ga0105240_10362074 | Ga0105240_103620742 | 336 |
| 124 | 3300009098 | Ga0105245_10027287 | Ga0105245_100272873 | 336 |
| 125 | 3300009101 | Ga0105247_10031858 | Ga0105247_100318583 | 336 |
| 126 | 3300009147 | Ga0114129_10042705 | Ga0114129_100427054 | 336 |
| 127 | 3300009177 | Ga0105248_10015685 | Ga0105248_100156854 | 336 |
| 128 | 3300010159 | Ga0099796_10044303 | Ga0099796_100443032 | 336 |
| 129 | 3300010375 | Ga0105239_10053334 | Ga0105239_100533343 | 336 |
| 130 | 3300013105 | Ga0157369_10240144 | Ga0157369_102401442 | 336 |
| 131 | 3300013306 | Ga0163162_10066920 | Ga0163162_100669203 | 336 |
| 132 | 3300013307 | Ga0157372_10747585 | Ga0157372_107475852 | 336 |
| 133 | 3300014326 | Ga0157380_10038702 | Ga0157380_100387022 | 336 |
| 134 | 3300014968 | Ga0157379_10014378 | Ga0157379_100143787 | 336 |
| 135 | 3300017792 | Ga0163161_10049212 | Ga0163161_100492122 | 336 |
| 136 | 3300021384 | Ga0213876_10089655 | Ga0213876_100896552 | 336 |
| 137 | 3300025898 | Ga0207692_10031217 | Ga0207692_100312173 | 336 |
| 138 | 3300025899 | Ga0207642_10004529 | Ga0207642_100045292 | 336 |
| 139 | 3300025900 | Ga0207710_10021356 | Ga0207710_100213563 | 336 |
| 140 | 3300025901 | Ga0207688_10122961 | Ga0207688_101229612 | 336 |
| 141 | 3300025903 | Ga0207680_10084105 | Ga0207680_100841052 | 336 |
| 142 | 3300025904 | Ga0207647_10014995 | Ga0207647_100149952 | 336 |
| 143 | 3300025907 | Ga0207645_10023243 | Ga0207645_100232432 | 336 |
| 144 | 3300025908 | Ga0207643_10101699 | Ga0207643_101016991 | 336 |
| 145 | 3300025916 | Ga0207663_10021386 | Ga0207663_100213863 | 336 |
| 146 | 3300025918 | Ga0207662_10027919 | Ga0207662_100279193 | 336 |
| 147 | 3300025919 | Ga0207657_10040977 | Ga0207657_100409773 | 336 |
| 148 | 3300025923 | Ga0207681_10058079 | Ga0207681_100580792 | 336 |
| 149 | 3300025924 | Ga0207694_10101613 | Ga0207694_101016132 | 336 |
| 150 | 3300025927 | Ga0207687_10006582 | Ga0207687_100065827 | 336 |
| 151 | 3300025929 | Ga0207664_10208304 | Ga0207664_102083042 | 336 |
| 152 | 3300025931 | Ga0207644_10109696 | Ga0207644_101096962 | 336 |
| 153 | 3300025932 | Ga0207690_10142329 | Ga0207690_101423292 | 336 |
| 154 | 3300025933 | Ga0207706_10007441 | Ga0207706_1000744110 | 336 |
| 155 | 3300025934 | Ga0207686_10006545 | Ga0207686_100065454 | 336 |
| 156 | 3300025937 | Ga0207669_10001327 | Ga0207669_100013277 | 336 |
| 157 | 3300025938 | Ga0207704_10012701 | Ga0207704_100127013 | 336 |
| 158 | 3300025938 | Ga0207704_10069343 | Ga0207704_100693431 | 336 |
| 159 | 3300025939 | Ga0207665_10009444 | Ga0207665_100094442 | 336 |
| 160 | 3300025941 | Ga0207711_10022005 | Ga0207711_100220054 | 336 |
| 161 | 3300025942 | Ga0207689_10037450 | Ga0207689_100374502 | 336 |
| 162 | 3300025949 | Ga0207667_10153951 | Ga0207667_101539512 | 336 |
| 163 | 3300025972 | Ga0207668_10053615 | Ga0207668_100536152 | 336 |
| 164 | 3300025981 | Ga0207640_10012242 | Ga0207640_100122423 | 336 |
| 165 | 3300025986 | Ga0207658_10029027 | Ga0207658_100290273 | 336 |
| 166 | 3300026023 | Ga0207677_10070154 | Ga0207677_100701542 | 336 |
| 167 | 3300026041 | Ga0207639_10086487 | Ga0207639_100864873 | 336 |
| 168 | 3300026067 | Ga0207678_10008103 | Ga0207678_100081033 | 336 |
| 169 | 3300026067 | Ga0207678_10023448 | Ga0207678_100234482 | 336 |
| 170 | 3300026118 | Ga0207675_100003650 | Ga0207675_1000036508 | 336 |
| 171 | 3300026121 | Ga0207683_10073010 | Ga0207683_100730102 | 336 |
| 172 | 3300026142 | Ga0207698_10063478 | Ga0207698_100634782 | 336 |
| 173 | 3300028380 | Ga0268265_10102008 | Ga0268265_101020082 | 336 |
| 174 | 3300028381 | Ga0268264_10095476 | Ga0268264_100954762 | 336 |
| 175 | 3300031852 | Ga0307410_10022955 | Ga0307410_100229553 | 336 |
| 176 | 3300031995 | Ga0307409_100055133 | Ga0307409_1000551332 | 336 |
| 177 | 3300032002 | Ga0307416_100090236 | Ga0307416_1000902362 | 336 |
| 178 | 3300032004 | Ga0307414_10110941 | Ga0307414_101109412 | 336 |
| 179 | 3300034957 | Ga0373938_0022222 | Ga0373938_0022222_73_1083 | 336 |
| 180 | 3300035092 | Ga0373952_0030916 | Ga0373952_0030916_119_1129 | 336 |
| 181 | 3300035112 | Ga0373932_0018190 | Ga0373932_0018190_547_1557 | 336 |
| 182 | 3300035114 | Ga0373939_0007230 | Ga0373939_0007230_664_1674 | 336 |
| 183 | 3300035121 | Ga0373960_0015951 | Ga0373960_0015951_125_1135 | 336 |
| 184 | 3300035691 | Ga0373931_0023757 | Ga0373931_0023757_311_1321 | 336 |
| 185 | 3300041512 | Ga0451853_0790618 | Ga0451853_0790618_263_1273 | 336 |
| 186 | 3300045976 | Ga0466967_0175167 | Ga0466967_0175167_749_1759 | 336 |
| 187 | 3300046499 | Ga0495594_0070383 | Ga0495594_0070383_20_1030 | 336 |
| 188 | 3300047320 | Ga0495672_0022122 | Ga0495672_0022122_2788_3798 | 336 |
| 189 | 3300048903 | Ga0496100_0057022 | Ga0496100_0057022_1492_2502 | 336 |
| 190 | 3300048904 | Ga0496101_0059960 | Ga0496101_0059960_175_1185 | 336 |
| 191 | 3300048905 | Ga0496102_0060517 | Ga0496102_0060517_1576_2586 | 336 |
| 192 | 3300048908 | Ga0496105_0057576 | Ga0496105_0057576_718_1737 | 336 |
| 193 | 3300048908 | Ga0496105_0236676 | Ga0496105_0236676_83_1093 | 336 |
| 194 | 3300048910 | Ga0496107_0030229 | Ga0496107_0030229_309_1319 | 336 |
| 195 | 3300048911 | Ga0496108_0020334 | Ga0496108_0020334_2075_3085 | 336 |
| 196 | 3300048913 | Ga0496110_0121966 | Ga0496110_0121966_167_1177 | 336 |
| 197 | 3300048913 | Ga0496110_0488440 | Ga0496110_0488440_82_1092 | 336 |
| 198 | 3300048915 | Ga0496112_0003670 | Ga0496112_0003670_8443_9453 | 336 |
| 199 | 3300048917 | Ga0496114_0023224 | Ga0496114_0023224_1511_2521 | 336 |
| 200 | 3300048918 | Ga0496115_0109886 | Ga0496115_0109886_785_1795 | 336 |
| 201 | 3300050490 | nmdc:mga03n38_13589_c1 | nmdc:mga03n38_13589_c1_1696_2706 | 336 |
| 202 | 3300050490 | nmdc:mga03n38_435_c1 | nmdc:mga03n38_435_c1_7348_8358 | 336 |
| 203 | 3300050490 | nmdc:mga03n38_53162_c1 | nmdc:mga03n38_53162_c1_446_1456 | 336 |
| 204 | 3300050491 | nmdc:mga00v17_27848_c1 | nmdc:mga00v17_27848_c1_392_1402 | 336 |
| 205 | 3300050491 | nmdc:mga00v17_5879_c1 | nmdc:mga00v17_5879_c1_5455_6465 | 336 |
| 206 | 3300050491 | nmdc:mga00v17_6485_c1 | nmdc:mga00v17_6485_c1_434_1444 | 336 |
| 207 | 3300050492 | nmdc:mga0yw44_512_c1 | nmdc:mga0yw44_512_c1_10077_11087 | 336 |
| 208 | 3300050494 | nmdc:mga06z11_33799_c1 | nmdc:mga06z11_33799_c1_1270_2280 | 336 |
| 209 | 3300050496 | nmdc:mga07m45_70652_c1 | nmdc:mga07m45_70652_c1_263_1273 | 336 |
| 210 | 3300050507 | nmdc:mga05p37_28521_c1 | nmdc:mga05p37_28521_c1_4968_5978 | 336 |
| 211 | 3300050509 | nmdc:mga0qj67_41963_c1 | nmdc:mga0qj67_41963_c1_2021_3031 | 336 |
| 212 | 3300050516 | nmdc:mga0sz30_12864_c1 | nmdc:mga0sz30_12864_c1_749_1759 | 336 |
| 213 | 3300050516 | nmdc:mga0sz30_1921_c1 | nmdc:mga0sz30_1921_c1_6153_7163 | 336 |
| 214 | 3300053083 | Ga0495655_0007628 | Ga0495655_0007628_807_1817 | 336 |
| 215 | iso_pu_bacteria | 2547132424 | 2548699733 | 336 |
| 216 | iso_pu_bacteria | 2551306166 | 2552111563 | 336 |
| 217 | iso_pu_bacteria | 2738541274 | 2738704803 | 336 |
| 218 | iso_pu_bacteria | 2738543028 | 2739329972 | 336 |
| 219 | iso_pu_bacteria | 2902799365 | 2902803486 | 336 |
| 220 | 3300003320 | rootH2_10055264 | rootH2_100552644 | 337 |
| 221 | 3300005367 | Ga0070667_100000074 | Ga0070667_10000007472 | 337 |
| 222 | 3300005548 | Ga0070665_100005707 | Ga0070665_1000057078 | 337 |
| 223 | 3300005617 | Ga0068859_100000567 | Ga0068859_10000056726 | 337 |
| 224 | 3300005841 | Ga0068863_100001963 | Ga0068863_1000019637 | 337 |
| 225 | 3300005843 | Ga0068860_100000276 | Ga0068860_10000027631 | 337 |
| 226 | 3300005844 | Ga0068862_100000065 | Ga0068862_10000006575 | 337 |
| 227 | 3300006931 | Ga0097620_100000567 | Ga0097620_10000056726 | 337 |
| 228 | 3300009101 | Ga0105247_10000017 | Ga0105247_1000001751 | 337 |
| 229 | 3300009177 | Ga0105248_10000849 | Ga0105248_1000084931 | 337 |
| 230 | 3300009553 | Ga0105249_10000096 | Ga0105249_1000009651 | 337 |
| 231 | 3300014325 | Ga0163163_10072408 | Ga0163163_100724082 | 337 |
| 232 | 3300025900 | Ga0207710_10000033 | Ga0207710_10000033214 | 337 |
| 233 | 3300025923 | Ga0207681_10000849 | Ga0207681_100008493 | 337 |
| 234 | 3300025941 | Ga0207711_10000661 | Ga0207711_100006614 | 337 |
| 235 | 3300025961 | Ga0207712_10000005 | Ga0207712_10000005308 | 337 |
| 236 | 3300025986 | Ga0207658_10000321 | Ga0207658_1000032136 | 337 |
| 237 | 3300026035 | Ga0207703_10010452 | Ga0207703_100104526 | 337 |
| 238 | 3300026088 | Ga0207641_10001342 | Ga0207641_1000134210 | 337 |
| 239 | 3300028379 | Ga0268266_10014326 | Ga0268266_100143266 | 337 |
| 240 | 3300028380 | Ga0268265_10000022 | Ga0268265_1000002254 | 337 |
| 241 | 3300028381 | Ga0268264_10000005 | Ga0268264_10000005304 | 337 |
| 242 | 3300048904 | Ga0496101_0043559 | Ga0496101_0043559_1877_2890 | 337 |
| 243 | 3300048905 | Ga0496102_0000415 | Ga0496102_0000415_47420_48433 | 337 |
| 244 | 3300048906 | Ga0496103_0000093 | Ga0496103_0000093_25271_26284 | 337 |
| 245 | 3300048919 | Ga0496116_0004420 | Ga0496116_0004420_6203_7216 | 337 |
| 246 | 3300048920 | Ga0496117_0021358 | Ga0496117_0021358_3366_4379 | 337 |
| 247 | 3300048921 | Ga0496118_0000488 | Ga0496118_0000488_19182_20195 | 337 |
| 248 | 3300048922 | Ga0496119_0002624 | Ga0496119_0002624_7035_8048 | 337 |
| 249 | 3300048923 | Ga0496120_0001188 | Ga0496120_0001188_11626_12639 | 337 |
| 250 | 3300048924 | Ga0496121_0007092 | Ga0496121_0007092_454_1467 | 337 |
| 251 | 3300048927 | Ga0496124_0008699 | Ga0496124_0008699_6812_7825 | 337 |
| 252 | 3300048928 | Ga0496125_0061113 | Ga0496125_0061113_817_1830 | 337 |
| 253 | 3300048929 | Ga0496126_0003151 | Ga0496126_0003151_13330_14343 | 337 |
| 254 | iso_pu_bacteria | 2902792274 | 2902793004 | 337 |
| 255 | 3300006048 | Ga0075363_100174617 | Ga0075363_1001746172 | 338 |
| 256 | 3300050490 | nmdc:mga03n38_126601_c1 | nmdc:mga03n38_126601_c1_99_1118 | 338 |
| 257 | iso_pu_bacteria | 2738543011 | 2739240319 | 338 |
| 258 | iso_pu_bacteria | 2889300758 | 2889302746 | 338 |
| 259 | iso_pu_bacteria | 2902810491 | 2902813677 | 338 |
| 260 | iso_pu_bacteria | 2939743619 | 2939747966 | 338 |
| 261 | 3300005331 | Ga0070670_100363401 | Ga0070670_1003634012 | 339 |
| 262 | 3300005338 | Ga0068868_100103672 | Ga0068868_1001036722 | 339 |
| 263 | 3300005347 | Ga0070668_100027164 | Ga0070668_1000271641 | 339 |
| 264 | 3300005355 | Ga0070671_100005599 | Ga0070671_1000055998 | 339 |
| 265 | 3300005356 | Ga0070674_100007854 | Ga0070674_1000078543 | 339 |
| 266 | 3300005356 | Ga0070674_100015283 | Ga0070674_1000152834 | 339 |
| 267 | 3300005365 | Ga0070688_100217326 | Ga0070688_1002173261 | 339 |
| 268 | 3300005367 | Ga0070667_100000819 | Ga0070667_1000008192 | 339 |
| 269 | 3300005367 | Ga0070667_100048784 | Ga0070667_1000487842 | 339 |
| 270 | 3300005367 | Ga0070667_100070012 | Ga0070667_1000700122 | 339 |
| 271 | 3300005435 | Ga0070714_100016514 | Ga0070714_1000165145 | 339 |
| 272 | 3300005435 | Ga0070714_100092138 | Ga0070714_1000921382 | 339 |
| 273 | 3300005436 | Ga0070713_100013669 | Ga0070713_1000136696 | 339 |
| 274 | 3300005440 | Ga0070705_100100131 | Ga0070705_1001001312 | 339 |
| 275 | 3300005456 | Ga0070678_100010151 | Ga0070678_1000101512 | 339 |
| 276 | 3300005457 | Ga0070662_100151791 | Ga0070662_1001517912 | 339 |
| 277 | 3300005539 | Ga0068853_100079851 | Ga0068853_1000798512 | 339 |
| 278 | 3300005546 | Ga0070696_100180892 | Ga0070696_1001808922 | 339 |
| 279 | 3300005547 | Ga0070693_100029203 | Ga0070693_1000292033 | 339 |
| 280 | 3300005548 | Ga0070665_100003609 | Ga0070665_1000036096 | 339 |
| 281 | 3300005578 | Ga0068854_100068457 | Ga0068854_1000684572 | 339 |
| 282 | 3300005615 | Ga0070702_100013285 | Ga0070702_1000132853 | 339 |
| 283 | 3300005616 | Ga0068852_100131202 | Ga0068852_1001312022 | 339 |
| 284 | 3300005618 | Ga0068864_100149884 | Ga0068864_1001498843 | 339 |
| 285 | 3300005618 | Ga0068864_100294245 | Ga0068864_1002942452 | 339 |
| 286 | 3300005718 | Ga0068866_10048584 | Ga0068866_100485842 | 339 |
| 287 | 3300005719 | Ga0068861_100037442 | Ga0068861_1000374423 | 339 |
| 288 | 3300005719 | Ga0068861_100116822 | Ga0068861_1001168222 | 339 |
| 289 | 3300005841 | Ga0068863_100002994 | Ga0068863_10000299412 | 339 |
| 290 | 3300005842 | Ga0068858_100186781 | Ga0068858_1001867812 | 339 |
| 291 | 3300005843 | Ga0068860_100096650 | Ga0068860_1000966502 | 339 |
| 292 | 3300005844 | Ga0068862_100014128 | Ga0068862_1000141285 | 339 |
| 293 | 3300006048 | Ga0075363_100004789 | Ga0075363_1000047895 | 339 |
| 294 | 3300006051 | Ga0075364_10001329 | Ga0075364_100013295 | 339 |
| 295 | 3300006173 | Ga0070716_100270296 | Ga0070716_1002702962 | 339 |
| 296 | 3300006353 | Ga0075370_10084524 | Ga0075370_100845241 | 339 |
| 297 | 3300006881 | Ga0068865_100004490 | Ga0068865_1000044906 | 339 |
| 298 | 3300006881 | Ga0068865_100075469 | Ga0068865_1000754692 | 339 |
| 299 | 3300009098 | Ga0105245_10047008 | Ga0105245_100470084 | 339 |
| 300 | 3300009101 | Ga0105247_10007735 | Ga0105247_100077354 | 339 |
| 301 | 3300009101 | Ga0105247_10012541 | Ga0105247_100125414 | 339 |
| 302 | 3300009176 | Ga0105242_10159454 | Ga0105242_101594542 | 339 |
| 303 | 3300009177 | Ga0105248_10019251 | Ga0105248_100192518 | 339 |
| 304 | 3300009177 | Ga0105248_10024808 | Ga0105248_100248082 | 339 |
| 305 | 3300009177 | Ga0105248_10098526 | Ga0105248_100985262 | 339 |
| 306 | 3300009553 | Ga0105249_10021366 | Ga0105249_100213663 | 339 |
| 307 | 3300010375 | Ga0105239_10123927 | Ga0105239_101239272 | 339 |
| 308 | 3300013296 | Ga0157374_10020714 | Ga0157374_100207143 | 339 |
| 309 | 3300013297 | Ga0157378_10030415 | Ga0157378_100304154 | 339 |
| 310 | 3300013306 | Ga0163162_10031526 | Ga0163162_100315264 | 339 |
| 311 | 3300013306 | Ga0163162_10048516 | Ga0163162_100485163 | 339 |
| 312 | 3300013307 | Ga0157372_10111308 | Ga0157372_101113083 | 339 |
| 313 | 3300013308 | Ga0157375_10012726 | Ga0157375_100127263 | 339 |
| 314 | 3300013308 | Ga0157375_10708006 | Ga0157375_107080061 | 339 |
| 315 | 3300014325 | Ga0163163_10016950 | Ga0163163_100169507 | 339 |
| 316 | 3300014326 | Ga0157380_10073612 | Ga0157380_100736122 | 339 |
| 317 | 3300014745 | Ga0157377_10028544 | Ga0157377_100285443 | 339 |
| 318 | 3300025303 | Ga0209051_1000051 | Ga0209051_1000051109 | 339 |
| 319 | 3300025900 | Ga0207710_10006703 | Ga0207710_100067032 | 339 |
| 320 | 3300025901 | Ga0207688_10008511 | Ga0207688_100085112 | 339 |
| 321 | 3300025904 | Ga0207647_10060212 | Ga0207647_100602122 | 339 |
| 322 | 3300025907 | Ga0207645_10170548 | Ga0207645_101705482 | 339 |
| 323 | 3300025928 | Ga0207700_10054780 | Ga0207700_100547802 | 339 |
| 324 | 3300025929 | Ga0207664_10088444 | Ga0207664_100884442 | 339 |
| 325 | 3300025931 | Ga0207644_10002040 | Ga0207644_100020407 | 339 |
| 326 | 3300025937 | Ga0207669_10017133 | Ga0207669_100171333 | 339 |
| 327 | 3300025938 | Ga0207704_10013973 | Ga0207704_100139732 | 339 |
| 328 | 3300025938 | Ga0207704_10229532 | Ga0207704_102295322 | 339 |
| 329 | 3300025939 | Ga0207665_10232623 | Ga0207665_102326231 | 339 |
| 330 | 3300025942 | Ga0207689_10019152 | Ga0207689_100191522 | 339 |
| 331 | 3300025960 | Ga0207651_10314517 | Ga0207651_103145171 | 339 |
| 332 | 3300025972 | Ga0207668_10165121 | Ga0207668_101651212 | 339 |
| 333 | 3300025972 | Ga0207668_10247697 | Ga0207668_102476972 | 339 |
| 334 | 3300025981 | Ga0207640_10023783 | Ga0207640_100237832 | 339 |
| 335 | 3300025986 | Ga0207658_10000743 | Ga0207658_1000074324 | 339 |
| 336 | 3300025986 | Ga0207658_10002978 | Ga0207658_1000297810 | 339 |
| 337 | 3300025986 | Ga0207658_10049977 | Ga0207658_100499773 | 339 |
| 338 | 3300026023 | Ga0207677_10107477 | Ga0207677_101074772 | 339 |
| 339 | 3300026035 | Ga0207703_10139183 | Ga0207703_101391832 | 339 |
| 340 | 3300026035 | Ga0207703_10177155 | Ga0207703_101771552 | 339 |
| 341 | 3300026078 | Ga0207702_10086975 | Ga0207702_100869752 | 339 |
| 342 | 3300026088 | Ga0207641_10005082 | Ga0207641_1000508212 | 339 |
| 343 | 3300026089 | Ga0207648_10159828 | Ga0207648_101598282 | 339 |
| 344 | 3300026118 | Ga0207675_100041689 | Ga0207675_1000416893 | 339 |
| 345 | 3300026118 | Ga0207675_100259950 | Ga0207675_1002599502 | 339 |
| 346 | 3300026121 | Ga0207683_10085918 | Ga0207683_100859182 | 339 |
| 347 | 3300026142 | Ga0207698_10212030 | Ga0207698_102120302 | 339 |
| 348 | 3300028379 | Ga0268266_10002162 | Ga0268266_1000216212 | 339 |
| 349 | 3300028380 | Ga0268265_10055693 | Ga0268265_100556932 | 339 |
| 350 | 3300028381 | Ga0268264_10074422 | Ga0268264_100744222 | 339 |
| 351 | 3300031251 | Ga0265327_10005197 | Ga0265327_1000519710 | 339 |
| 352 | 3300037853 | Ga0436364_0166911 | Ga0436364_0166911_6332_7363 | 339 |
| 353 | 3300037853 | Ga0436364_0255571 | Ga0436364_0255571_3169_4188 | 339 |
| 354 | 3300037853 | Ga0436364_1311241 | Ga0436364_1311241_359_1378 | 339 |
| 355 | 3300039437 | Ga0436365_0200358 | Ga0436365_0200358_653_1684 | 339 |
| 356 | 3300039437 | Ga0436365_0484364 | Ga0436365_0484364_7961_8980 | 339 |
| 357 | 3300041413 | Ga0439465_0016772 | Ga0439465_0016772_1189_2232 | 339 |
| 358 | 3300041997 | Ga0439431_0003250 | Ga0439431_0003250_184_1227 | 339 |
| 359 | 3300042005 | Ga0439448_0001700 | Ga0439448_0001700_1973_2992 | 339 |
| 360 | 3300042435 | Ga0439434_0007526 | Ga0439434_0007526_1645_2688 | 339 |
| 361 | 3300044683 | Ga0466965_0054711 | Ga0466965_0054711_168_1187 | 339 |
| 362 | 3300044684 | Ga0466966_0069996 | Ga0466966_0069996_1033_2058 | 339 |
| 363 | 3300044694 | Ga0466963_0002039 | Ga0466963_0002039_3736_4755 | 339 |
| 364 | 3300044719 | Ga0466971_0010315 | Ga0466971_0010315_724_1743 | 339 |
| 365 | 3300044735 | Ga0466968_0023062 | Ga0466968_0023062_330_1355 | 339 |
| 366 | 3300044901 | Ga0466960_0004198 | Ga0466960_0004198_4361_5380 | 339 |
| 367 | 3300045049 | Ga0466959_0037964 | Ga0466959_0037964_1136_2161 | 339 |
| 368 | 3300045836 | Ga0466958_0037843 | Ga0466958_0037843_442_1467 | 339 |
| 369 | 3300045976 | Ga0466967_0001069 | Ga0466967_0001069_9728_10747 | 339 |
| 370 | 3300045976 | Ga0466967_0004355 | Ga0466967_0004355_4976_5995 | 339 |
| 371 | 3300046461 | Ga0495641_0075763 | Ga0495641_0075763_283_1311 | 339 |
| 372 | 3300046529 | Ga0495652_0147064 | Ga0495652_0147064_90_1118 | 339 |
| 373 | 3300046694 | Ga0495649_0114982 | Ga0495649_0114982_214_1233 | 339 |
| 374 | 3300047320 | Ga0495672_0179321 | Ga0495672_0179321_34_1053 | 339 |
| 375 | 3300048903 | Ga0496100_0000212 | Ga0496100_0000212_28921_29940 | 339 |
| 376 | 3300048903 | Ga0496100_0009399 | Ga0496100_0009399_2713_3732 | 339 |
| 377 | 3300048904 | Ga0496101_0000020 | Ga0496101_0000020_142389_143408 | 339 |
| 378 | 3300048904 | Ga0496101_0001415 | Ga0496101_0001415_10050_11069 | 339 |
| 379 | 3300048904 | Ga0496101_0026246 | Ga0496101_0026246_2713_3732 | 339 |
| 380 | 3300048905 | Ga0496102_0004064 | Ga0496102_0004064_7731_8750 | 339 |
| 381 | 3300048905 | Ga0496102_0004363 | Ga0496102_0004363_10811_11830 | 339 |
| 382 | 3300048905 | Ga0496102_0327726 | Ga0496102_0327726_217_1236 | 339 |
| 383 | 3300048906 | Ga0496103_0000512 | Ga0496103_0000512_25529_26548 | 339 |
| 384 | 3300048906 | Ga0496103_0049985 | Ga0496103_0049985_657_1676 | 339 |
| 385 | 3300048907 | Ga0496104_0004308 | Ga0496104_0004308_9617_10636 | 339 |
| 386 | 3300048908 | Ga0496105_0255008 | Ga0496105_0255008_350_1369 | 339 |
| 387 | 3300048909 | Ga0496106_0001024 | Ga0496106_0001024_10959_11978 | 339 |
| 388 | 3300048909 | Ga0496106_0011011 | Ga0496106_0011011_4713_5732 | 339 |
| 389 | 3300048909 | Ga0496106_0086509 | Ga0496106_0086509_1201_2220 | 339 |
| 390 | 3300048909 | Ga0496106_0242942 | Ga0496106_0242942_19_1038 | 339 |
| 391 | 3300048910 | Ga0496107_0002866 | Ga0496107_0002866_10344_11363 | 339 |
| 392 | 3300048910 | Ga0496107_0005597 | Ga0496107_0005597_7038_8057 | 339 |
| 393 | 3300048910 | Ga0496107_0274080 | Ga0496107_0274080_207_1226 | 339 |
| 394 | 3300048911 | Ga0496108_0000405 | Ga0496108_0000405_13624_14643 | 339 |
| 395 | 3300048911 | Ga0496108_0001278 | Ga0496108_0001278_6541_7560 | 339 |
| 396 | 3300048911 | Ga0496108_0063089 | Ga0496108_0063089_184_1203 | 339 |
| 397 | 3300048912 | Ga0496109_0002338 | Ga0496109_0002338_11134_12153 | 339 |
| 398 | 3300048912 | Ga0496109_0081314 | Ga0496109_0081314_1029_2048 | 339 |
| 399 | 3300048913 | Ga0496110_0013722 | Ga0496110_0013722_192_1211 | 339 |
| 400 | 3300048913 | Ga0496110_0019778 | Ga0496110_0019778_1090_2109 | 339 |
| 401 | 3300048913 | Ga0496110_0150566 | Ga0496110_0150566_1057_2076 | 339 |
| 402 | 3300048914 | Ga0496111_0138468 | Ga0496111_0138468_226_1245 | 339 |
| 403 | 3300048915 | Ga0496112_0041498 | Ga0496112_0041498_2645_3679 | 339 |
| 404 | 3300048915 | Ga0496112_0078708 | Ga0496112_0078708_593_1612 | 339 |
| 405 | 3300048917 | Ga0496114_0000181 | Ga0496114_0000181_28537_29556 | 339 |
| 406 | 3300048917 | Ga0496114_0004074 | Ga0496114_0004074_4175_5194 | 339 |
| 407 | 3300048920 | Ga0496117_0076871 | Ga0496117_0076871_829_1848 | 339 |
| 408 | 3300048921 | Ga0496118_0000359 | Ga0496118_0000359_46762_47781 | 339 |
| 409 | 3300048921 | Ga0496118_0004501 | Ga0496118_0004501_13634_14653 | 339 |
| 410 | 3300048922 | Ga0496119_0002301 | Ga0496119_0002301_9537_10556 | 339 |
| 411 | 3300048924 | Ga0496121_0000002 | Ga0496121_0000002_848913_849932 | 339 |
| 412 | 3300048925 | Ga0496122_0000312 | Ga0496122_0000312_75423_76442 | 339 |
| 413 | 3300048926 | Ga0496123_0003426 | Ga0496123_0003426_5684_6703 | 339 |
| 414 | 3300048927 | Ga0496124_0000002 | Ga0496124_0000002_644657_645676 | 339 |
| 415 | 3300048928 | Ga0496125_0000002 | Ga0496125_0000002_848913_849932 | 339 |
| 416 | 3300048928 | Ga0496125_0027604 | Ga0496125_0027604_2538_3572 | 339 |
| 417 | 3300048929 | Ga0496126_0000011 | Ga0496126_0000011_644657_645676 | 339 |
| 418 | 3300048929 | Ga0496126_0003649 | Ga0496126_0003649_17122_18156 | 339 |
| 419 | 3300048929 | Ga0496126_0003649 | Ga0496126_0003649_4261_5280 | 339 |
| 420 | 3300049569 | Ga0501032_0021556 | Ga0501032_0021556_1782_2801 | 339 |
| 421 | 3300049571 | Ga0501034_0011897 | Ga0501034_0011897_1401_2420 | 339 |
| 422 | 3300049581 | Ga0501047_0008566 | Ga0501047_0008566_1953_2972 | 339 |
| 423 | 3300049822 | Ga0501035_0056811 | Ga0501035_0056811_1826_2845 | 339 |
| 424 | 3300049823 | Ga0501044_0003845 | Ga0501044_0003845_5699_6718 | 339 |
| 425 | 3300050490 | nmdc:mga03n38_361_c1 | nmdc:mga03n38_361_c1_2810_3844 | 339 |
| 426 | 3300050516 | nmdc:mga0sz30_3093_c1 | nmdc:mga0sz30_3093_c1_4696_5730 | 339 |
| 427 | 3300053090 | Ga0500646_0034793 | Ga0500646_0034793_134_1156 | 339 |
| 428 | 3300005337 | Ga0070682_100005684 | Ga0070682_1000056845 | 340 |
| 429 | 3300005617 | Ga0068859_100089377 | Ga0068859_1000893773 | 340 |
| 430 | 3300005719 | Ga0068861_100033053 | Ga0068861_1000330534 | 340 |
| 431 | 3300005937 | Ga0081455_10057811 | Ga0081455_100578114 | 340 |
| 432 | 3300006038 | Ga0075365_10035342 | Ga0075365_100353422 | 340 |
| 433 | 3300006048 | Ga0075363_100189972 | Ga0075363_1001899721 | 340 |
| 434 | 3300006186 | Ga0075369_10010696 | Ga0075369_100106962 | 340 |
| 435 | 3300006186 | Ga0075369_10031663 | Ga0075369_100316633 | 340 |
| 436 | 3300006353 | Ga0075370_10026266 | Ga0075370_100262663 | 340 |
| 437 | 3300006931 | Ga0097620_100089380 | Ga0097620_1000893803 | 340 |
| 438 | 3300009098 | Ga0105245_10121636 | Ga0105245_101216362 | 340 |
| 439 | 3300009551 | Ga0105238_10066892 | Ga0105238_100668922 | 340 |
| 440 | 3300010375 | Ga0105239_10128759 | Ga0105239_101287592 | 340 |
| 441 | 3300013297 | Ga0157378_10201189 | Ga0157378_102011892 | 340 |
| 442 | 3300013306 | Ga0163162_10314316 | Ga0163162_103143162 | 340 |
| 443 | 3300013307 | Ga0157372_10267066 | Ga0157372_102670662 | 340 |
| 444 | 3300013308 | Ga0157375_10059931 | Ga0157375_100599312 | 340 |
| 445 | 3300025898 | Ga0207692_10047737 | Ga0207692_100477372 | 340 |
| 446 | 3300025905 | Ga0207685_10006064 | Ga0207685_100060643 | 340 |
| 447 | 3300025906 | Ga0207699_10254478 | Ga0207699_102544782 | 340 |
| 448 | 3300025915 | Ga0207693_10018382 | Ga0207693_100183824 | 340 |
| 449 | 3300025916 | Ga0207663_10093628 | Ga0207663_100936282 | 340 |
| 450 | 3300025932 | Ga0207690_10186659 | Ga0207690_101866592 | 340 |
| 451 | 3300025972 | Ga0207668_10122312 | Ga0207668_101223122 | 340 |
| 452 | 3300026023 | Ga0207677_10228607 | Ga0207677_102286072 | 340 |
| 453 | 3300026118 | Ga0207675_100051444 | Ga0207675_1000514444 | 340 |
| 454 | 3300026118 | Ga0207675_100196042 | Ga0207675_1001960422 | 340 |
| 455 | 3300028380 | Ga0268265_10065580 | Ga0268265_100655802 | 340 |
| 456 | 3300041413 | Ga0439465_0000060 | Ga0439465_0000060_5911_6933 | 340 |
| 457 | 3300042004 | Ga0439445_0001642 | Ga0439445_0001642_1693_2715 | 340 |
| 458 | 3300044684 | Ga0466966_0113204 | Ga0466966_0113204_617_1654 | 340 |
| 459 | 3300044693 | Ga0466961_0003256 | Ga0466961_0003256_6165_7211 | 340 |
| 460 | 3300044735 | Ga0466968_0023100 | Ga0466968_0023100_296_1342 | 340 |
| 461 | 3300044901 | Ga0466960_0000298 | Ga0466960_0000298_5091_6125 | 340 |
| 462 | 3300045976 | Ga0466967_0124981 | Ga0466967_0124981_1133_2179 | 340 |
| 463 | 3300046459 | Ga0495629_0017955 | Ga0495629_0017955_2067_3101 | 340 |
| 464 | 3300046460 | Ga0495638_0036648 | Ga0495638_0036648_418_1452 | 340 |
| 465 | 3300046461 | Ga0495641_0006709 | Ga0495641_0006709_3167_4201 | 340 |
| 466 | 3300046517 | Ga0495630_0129607 | Ga0495630_0129607_459_1493 | 340 |
| 467 | 3300046531 | Ga0495665_0034359 | Ga0495665_0034359_875_1909 | 340 |
| 468 | 3300046689 | Ga0495613_0178529 | Ga0495613_0178529_95_1129 | 340 |
| 469 | 3300047315 | Ga0495581_0012422 | Ga0495581_0012422_2911_3945 | 340 |
| 470 | 3300047319 | Ga0495674_0031488 | Ga0495674_0031488_697_1731 | 340 |
| 471 | 3300047323 | Ga0495683_0001402 | Ga0495683_0001402_14728_15768 | 340 |
| 472 | 3300048905 | Ga0496102_0332709 | Ga0496102_0332709_156_1178 | 340 |
| 473 | 3300048906 | Ga0496103_0049761 | Ga0496103_0049761_602_1624 | 340 |
| 474 | 3300048909 | Ga0496106_0092960 | Ga0496106_0092960_714_1736 | 340 |
| 475 | 3300048910 | Ga0496107_0038963 | Ga0496107_0038963_410_1432 | 340 |
| 476 | 3300048911 | Ga0496108_0009737 | Ga0496108_0009737_5559_6581 | 340 |
| 477 | 3300048915 | Ga0496112_0223853 | Ga0496112_0223853_269_1291 | 340 |
| 478 | 3300049569 | Ga0501032_0000469 | Ga0501032_0000469_16516_17553 | 340 |
| 479 | 3300049571 | Ga0501034_0009642 | Ga0501034_0009642_5070_6107 | 340 |
| 480 | 3300049572 | Ga0501036_0016952 | Ga0501036_0016952_4961_5998 | 340 |
| 481 | 3300049573 | Ga0501037_0000234 | Ga0501037_0000234_39669_40706 | 340 |
| 482 | 3300049574 | Ga0501038_0004555 | Ga0501038_0004555_10769_11806 | 340 |
| 483 | 3300049575 | Ga0501039_0000113 | Ga0501039_0000113_39763_40800 | 340 |
| 484 | 3300049579 | Ga0501043_0000082 | Ga0501043_0000082_30035_31072 | 340 |
| 485 | 3300049586 | Ga0501070_0001505 | Ga0501070_0001505_8979_10016 | 340 |
| 486 | 3300049586 | Ga0501070_0029564 | Ga0501070_0029564_706_1740 | 340 |
| 487 | 3300049742 | Ga0501080_0138139 | Ga0501080_0138139_1088_2122 | 340 |
| 488 | 3300050489 | nmdc:mga03683_29631_c1 | nmdc:mga03683_29631_c1_254_1276 | 340 |
| 489 | 3300050490 | nmdc:mga03n38_16498_c1 | nmdc:mga03n38_16498_c1_1567_2589 | 340 |
| 490 | 3300050492 | nmdc:mga0yw44_26928_c1 | nmdc:mga0yw44_26928_c1_2101_3135 | 340 |
| 491 | 3300050493 | nmdc:mga0k408_38942_c1 | nmdc:mga0k408_38942_c1_720_1742 | 340 |
| 492 | 3300050496 | nmdc:mga07m45_1418_c1 | nmdc:mga07m45_1418_c1_248_1270 | 340 |
| 493 | 3300050516 | nmdc:mga0sz30_11029_c1 | nmdc:mga0sz30_11029_c1_1592_2614 | 340 |
| 494 | 3300053080 | Ga0500635_0012608 | Ga0500635_0012608_1180_2202 | 340 |
| 495 | 3300053080 | Ga0500635_0018800 | Ga0500635_0018800_448_1491 | 340 |
| 496 | 3300053131 | Ga0500652_009892 | Ga0500652_009892_245_1288 | 340 |
| 497 | 3300053131 | Ga0500652_070942 | Ga0500652_070942_382_1404 | 340 |
| 498 | 3300053136 | Ga0500559_0052838 | Ga0500559_0052838_126_1169 | 340 |
| 499 | 3300053730 | Ga0500645_000438 | Ga0500645_000438_2476_3519 | 340 |
| 500 | iso_pu_bacteria | 2939582691 | 2939589096 | 340 |
| 501 | 3300005841 | Ga0068863_100381004 | Ga0068863_1003810042 | 341 |
| 502 | 3300010375 | Ga0105239_10009981 | Ga0105239_1000998111 | 341 |
| 503 | 3300046524 | Ga0495648_0018611 | Ga0495648_0018611_3003_4040 | 341 |
| 504 | 3300046530 | Ga0495654_0079693 | Ga0495654_0079693_85_1122 | 341 |
| 505 | 3300046648 | Ga0495611_0034171 | Ga0495611_0034171_43_1080 | 341 |
| 506 | 3300046692 | Ga0495671_0063697 | Ga0495671_0063697_297_1334 | 341 |
| 507 | 3300047320 | Ga0495672_0004144 | Ga0495672_0004144_1146_2183 | 341 |
| 508 | 3300047444 | Ga0495675_0004548 | Ga0495675_0004548_459_1493 | 341 |
| 509 | 3300047469 | Ga0495673_0002432 | Ga0495673_0002432_10085_11122 | 341 |
| 510 | 3300048903 | Ga0496100_0005227 | Ga0496100_0005227_5757_6782 | 341 |
| 511 | 3300048904 | Ga0496101_0000075 | Ga0496101_0000075_84590_85615 | 341 |
| 512 | 3300048904 | Ga0496101_0000310 | Ga0496101_0000310_23931_24980 | 341 |
| 513 | 3300048905 | Ga0496102_0000003 | Ga0496102_0000003_198203_199228 | 341 |
| 514 | 3300048906 | Ga0496103_0000014 | Ga0496103_0000014_91388_92413 | 341 |
| 515 | 3300048908 | Ga0496105_0076631 | Ga0496105_0076631_582_1631 | 341 |
| 516 | 3300048909 | Ga0496106_0001954 | Ga0496106_0001954_3290_4339 | 341 |
| 517 | 3300048910 | Ga0496107_0005122 | Ga0496107_0005122_6501_7550 | 341 |
| 518 | 3300048910 | Ga0496107_0028877 | Ga0496107_0028877_2713_3738 | 341 |
| 519 | 3300048917 | Ga0496114_0002320 | Ga0496114_0002320_12750_13799 | 341 |
| 520 | 3300048918 | Ga0496115_0009311 | Ga0496115_0009311_1762_2811 | 341 |
| 521 | 3300048919 | Ga0496116_0000071 | Ga0496116_0000071_197338_198363 | 341 |
| 522 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_393036_394061 | 341 |
| 523 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_393039_394064 | 341 |
| 524 | 3300048922 | Ga0496119_0000266 | Ga0496119_0000266_61580_62605 | 341 |
| 525 | 3300048923 | Ga0496120_0000235 | Ga0496120_0000235_46133_47158 | 341 |
| 526 | 3300048924 | Ga0496121_0000019 | Ga0496121_0000019_207646_208671 | 341 |
| 527 | 3300048929 | Ga0496126_0000951 | Ga0496126_0000951_46138_47163 | 341 |
| 528 | 3300049581 | Ga0501047_0097938 | Ga0501047_0097938_1519_2544 | 341 |
| 529 | 3300053087 | Ga0500643_003479 | Ga0500643_003479_3009_4046 | 341 |
| 530 | 3300053098 | Ga0500650_0102349 | Ga0500650_0102349_152_1189 | 341 |
| 531 | 3300005937 | Ga0081455_10047021 | Ga0081455_100470213 | 348 |
| 532 | 3300041411 | Ga0439466_0061507 | Ga0439466_0061507_78_1124 | 348 |
| 533 | 3300042435 | Ga0439434_0027662 | Ga0439434_0027662_601_1647 | 348 |
| 534 | 3300002070 | JGI24750J21931_1008460 | JGI24750J21931_10084602 | 350 |
| 535 | 3300002077 | JGI24744J21845_10003374 | JGI24744J21845_100033742 | 350 |
| 536 | 3300002244 | JGI24742J22300_10001095 | JGI24742J22300_100010952 | 350 |
| 537 | 3300005330 | Ga0070690_100007228 | Ga0070690_1000072283 | 350 |
| 538 | 3300005334 | Ga0068869_100014974 | Ga0068869_1000149742 | 350 |
| 539 | 3300005336 | Ga0070680_100113503 | Ga0070680_1001135031 | 350 |
| 540 | 3300005337 | Ga0070682_100004933 | Ga0070682_1000049332 | 350 |
| 541 | 3300005338 | Ga0068868_100002812 | Ga0068868_1000028129 | 350 |
| 542 | 3300005341 | Ga0070691_10067301 | Ga0070691_100673011 | 350 |
| 543 | 3300005343 | Ga0070687_100087761 | Ga0070687_1000877612 | 350 |
| 544 | 3300005347 | Ga0070668_100010210 | Ga0070668_1000102101 | 350 |
| 545 | 3300005353 | Ga0070669_100008103 | Ga0070669_1000081038 | 350 |
| 546 | 3300005356 | Ga0070674_100003739 | Ga0070674_10000373910 | 350 |
| 547 | 3300005367 | Ga0070667_100005546 | Ga0070667_10000554611 | 350 |
| 548 | 3300005439 | Ga0070711_100000479 | Ga0070711_1000004797 | 350 |
| 549 | 3300005441 | Ga0070700_100013522 | Ga0070700_1000135225 | 350 |
| 550 | 3300005444 | Ga0070694_100022680 | Ga0070694_1000226803 | 350 |
| 551 | 3300005455 | Ga0070663_100003214 | Ga0070663_1000032148 | 350 |
| 552 | 3300005456 | Ga0070678_100000595 | Ga0070678_10000059510 | 350 |
| 553 | 3300005457 | Ga0070662_100012622 | Ga0070662_1000126221 | 350 |
| 554 | 3300005459 | Ga0068867_100001973 | Ga0068867_10000197310 | 350 |
| 555 | 3300005536 | Ga0070697_100305112 | Ga0070697_1003051122 | 350 |
| 556 | 3300005546 | Ga0070696_100012568 | Ga0070696_1000125682 | 350 |
| 557 | 3300005548 | Ga0070665_100286620 | Ga0070665_1002866202 | 350 |
| 558 | 3300005549 | Ga0070704_100000666 | Ga0070704_10000066612 | 350 |
| 559 | 3300005578 | Ga0068854_100003429 | Ga0068854_1000034299 | 350 |
| 560 | 3300005616 | Ga0068852_100288684 | Ga0068852_1002886842 | 350 |
| 561 | 3300005718 | Ga0068866_10001353 | Ga0068866_100013536 | 350 |
| 562 | 3300005719 | Ga0068861_100009323 | Ga0068861_1000093233 | 350 |
| 563 | 3300005842 | Ga0068858_100015481 | Ga0068858_1000154812 | 350 |
| 564 | 3300005843 | Ga0068860_100011255 | Ga0068860_1000112553 | 350 |
| 565 | 3300005844 | Ga0068862_100271605 | Ga0068862_1002716052 | 350 |
| 566 | 3300006163 | Ga0070715_10004540 | Ga0070715_100045403 | 350 |
| 567 | 3300006358 | Ga0068871_100021812 | Ga0068871_1000218125 | 350 |
| 568 | 3300006881 | Ga0068865_100010272 | Ga0068865_1000102724 | 350 |
| 569 | 3300009094 | Ga0111539_10254263 | Ga0111539_102542632 | 350 |
| 570 | 3300009098 | Ga0105245_10004418 | Ga0105245_100044189 | 350 |
| 571 | 3300009101 | Ga0105247_10002837 | Ga0105247_100028373 | 350 |
| 572 | 3300009174 | Ga0105241_10083795 | Ga0105241_100837952 | 350 |
| 573 | 3300009176 | Ga0105242_10001113 | Ga0105242_1000111318 | 350 |
| 574 | 3300009177 | Ga0105248_10003348 | Ga0105248_1000334812 | 350 |
| 575 | 3300009553 | Ga0105249_10001976 | Ga0105249_1000197618 | 350 |
| 576 | 3300010375 | Ga0105239_10010576 | Ga0105239_1001057611 | 350 |
| 577 | 3300013296 | Ga0157374_10124598 | Ga0157374_101245983 | 350 |
| 578 | 3300013297 | Ga0157378_10009136 | Ga0157378_100091369 | 350 |
| 579 | 3300013306 | Ga0163162_10013602 | Ga0163162_100136025 | 350 |
| 580 | 3300013307 | Ga0157372_10007458 | Ga0157372_100074587 | 350 |
| 581 | 3300014326 | Ga0157380_10000771 | Ga0157380_100007718 | 350 |
| 582 | 3300014968 | Ga0157379_10006231 | Ga0157379_1000623111 | 350 |
| 583 | 3300017792 | Ga0163161_10002358 | Ga0163161_100023587 | 350 |
| 584 | 3300025899 | Ga0207642_10000124 | Ga0207642_1000012418 | 350 |
| 585 | 3300025900 | Ga0207710_10003442 | Ga0207710_100034428 | 350 |
| 586 | 3300025901 | Ga0207688_10002685 | Ga0207688_100026853 | 350 |
| 587 | 3300025905 | Ga0207685_10029080 | Ga0207685_100290803 | 350 |
| 588 | 3300025915 | Ga0207693_10001826 | Ga0207693_100018268 | 350 |
| 589 | 3300025916 | Ga0207663_10002536 | Ga0207663_100025362 | 350 |
| 590 | 3300025918 | Ga0207662_10005313 | Ga0207662_100053134 | 350 |
| 591 | 3300025923 | Ga0207681_10079363 | Ga0207681_100793632 | 350 |
| 592 | 3300025927 | Ga0207687_10003894 | Ga0207687_100038946 | 350 |
| 593 | 3300025929 | Ga0207664_10248421 | Ga0207664_102484212 | 350 |
| 594 | 3300025933 | Ga0207706_10005962 | Ga0207706_100059628 | 350 |
| 595 | 3300025935 | Ga0207709_10006328 | Ga0207709_100063282 | 350 |
| 596 | 3300025937 | Ga0207669_10002064 | Ga0207669_100020645 | 350 |
| 597 | 3300025938 | Ga0207704_10000291 | Ga0207704_1000029118 | 350 |
| 598 | 3300025939 | Ga0207665_10001751 | Ga0207665_1000175113 | 350 |
| 599 | 3300025940 | Ga0207691_10054294 | Ga0207691_100542943 | 350 |
| 600 | 3300025941 | Ga0207711_10087903 | Ga0207711_100879032 | 350 |
| 601 | 3300025942 | Ga0207689_10011177 | Ga0207689_100111775 | 350 |
| 602 | 3300025961 | Ga0207712_10005062 | Ga0207712_100050622 | 350 |
| 603 | 3300025972 | Ga0207668_10003268 | Ga0207668_100032687 | 350 |
| 604 | 3300025981 | Ga0207640_10005157 | Ga0207640_100051578 | 350 |
| 605 | 3300025986 | Ga0207658_10014287 | Ga0207658_100142874 | 350 |
| 606 | 3300026023 | Ga0207677_10005648 | Ga0207677_100056488 | 350 |
| 607 | 3300026035 | Ga0207703_10076965 | Ga0207703_100769653 | 350 |
| 608 | 3300026041 | Ga0207639_10002547 | Ga0207639_100025478 | 350 |
| 609 | 3300026067 | Ga0207678_10011314 | Ga0207678_100113148 | 350 |
| 610 | 3300026075 | Ga0207708_10002264 | Ga0207708_100022649 | 350 |
| 611 | 3300026089 | Ga0207648_10002008 | Ga0207648_100020087 | 350 |
| 612 | 3300026118 | Ga0207675_100003453 | Ga0207675_10000345311 | 350 |
| 613 | 3300026121 | Ga0207683_10003523 | Ga0207683_1000352310 | 350 |
| 614 | 3300026142 | Ga0207698_10010560 | Ga0207698_100105603 | 350 |
| 615 | 3300028379 | Ga0268266_10042535 | Ga0268266_100425352 | 350 |
| 616 | 3300028380 | Ga0268265_10104994 | Ga0268265_101049941 | 350 |
| 617 | 3300028381 | Ga0268264_10002955 | Ga0268264_100029552 | 350 |
| 618 | 3300035242 | Ga0373962_0051657 | Ga0373962_0051657_24_1097 | 350 |
| 619 | 3300048903 | Ga0496100_0006724 | Ga0496100_0006724_552_1625 | 350 |
| 620 | 3300048904 | Ga0496101_0041333 | Ga0496101_0041333_2038_3090 | 350 |
| 621 | 3300048906 | Ga0496103_0011056 | Ga0496103_0011056_617_1690 | 350 |
| 622 | 3300048909 | Ga0496106_0035640 | Ga0496106_0035640_153_1226 | 350 |
| 623 | 3300048910 | Ga0496107_0011433 | Ga0496107_0011433_4971_6044 | 350 |
| 624 | 3300048918 | Ga0496115_0005302 | Ga0496115_0005302_6874_7947 | 350 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1hnk-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii, apo tetragonal form | 0.8999 | 6 | 336 |
| 4x9o-assembly1.cif.gz_B | beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate | 0.8956 | 4 | 340 |
| 1hnk-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii, apo tetragonal form | 0.8936 | 6 | 336 |
| 4x0o-assembly1.cif.gz_A | beta-ketoacyl-(acyl carrier protein) synthase iii-2 (fabh2) from vibrio cholerae soaked with acetyl-coa | 0.8919 | 4 | 344 |
| 4wzu-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-(acyl carrier protein) synthase iii-2 (fabh2) from vibrio cholerae | 0.8912 | 4 | 340 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1hnkA02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9491 | 239 | 336 | 3.40.47.10 |
| 1hn9A02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.8968 | 185 | 336 | 3.40.47.10 |
| 2ebdB02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.8958 | 181 | 336 | 3.40.47.10 |
| 4x9oB00 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.8956 | 4 | 340 | 3.40.47.10 |
| 2ebdB02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.8898 | 181 | 336 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A101AQQ3-F1-model_v4 | deleted | 0.9849 | 6 | 339 |
|
| AF-A0A101AQQ3-F1-model_v4 | deleted | 0.9733 | 6 | 339 |
|
| AF-X8C9R0-F1-model_v4 | 3-Oxoacyl-[acyl-carrier-(ACP)] synthase III family protein | 0.9698 | 4 | 217 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A351GHW3-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9659 | 227 | 336 |
GO:0016746
|
| AF-W7J4G5-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180) | 0.9657 | 221 | 336 |
GO:0017000
GO:0033818 GO:0044550 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar