F470149

General Info

Members Datasets Scaffolds Average Seq Length
622 288 1244 126

Family's Representative Sequence

Representative Sequence 3300053151|Ga0500604_0079076|Ga0500604_0079076_270_659
Length 129
Sequence MPATPASDAERIAAAQAYIDALVSHDADKVPFAPGCTRIEVGVKTGFSANHLRRSLNRGVQYRVIQATTVPEFTVVDGDTIQAKFDLVTKPSLLGRKVGAHIDETFQISAADGLIHHIRAGIRPFVTAS

Samples

Sample ID Description Type Environment
1 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
191 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
194 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
195 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
196 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
199 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
200 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
274 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
277 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
278 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
279 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
280 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
281 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
282 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
283 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
284 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
285 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
286 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
287 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
288 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.77
Nodule 0.16
Rhizoplane 11.09
Rhizosphere 65.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500604_0079076 3300053151 Bacteria 1060
2 LJNas_1009105 3300000546 Bacteria 1064
3 JGI24746J21847_1005157 3300001977 Bacteria 2043
4 JGI24750J21931_1046308 3300002070 Bacteria 670
5 JGI24744J21845_10008713 3300002077 Bacteria 2084
6 JGI24742J22300_10003180 3300002244 Bacteria 2656
7 rootH2_10270332 3300003320 Bacteria 1072
8 Ga0055540_1001998 3300003792 Bacteria 11401
9 Ga0055540_1003798 3300003792 Bacteria 7117
10 Ga0070676_10025306 3300005328 Bacteria 3353
11 Ga0070683_100844380 3300005329 Bacteria 878
12 Ga0070690_100066642 3300005330 Bacteria 2331
13 Ga0070690_100808971 3300005330 Bacteria 727
14 Ga0070670_100101299 3300005331 Bacteria 2480
15 Ga0068869_100025221 3300005334 Bacteria 4126
16 Ga0068869_100031218 3300005334 Bacteria 3747
17 Ga0070666_10215865 3300005335 Bacteria 1352
18 Ga0070682_100115617 3300005337 Bacteria 1794
19 Ga0070682_100133346 3300005337 Bacteria 1684
20 Ga0070682_100305754 3300005337 Bacteria 1169
21 Ga0070682_101089981 3300005337 Bacteria 668
22 Ga0070682_101887669 3300005337 Bacteria 523
23 Ga0068868_100006841 3300005338 Bacteria 8098
24 Ga0070689_100032780 3300005340 Bacteria 3954
25 Ga0070689_100382233 3300005340 Bacteria 1187
26 Ga0070691_10009126 3300005341 Bacteria 4534
27 Ga0070661_100876176 3300005344 Bacteria 740
28 Ga0070692_10032070 3300005345 Bacteria 2639
29 Ga0070668_100000668 3300005347 Bacteria 23244
30 Ga0070675_100644047 3300005354 Bacteria 963
31 Ga0070671_100004655 3300005355 Bacteria 10880
32 Ga0070671_100100725 3300005355 Bacteria 2424
33 Ga0070671_100630110 3300005355 Bacteria 928
34 Ga0070674_100000670 3300005356 Bacteria 17325
35 Ga0070674_100483112 3300005356 Bacteria 1028
36 Ga0070674_100636034 3300005356 Bacteria 905
37 Ga0070673_100170531 3300005364 Bacteria 1857
38 Ga0070688_100247107 3300005365 Bacteria 1269
39 Ga0070659_100101927 3300005366 Bacteria 2311
40 Ga0070659_100324355 3300005366 Bacteria 1288
41 Ga0070659_100502226 3300005366 Bacteria 1034
42 Ga0070659_101384686 3300005366 Bacteria 625
43 Ga0070667_100038153 3300005367 Bacteria 4028
44 Ga0070667_100758177 3300005367 Bacteria 900
45 Ga0070667_100875672 3300005367 Bacteria 835
46 Ga0070703_10018256 3300005406 Bacteria 2026
47 Ga0070709_10041815 3300005434 Bacteria 2826
48 Ga0070714_100011070 3300005435 Bacteria 7147
49 Ga0070714_100364249 3300005435 Bacteria 1360
50 Ga0070713_100008148 3300005436 Bacteria 7418
51 Ga0070713_100157718 3300005436 Bacteria 2024
52 Ga0070710_10004825 3300005437 Bacteria 6377
53 Ga0070710_10019420 3300005437 Bacteria 3512
54 Ga0070710_10564310 3300005437 Bacteria 788
55 Ga0070701_10087661 3300005438 Bacteria 1698
56 Ga0070711_100000314 3300005439 Bacteria 25098
57 Ga0070711_100017624 3300005439 Bacteria 4549
58 Ga0070705_100028759 3300005440 Bacteria 3048
59 Ga0070705_100383668 3300005440 Bacteria 1035
60 Ga0070705_100667487 3300005440 Bacteria 812
61 Ga0070700_100001750 3300005441 Bacteria 10914
62 Ga0070700_100315425 3300005441 Bacteria 1146
63 Ga0070700_100536372 3300005441 Bacteria 907
64 Ga0070700_101272530 3300005441 Bacteria 617
65 Ga0070663_100064928 3300005455 Bacteria 2640
66 Ga0070663_100650282 3300005455 Bacteria 891
67 Ga0070663_101549789 3300005455 Bacteria 590
68 Ga0070678_100000573 3300005456 Bacteria 18054
69 Ga0070678_100050012 3300005456 Bacteria 3020
70 Ga0070662_100020856 3300005457 Bacteria 4469
71 Ga0070662_100164320 3300005457 Bacteria 1738
72 Ga0070662_100634807 3300005457 Bacteria 900
73 Ga0068867_100000498 3300005459 Bacteria 26212
74 Ga0068867_100028621 3300005459 Bacteria 4012
75 Ga0070685_10237050 3300005466 Bacteria 1203
76 Ga0070685_10446737 3300005466 Bacteria 905
77 Ga0070685_10767844 3300005466 Bacteria 708
78 Ga0070679_100476783 3300005530 Bacteria 1192
79 Ga0070684_101313165 3300005535 Bacteria 681
80 Ga0068853_100002702 3300005539 Bacteria 13376
81 Ga0068853_100582016 3300005539 Bacteria 1062
82 Ga0068853_100936796 3300005539 Bacteria 833
83 Ga0070672_100248812 3300005543 Bacteria 1497
84 Ga0070672_100415424 3300005543 Bacteria 1155
85 Ga0070686_100123768 3300005544 Bacteria 1779
86 Ga0070695_100000790 3300005545 Bacteria 17051
87 Ga0070693_100052951 3300005547 Bacteria 2328
88 Ga0070693_100082566 3300005547 Bacteria 1919
89 Ga0070693_100475005 3300005547 Bacteria 882
90 Ga0070665_100003208 3300005548 Bacteria 17593
91 Ga0070665_100073216 3300005548 Bacteria 3433
92 Ga0070665_101366610 3300005548 Bacteria 718
93 Ga0070704_100002466 3300005549 Bacteria 10390
94 Ga0070704_100319966 3300005549 Bacteria 1299
95 Ga0068855_100642118 3300005563 Bacteria 1141
96 Ga0070664_100295145 3300005564 Bacteria 1464
97 Ga0068857_100513870 3300005577 Bacteria 1125
98 Ga0068854_100000891 3300005578 Bacteria 17935
99 Ga0068854_100815782 3300005578 Bacteria 814
100 Ga0068856_100069711 3300005614 Bacteria 3477
101 Ga0070702_100000125 3300005615 Bacteria 23573
102 Ga0070702_100077403 3300005615 Bacteria 1982
103 Ga0070702_100316797 3300005615 Bacteria 1085
104 Ga0068852_100332127 3300005616 Bacteria 1479
105 Ga0068852_100402675 3300005616 Bacteria 1346
106 Ga0068852_100736056 3300005616 Bacteria 998
107 Ga0068859_100008459 3300005617 Bacteria 10419
108 Ga0068859_100029745 3300005617 Bacteria 5480
109 Ga0068864_100191598 3300005618 Bacteria 1874
110 Ga0068864_101606836 3300005618 Bacteria 654
111 Ga0068861_100004013 3300005719 Bacteria 9854
112 Ga0068861_101349880 3300005719 Bacteria 695
113 Ga0068851_10109830 3300005834 Bacteria 1471
114 Ga0068863_100002843 3300005841 Bacteria 17141
115 Ga0068863_101007469 3300005841 Bacteria 836
116 Ga0068863_101308300 3300005841 Bacteria 732
117 Ga0068858_100004199 3300005842 Bacteria 14180
118 Ga0068858_100122950 3300005842 Bacteria 2429
119 Ga0068858_101034545 3300005842 Bacteria 805
120 Ga0068860_100001829 3300005843 Bacteria 22655
121 Ga0068860_100323240 3300005843 Bacteria 1514
122 Ga0068862_100001560 3300005844 Bacteria 20916
123 Ga0068862_100175598 3300005844 Bacteria 1920
124 Ga0068862_101099150 3300005844 Bacteria 790
125 Ga0068862_102715841 3300005844 Bacteria 507
126 Ga0081455_10000782 3300005937 Bacteria 40906
127 Ga0081455_10092186 3300005937 Bacteria 2452
128 Ga0081455_10285251 3300005937 Bacteria 1191
129 Ga0081455_10457741 3300005937 Bacteria 869
130 Ga0070717_10133129 3300006028 Bacteria 2139
131 Ga0075365_10013421 3300006038 Bacteria 4899
132 Ga0075365_10029454 3300006038 Bacteria 3510
133 Ga0075365_10071492 3300006038 Bacteria 2336
134 Ga0075365_10107493 3300006038 Bacteria 1916
135 Ga0075365_10503851 3300006038 Bacteria 856
136 Ga0075365_10679994 3300006038 Bacteria 727
137 Ga0075363_100005063 3300006048 Bacteria 5828
138 Ga0075363_100052543 3300006048 Bacteria 2175
139 Ga0075363_100091304 3300006048 Bacteria 1676
140 Ga0075363_100099194 3300006048 Bacteria 1611
141 Ga0075363_100107918 3300006048 Bacteria 1545
142 Ga0075363_100203480 3300006048 Bacteria 1132
143 Ga0075363_100386689 3300006048 Bacteria 821
144 Ga0075363_100441032 3300006048 Bacteria 768
145 Ga0075363_100460117 3300006048 Bacteria 752
146 Ga0075363_100514232 3300006048 Bacteria 712
147 Ga0075363_100590038 3300006048 Bacteria 665
148 Ga0075364_10013803 3300006051 Bacteria 4977
149 Ga0075364_10028042 3300006051 Bacteria 3602
150 Ga0075364_10031536 3300006051 Bacteria 3405
151 Ga0075364_10037456 3300006051 Bacteria 3140
152 Ga0075364_10043248 3300006051 Bacteria 2928
153 Ga0075364_10055232 3300006051 Bacteria 2598
154 Ga0075364_10135452 3300006051 Bacteria 1654
155 Ga0075364_10149367 3300006051 Bacteria 1574
156 Ga0075364_10357856 3300006051 Bacteria 995
157 Ga0070715_10008190 3300006163 Bacteria 3634
158 Ga0070715_10310010 3300006163 Bacteria 848
159 Ga0070716_100003886 3300006173 Bacteria 7091
160 Ga0070716_100012845 3300006173 Bacteria 4256
161 Ga0070712_100004966 3300006175 Bacteria 8228
162 Ga0070712_100081606 3300006175 Bacteria 2343
163 Ga0075362_10020823 3300006177 Bacteria 2744
164 Ga0075362_10041861 3300006177 Bacteria 2022
165 Ga0075367_10026730 3300006178 Bacteria 3275
166 Ga0075367_10078284 3300006178 Bacteria 1996
167 Ga0075367_10130879 3300006178 Bacteria 1551
168 Ga0075367_10321865 3300006178 Bacteria 974
169 Ga0075367_10416666 3300006178 Bacteria 850
170 Ga0075369_10005893 3300006186 Bacteria 4606
171 Ga0075369_10018184 3300006186 Bacteria 2859
172 Ga0075369_10055752 3300006186 Bacteria 1718
173 Ga0075369_10110242 3300006186 Bacteria 1240
174 Ga0075369_10168165 3300006186 Bacteria 1006
175 Ga0075369_10206178 3300006186 Bacteria 908
176 Ga0075369_10341888 3300006186 Bacteria 701
177 Ga0075369_10346691 3300006186 Bacteria 696
178 Ga0075369_10435604 3300006186 Bacteria 620
179 Ga0075366_10935646 3300006195 Bacteria 540
180 Ga0097621_100763184 3300006237 Bacteria 894
181 Ga0075370_10004013 3300006353 Bacteria 7072
182 Ga0075370_10069320 3300006353 Bacteria 2015
183 Ga0075370_10077795 3300006353 Bacteria 1904
184 Ga0075370_10174297 3300006353 Bacteria 1265
185 Ga0075370_10284709 3300006353 Bacteria 982
186 Ga0075370_10414506 3300006353 Bacteria 809
187 Ga0075370_10451563 3300006353 Bacteria 773
188 Ga0068871_100124134 3300006358 Bacteria 2184
189 Ga0068871_100190596 3300006358 Bacteria 1766
190 Ga0068871_100678769 3300006358 Bacteria 942
191 Ga0075428_100039700 3300006844 Bacteria 5180
192 Ga0075428_101507426 3300006844 Bacteria 704
193 Ga0075430_100017061 3300006846 Bacteria 6185
194 Ga0075431_100186031 3300006847 Bacteria 2130
195 Ga0068865_100000861 3300006881 Bacteria 17226
196 Ga0068865_100257255 3300006881 Bacteria 1381
197 Ga0097620_100008459 3300006931 Bacteria 10419
198 Ga0097620_100029746 3300006931 Bacteria 5480
199 Ga0105244_10139803 3300009036 Bacteria 1165
200 Ga0105240_10231328 3300009093 Bacteria 2148
201 Ga0111539_10276976 3300009094 Bacteria 1952
202 Ga0105245_10005820 3300009098 Bacteria 10820
203 Ga0105245_10157631 3300009098 Bacteria 2151
204 Ga0105245_10183181 3300009098 Bacteria 2002
205 Ga0105245_12777168 3300009098 Bacteria 542
206 Ga0105247_10005519 3300009101 Bacteria 7960
207 Ga0105247_10192746 3300009101 Bacteria 1365
208 Ga0105243_10007672 3300009148 Bacteria 8289
209 Ga0105243_10300287 3300009148 Bacteria 1455
210 Ga0105241_10046942 3300009174 Bacteria 3282
211 Ga0105242_10001151 3300009176 Bacteria 20832
212 Ga0105248_10014177 3300009177 Bacteria 8775
213 Ga0105248_10081708 3300009177 Bacteria 3633
214 Ga0105248_12957152 3300009177 Bacteria 541
215 Ga0105237_10264988 3300009545 Bacteria 1721
216 Ga0105237_10321774 3300009545 Bacteria 1550
217 Ga0105238_10049395 3300009551 Bacteria 4237
218 Ga0105238_13024716 3300009551 Bacteria 505
219 Ga0105249_10013183 3300009553 Bacteria 7294
220 Ga0105249_10100746 3300009553 Bacteria 2716
221 Ga0105147_111674 3300009982 Bacteria 746
222 Ga0099796_10021990 3300010159 Bacteria 1972
223 Ga0105239_10019191 3300010375 Bacteria 7552
224 Ga0105239_10123145 3300010375 Bacteria 2881
225 Ga0105246_10071028 3300011119 Bacteria 2450
226 Ga0157369_10420364 3300013105 Bacteria 1386
227 Ga0157369_10867240 3300013105 Bacteria 926
228 Ga0157374_10046311 3300013296 Bacteria 4027
229 Ga0157374_10189901 3300013296 Bacteria 2009
230 Ga0157378_10019709 3300013297 Bacteria 5931
231 Ga0157378_10191555 3300013297 Bacteria 1929
232 Ga0163162_10006909 3300013306 Bacteria 11007
233 Ga0163162_10125942 3300013306 Bacteria 2668
234 Ga0163162_10194890 3300013306 Bacteria 2154
235 Ga0157372_10006040 3300013307 Bacteria 12867
236 Ga0157372_10445550 3300013307 Bacteria 1509
237 Ga0157372_12171080 3300013307 Bacteria 638
238 Ga0157375_10014110 3300013308 Bacteria 7125
239 Ga0157375_10094534 3300013308 Bacteria 3058
240 Ga0157375_10208977 3300013308 Bacteria 2109
241 Ga0157375_11910339 3300013308 Bacteria 705
242 Ga0163163_10040397 3300014325 Bacteria 4555
243 Ga0163163_11141856 3300014325 Bacteria 842
244 Ga0163163_11468472 3300014325 Bacteria 743
245 Ga0157380_10004610 3300014326 Bacteria 9573
246 Ga0157380_10370124 3300014326 Bacteria 1348
247 Ga0157377_10091655 3300014745 Bacteria 1796
248 Ga0157377_10180876 3300014745 Bacteria 1326
249 Ga0157377_11109623 3300014745 Bacteria 607
250 Ga0157377_11263167 3300014745 Bacteria 575
251 Ga0157379_10054029 3300014968 Bacteria 3589
252 Ga0157379_10439656 3300014968 Bacteria 1203
253 Ga0157379_10555100 3300014968 Bacteria 1069
254 Ga0157376_10480813 3300014969 Bacteria 1217
255 Ga0163161_10003677 3300017792 Bacteria 10756
256 Ga0163161_10071532 3300017792 Bacteria 2538
257 Ga0163161_11101857 3300017792 Bacteria 682
258 Ga0213875_10542394 3300021388 Bacteria 560
259 Ga0209673_1007893 3300025273 Bacteria 4814
260 Ga0209673_1063466 3300025273 Bacteria 911
261 Ga0209051_1000457 3300025303 Bacteria 53817
262 Ga0209051_1001136 3300025303 Bacteria 24323
263 Ga0209051_1003245 3300025303 Bacteria 10808
264 Ga0209051_1011316 3300025303 Bacteria 4414
265 Ga0207656_10169700 3300025321 Bacteria 1042
266 Ga0207696_1089576 3300025711 Bacteria 843
267 Ga0207653_10011080 3300025885 Bacteria 2815
268 Ga0207692_10065057 3300025898 Bacteria 1901
269 Ga0207692_10217714 3300025898 Bacteria 1130
270 Ga0207642_10002204 3300025899 Bacteria 6041
271 Ga0207710_10007991 3300025900 Bacteria 4472
272 Ga0207710_10112171 3300025900 Bacteria 1295
273 Ga0207688_10001427 3300025901 Bacteria 12464
274 Ga0207688_10013926 3300025901 Bacteria 4372
275 Ga0207688_10543246 3300025901 Bacteria 730
276 Ga0207647_10044840 3300025904 Bacteria 2761
277 Ga0207685_10019534 3300025905 Bacteria 2235
278 Ga0207685_10196061 3300025905 Bacteria 946
279 Ga0207699_10016435 3300025906 Bacteria 3872
280 Ga0207699_10037681 3300025906 Bacteria 2766
281 Ga0207699_10266172 3300025906 Bacteria 1186
282 Ga0207645_10201774 3300025907 Bacteria 1309
283 Ga0207654_10155937 3300025911 Bacteria 1470
284 Ga0207695_11126946 3300025913 Bacteria 664
285 Ga0207671_10203307 3300025914 Bacteria 1547
286 Ga0207671_10323638 3300025914 Bacteria 1220
287 Ga0207693_10000698 3300025915 Bacteria 30147
288 Ga0207693_10004121 3300025915 Bacteria 12340
289 Ga0207663_10001329 3300025916 Bacteria 11434
290 Ga0207663_10093458 3300025916 Bacteria 2002
291 Ga0207649_10518058 3300025920 Bacteria 909
292 Ga0207681_10383796 3300025923 Bacteria 1131
293 Ga0207694_10133188 3300025924 Bacteria 1994
294 Ga0207687_10004034 3300025927 Bacteria 9835
295 Ga0207687_10061945 3300025927 Bacteria 2644
296 Ga0207687_10450159 3300025927 Bacteria 1068
297 Ga0207687_11535426 3300025927 Bacteria 572
298 Ga0207700_10037441 3300025928 Bacteria 3513
299 Ga0207700_10202376 3300025928 Bacteria 1674
300 Ga0207700_10651405 3300025928 Bacteria 939
301 Ga0207664_10131075 3300025929 Bacteria 2110
302 Ga0207644_10079177 3300025931 Bacteria 2424
303 Ga0207644_10290121 3300025931 Bacteria 1315
304 Ga0207690_10034042 3300025932 Bacteria 3280
305 Ga0207706_10069770 3300025933 Bacteria 3091
306 Ga0207706_10124411 3300025933 Bacteria 2269
307 Ga0207686_10017782 3300025934 Bacteria 4012
308 Ga0207709_10003375 3300025935 Bacteria 9536
309 Ga0207709_11138031 3300025935 Bacteria 642
310 Ga0207670_10507218 3300025936 Bacteria 980
311 Ga0207670_10609520 3300025936 Bacteria 897
312 Ga0207669_10006430 3300025937 Bacteria 5369
313 Ga0207669_10326134 3300025937 Bacteria 1177
314 Ga0207704_10000279 3300025938 Bacteria 24450
315 Ga0207665_10019560 3300025939 Bacteria 4452
316 Ga0207665_10032619 3300025939 Bacteria 3449
317 Ga0207691_10042301 3300025940 Bacteria 4201
318 Ga0207691_10168455 3300025940 Bacteria 1919
319 Ga0207711_10037883 3300025941 Bacteria 4098
320 Ga0207711_10056465 3300025941 Bacteria 3374
321 Ga0207711_11604183 3300025941 Bacteria 594
322 Ga0207661_10114805 3300025944 Bacteria 2284
323 Ga0207667_10613153 3300025949 Bacteria 1096
324 Ga0207651_10147683 3300025960 Bacteria 1826
325 Ga0207651_11288678 3300025960 Bacteria 657
326 Ga0207712_10003208 3300025961 Bacteria 10395
327 Ga0207712_10207332 3300025961 Bacteria 1559
328 Ga0207668_10000917 3300025972 Bacteria 17754
329 Ga0207640_10033813 3300025981 Bacteria 3184
330 Ga0207640_10056470 3300025981 Bacteria 2577
331 Ga0207640_10664396 3300025981 Bacteria 889
332 Ga0207658_10028503 3300025986 Bacteria 3932
333 Ga0207658_10068765 3300025986 Bacteria 2673
334 Ga0207658_10650448 3300025986 Bacteria 950
335 Ga0207677_10017261 3300026023 Bacteria 4298
336 Ga0207677_10736742 3300026023 Bacteria 877
337 Ga0207703_10049501 3300026035 Bacteria 3397
338 Ga0207703_10281280 3300026035 Bacteria 1511
339 Ga0207703_10714284 3300026035 Bacteria 954
340 Ga0207703_10904475 3300026035 Bacteria 845
341 Ga0207639_10017157 3300026041 Bacteria 5130
342 Ga0207639_10139242 3300026041 Bacteria 2019
343 Ga0207639_10585583 3300026041 Bacteria 1027
344 Ga0207678_10022201 3300026067 Bacteria 5561
345 Ga0207678_10044436 3300026067 Bacteria 3843
346 Ga0207678_10230590 3300026067 Bacteria 1586
347 Ga0207678_10332301 3300026067 Bacteria 1309
348 Ga0207678_10350624 3300026067 Bacteria 1273
349 Ga0207678_10707553 3300026067 Bacteria 887
350 Ga0207708_10003268 3300026075 Bacteria 11950
351 Ga0207708_10080582 3300026075 Bacteria 2501
352 Ga0207708_11129985 3300026075 Bacteria 684
353 Ga0207708_11156308 3300026075 Bacteria 676
354 Ga0207702_10158683 3300026078 Bacteria 2064
355 Ga0207702_10339487 3300026078 Bacteria 1435
356 Ga0207641_10050027 3300026088 Bacteria 3534
357 Ga0207641_10262096 3300026088 Bacteria 1619
358 Ga0207641_10905189 3300026088 Bacteria 876
359 Ga0207648_10006557 3300026089 Bacteria 11560
360 Ga0207676_10441119 3300026095 Bacteria 1225
361 Ga0207675_100001052 3300026118 Bacteria 27348
362 Ga0207675_101382889 3300026118 Bacteria 724
363 Ga0207683_10001365 3300026121 Bacteria 22077
364 Ga0207683_10053782 3300026121 Bacteria 3531
365 Ga0207698_10178996 3300026142 Bacteria 1876
366 Ga0207698_10250318 3300026142 Bacteria 1621
367 Ga0207428_10166983 3300027907 Bacteria 1668
368 Ga0268266_10002931 3300028379 Bacteria 17640
369 Ga0268266_10518895 3300028379 Bacteria 1139
370 Ga0268266_11385197 3300028379 Bacteria 679
371 Ga0268265_10146212 3300028380 Bacteria 1986
372 Ga0268265_10646736 3300028380 Bacteria 1016
373 Ga0268264_10006370 3300028381 Bacteria 9948
374 Ga0307406_10220748 3300031901 Bacteria 1409
375 Ga0307409_100612584 3300031995 Bacteria 1077
376 Ga0307409_100779607 3300031995 Bacteria 962
377 Ga0307409_101457772 3300031995 Bacteria 711
378 Ga0307416_101967584 3300032002 Bacteria 687
379 Ga0307411_10670718 3300032005 Bacteria 900
380 Ga0307415_100126532 3300032126 Bacteria 1927
381 Ga0307415_100777197 3300032126 Bacteria 872
382 Ga0373929_0051351 3300035085 Bacteria 943
383 Ga0373951_0010229 3300035091 Bacteria 2106
384 Ga0373932_0349187 3300035112 Bacteria 562
385 Ga0373942_0073799 3300035207 Bacteria 1001
386 Ga0373931_0075260 3300035691 Bacteria 1851
387 Ga0373931_0181876 3300035691 Bacteria 1245
388 Ga0436364_0515775 3300037853 Bacteria 2492
389 Ga0436363_0392846 3300039450 Bacteria 930
390 Ga0439466_0081904 3300041411 Bacteria 1017
391 Ga0439466_0103747 3300041411 Bacteria 885
392 Ga0439465_0009928 3300041413 Bacteria 2997
393 Ga0439465_0029544 3300041413 Bacteria 1742
394 Ga0439465_0056535 3300041413 Bacteria 1293
395 Ga0439465_0099385 3300041413 Bacteria 1003
396 Ga0451789_0510679 3300041443 Bacteria 579
397 Ga0451793_1315040 3300041452 Bacteria 704
398 Ga0451795_1559105 3300041456 Bacteria 1844
399 Ga0451800_0898859 3300041459 Bacteria 945
400 Ga0451800_1546053 3300041459 Bacteria 889
401 Ga0451807_1175032 3300041486 Bacteria 1110
402 Ga0451837_0948585 3300041494 Bacteria 611
403 Ga0451839_0105349 3300041496 Bacteria 1057
404 Ga0451849_0980699 3300041505 Bacteria 732
405 Ga0451851_0227724 3300041507 Bacteria 504
406 Ga0451853_2862731 3300041512 Bacteria 1469
407 Ga0439445_0012957 3300042004 Bacteria 2012
408 Ga0439445_0108757 3300042004 Bacteria 790
409 Ga0439435_0047629 3300042436 Bacteria 1218
410 Ga0439460_0082887 3300042461 Bacteria 1009
411 Ga0466969_0033782 3300044656 Bacteria 2595
412 Ga0466972_0405015 3300044658 Bacteria 639
413 Ga0466965_0005457 3300044683 Bacteria 5733
414 Ga0466965_0242460 3300044683 Bacteria 965
415 Ga0466966_0041831 3300044684 Bacteria 2943
416 Ga0466966_0045653 3300044684 Bacteria 2800
417 Ga0466961_0055388 3300044693 Bacteria 2528
418 Ga0466961_0073378 3300044693 Bacteria 2170
419 Ga0466963_0069880 3300044694 Bacteria 2361
420 Ga0466963_0795939 3300044694 Bacteria 667
421 Ga0466964_0091031 3300044706 Bacteria 1327
422 Ga0466971_0029425 3300044719 Bacteria 2457
423 Ga0466971_0377910 3300044719 Bacteria 688
424 Ga0466968_0008335 3300044735 Bacteria 3967
425 Ga0466968_0062270 3300044735 Bacteria 1611
426 Ga0466968_0067993 3300044735 Bacteria 1546
427 Ga0466970_0024024 3300044765 Bacteria 3186
428 Ga0466970_0040986 3300044765 Bacteria 2460
429 Ga0466970_0421443 3300044765 Bacteria 763
430 Ga0466957_0003928 3300044842 Bacteria 8218
431 Ga0466957_0051845 3300044842 Bacteria 2497
432 Ga0466957_0514218 3300044842 Bacteria 831
433 Ga0466960_0091659 3300044901 Bacteria 1550
434 Ga0466959_0070895 3300045049 Bacteria 2524
435 Ga0466959_0245603 3300045049 Bacteria 1235
436 Ga0466958_0000490 3300045836 Bacteria 16540
437 Ga0466958_0035562 3300045836 Bacteria 2976
438 Ga0466958_0364805 3300045836 Bacteria 931
439 Ga0466967_0146582 3300045976 Bacteria 2202
440 Ga0466967_0314298 3300045976 Bacteria 1510
441 Ga0495638_0028877 3300046460 Bacteria 3578
442 Ga0495606_0485280 3300046507 Bacteria 627
443 Ga0495648_0007578 3300046524 Bacteria 8670
444 Ga0495597_0219769 3300046542 Bacteria 755
445 Ga0495672_0152443 3300047320 Bacteria 1197
446 Ga0495672_0201845 3300047320 Bacteria 994
447 Ga0495673_0000867 3300047469 Bacteria 28018
448 Ga0495686_0003063 3300047472 Bacteria 14817
449 Ga0496100_0000369 3300048903 Bacteria 21896
450 Ga0496100_0004153 3300048903 Bacteria 7639
451 Ga0496100_0122662 3300048903 Bacteria 1820
452 Ga0496100_0147585 3300048903 Bacteria 1674
453 Ga0496100_0242307 3300048903 Bacteria 1331
454 Ga0496101_0000155 3300048904 Bacteria 58347
455 Ga0496101_0002507 3300048904 Bacteria 11283
456 Ga0496101_0150704 3300048904 Bacteria 1779
457 Ga0496101_0367669 3300048904 Bacteria 1131
458 Ga0496101_0982762 3300048904 Bacteria 664
459 Ga0496102_0006522 3300048905 Bacteria 9955
460 Ga0496102_0036472 3300048905 Bacteria 4430
461 Ga0496102_0039071 3300048905 Bacteria 4286
462 Ga0496102_0149464 3300048905 Bacteria 2194
463 Ga0496102_0423803 3300048905 Bacteria 1250
464 Ga0496102_0697074 3300048905 Bacteria 938
465 Ga0496102_0871236 3300048905 Bacteria 822
466 Ga0496103_0002754 3300048906 Bacteria 10958
467 Ga0496103_0153849 3300048906 Bacteria 1473
468 Ga0496103_0160432 3300048906 Bacteria 1442
469 Ga0496103_0199891 3300048906 Bacteria 1285
470 Ga0496104_0010542 3300048907 Bacteria 8253
471 Ga0496104_0011509 3300048907 Bacteria 7928
472 Ga0496104_0346241 3300048907 Bacteria 1399
473 Ga0496105_0002962 3300048908 Bacteria 12463
474 Ga0496105_0130137 3300048908 Bacteria 2075
475 Ga0496105_0187385 3300048908 Bacteria 1693
476 Ga0496106_0003043 3300048909 Bacteria 12492
477 Ga0496106_0007625 3300048909 Bacteria 8004
478 Ga0496106_0012327 3300048909 Bacteria 6309
479 Ga0496106_0064292 3300048909 Bacteria 2791
480 Ga0496106_0273803 3300048909 Bacteria 1352
481 Ga0496106_0457057 3300048909 Bacteria 1026
482 Ga0496107_0001655 3300048910 Bacteria 13925
483 Ga0496107_0008525 3300048910 Bacteria 7096
484 Ga0496107_0331743 3300048910 Bacteria 1132
485 Ga0496107_0440062 3300048910 Bacteria 969
486 Ga0496107_0695902 3300048910 Bacteria 748
487 Ga0496107_0929184 3300048910 Bacteria 633
488 Ga0496108_0005182 3300048911 Bacteria 10530
489 Ga0496108_0149116 3300048911 Bacteria 2018
490 Ga0496108_0389644 3300048911 Bacteria 1217
491 Ga0496109_0012186 3300048912 Bacteria 7418
492 Ga0496109_0013047 3300048912 Bacteria 7187
493 Ga0496109_0959454 3300048912 Bacteria 793
494 Ga0496110_0116670 3300048913 Bacteria 2403
495 Ga0496110_1365007 3300048913 Bacteria 618
496 Ga0496111_0987375 3300048914 Bacteria 604
497 Ga0496112_0004227 3300048915 Bacteria 12117
498 Ga0496112_0016825 3300048915 Bacteria 6861
499 Ga0496112_0076272 3300048915 Bacteria 3316
500 Ga0496112_0192477 3300048915 Bacteria 2001
501 Ga0496112_0240547 3300048915 Bacteria 1763
502 Ga0496112_0789278 3300048915 Bacteria 875
503 Ga0496113_0022340 3300048916 Bacteria 4473
504 Ga0496113_0147876 3300048916 Bacteria 1852
505 Ga0496113_0554569 3300048916 Bacteria 922
506 Ga0496113_0699506 3300048916 Bacteria 809
507 Ga0496114_0002622 3300048917 Bacteria 13723
508 Ga0496114_0012397 3300048917 Bacteria 6823
509 Ga0496115_0003099 3300048918 Bacteria 11941
510 Ga0496115_0007064 3300048918 Bacteria 8248
511 Ga0496115_0075230 3300048918 Bacteria 2743
512 Ga0496117_0094235 3300048920 Bacteria 1917
513 Ga0496118_0000160 3300048921 Bacteria 120349
514 Ga0496119_0051322 3300048922 Bacteria 2535
515 Ga0496126_1250463 3300048929 Bacteria 543
516 Ga0501032_0119580 3300049569 Bacteria 1742
517 Ga0501032_0885027 3300049569 Bacteria 562
518 Ga0501033_0394893 3300049570 Bacteria 965
519 Ga0501034_0001780 3300049571 Bacteria 27513
520 Ga0501034_0228502 3300049571 Bacteria 1810
521 Ga0501034_0255271 3300049571 Bacteria 1697
522 Ga0501034_0530448 3300049571 Bacteria 1088
523 Ga0501036_0005484 3300049572 Bacteria 10288
524 Ga0501036_0617813 3300049572 Bacteria 898
525 Ga0501037_0000622 3300049573 Bacteria 27471
526 Ga0501037_0375090 3300049573 Bacteria 978
527 Ga0501038_0016039 3300049574 Bacteria 6803
528 Ga0501039_0000535 3300049575 Bacteria 27539
529 Ga0501039_0753015 3300049575 Bacteria 761
530 Ga0501043_0000232 3300049579 Bacteria 50365
531 Ga0501046_0580056 3300049580 Bacteria 797
532 Ga0501047_0038508 3300049581 Bacteria 4626
533 Ga0501068_0128966 3300049584 Bacteria 1581
534 Ga0501069_0021599 3300049585 Bacteria 3496
535 Ga0501070_0000143 3300049586 Bacteria 65562
536 Ga0501070_0018231 3300049586 Bacteria 5888
537 Ga0501070_0082930 3300049586 Bacteria 2654
538 Ga0501070_0815674 3300049586 Bacteria 732
539 Ga0501073_0023104 3300049589 Bacteria 4470
540 Ga0501073_0168138 3300049589 Bacteria 1518
541 Ga0501077_0554869 3300049593 Bacteria 737
542 Ga0501080_0064593 3300049742 Bacteria 3404
543 Ga0501035_0000218 3300049822 Bacteria 68475
544 Ga0501044_0000639 3300049823 Bacteria 42286
545 Ga0501044_0031267 3300049823 Bacteria 5604
546 Ga0501044_0418660 3300049823 Bacteria 1250
547 nmdc:mga03683_188988_c1 3300050489 Bacteria 942
548 nmdc:mga03683_29558_c1 3300050489 Bacteria 2186
549 nmdc:mga03683_42987_c1 3300050489 Bacteria 1862
550 nmdc:mga03n38_130817_c1 3300050490 Bacteria 1244
551 nmdc:mga03n38_16296_c1 3300050490 Bacteria 2889
552 nmdc:mga03n38_219355_c1 3300050490 Bacteria 992
553 nmdc:mga03n38_31872_c1 3300050490 Bacteria 2228
554 nmdc:mga03n38_32214_c1 3300050490 Bacteria 2219
555 nmdc:mga03n38_35981_c1 3300050490 Bacteria 2126
556 nmdc:mga03n38_363111_c1 3300050490 Bacteria 790
557 nmdc:mga03n38_370150_c1 3300050490 Bacteria 783
558 nmdc:mga03n38_389713_c1 3300050490 Bacteria 765
559 nmdc:mga00v17_26788_c1 3300050491 Bacteria 3362
560 nmdc:mga00v17_2833_c2 3300050491 Bacteria 5846
561 nmdc:mga00v17_408647_c1 3300050491 Bacteria 882
562 nmdc:mga00v17_42047_c1 3300050491 Bacteria 2747
563 nmdc:mga00v17_6159_c1 3300050491 Bacteria 6358
564 nmdc:mga00v17_683309_c1 3300050491 Bacteria 659
565 nmdc:mga00v17_92454_c1 3300050491 Bacteria 1902
566 nmdc:mga00v17_9722_c1 3300050491 Bacteria 5219
567 nmdc:mga00v17_99664_c1 3300050491 Bacteria 1833
568 nmdc:mga0yw44_1109872_c1 3300050492 Bacteria 534
569 nmdc:mga0yw44_123710_c1 3300050492 Bacteria 1668
570 nmdc:mga0yw44_16499_c1 3300050492 Bacteria 3990
571 nmdc:mga0yw44_351597_c1 3300050492 Bacteria 992
572 nmdc:mga0yw44_508450_c1 3300050492 Bacteria 817
573 nmdc:mga0yw44_5441_c1 3300050492 Bacteria 6018
574 nmdc:mga0yw44_630842_c1 3300050492 Bacteria 728
575 nmdc:mga0yw44_968303_c1 3300050492 Bacteria 576
576 nmdc:mga0k408_202748_c1 3300050493 Bacteria 1184
577 nmdc:mga0k408_791604_c1 3300050493 Bacteria 553
578 nmdc:mga06z11_10243_c1 3300050494 Bacteria 3983
579 nmdc:mga06z11_105786_c1 3300050494 Bacteria 1551
580 nmdc:mga06z11_574571_c1 3300050494 Bacteria 685
581 nmdc:mga06z11_63688_c1 3300050494 Bacteria 1930
582 nmdc:mga06z11_652650_c1 3300050494 Bacteria 640
583 nmdc:mga07m45_101819_c1 3300050496 Bacteria 1649
584 nmdc:mga07m45_16996_c1 3300050496 Bacteria 3901
585 nmdc:mga07m45_24163_c1 3300050496 Bacteria 3327
586 nmdc:mga07m45_29068_c1 3300050496 Bacteria 3054
587 nmdc:mga07m45_398098_c1 3300050496 Bacteria 799
588 nmdc:mga07m45_94864_c1 3300050496 Bacteria 1711
589 nmdc:mga06r32_93167_c1 3300050510 Bacteria 2946
590 nmdc:mga08y16_527988_c1 3300050511 Bacteria 1196
591 nmdc:mga0sz30_10822_c1 3300050516 Bacteria 3505
592 nmdc:mga0sz30_184485_c1 3300050516 Bacteria 926
593 nmdc:mga0sz30_25865_c1 3300050516 Bacteria 2402
594 nmdc:mga0sz30_3347_c1 3300050516 Bacteria 1125
595 nmdc:mga0sz30_35420_c1 3300050516 Bacteria 782
596 nmdc:mga0sz30_41213_c1 3300050516 Bacteria 1941
597 nmdc:mga0sz30_78730_c1 3300050516 Bacteria 1425
598 nmdc:mga0sz30_9137_c2 3300050516 Bacteria 2410
599 nmdc:mga0sz30_97734_c1 3300050516 Bacteria 1281
600 Ga0500635_0240173 3300053080 Bacteria 709
601 Ga0500643_006078 3300053087 Bacteria 5103
602 Ga0500643_010166 3300053087 Bacteria 3529
603 Ga0500581_131629 3300053089 Bacteria 1196
604 Ga0500583_0223280 3300053092 Bacteria 934
605 Ga0500641_0048801 3300053096 Bacteria 1735
606 Ga0500652_000569 3300053131 Bacteria 12910
607 Ga0500652_252153 3300053131 Bacteria 698
608 Ga0500658_0077018 3300053134 Bacteria 1419
609 Ga0500588_0012243 3300053146 Bacteria 2123
610 Ga0500627_0002462 3300053158 Bacteria 5494
611 Ga0500645_000020 3300053730 Bacteria 134162
612 Ga0500645_013817 3300053730 Bacteria 2585
613 Ga0466962_0003654 3300061719 Bacteria 7335
614 Ga0466962_0109095 3300061719 Bacteria 1332
615 Ga0466962_0389277 3300061719 Bacteria 697
616 2644491385 2643221687 Bacteria 6500351
617 2738703560 2738541274 Bacteria 6909446
618 2739328979 2738543028 Bacteria 6917070
619 2842136532 2842134933 Bacteria 5847019
620 2902795699 2902792274 Bacteria 7270173
621 2902800906 2902799365 Bacteria 5419524
622 2902842558 2902837492 Bacteria 6697721
623 Ga0500604_0079076
624 LJNas_1009105
625 JGI24746J21847_1005157
626 JGI24750J21931_1046308
627 JGI24744J21845_10008713
628 JGI24742J22300_10003180
629 rootH2_10270332
630 Ga0055540_1001998
631 Ga0055540_1003798
632 Ga0070676_10025306
633 Ga0070683_100844380
634 Ga0070690_100066642
635 Ga0070690_100808971
636 Ga0070670_100101299
637 Ga0068869_100025221
638 Ga0068869_100031218
639 Ga0070666_10215865
640 Ga0070682_100115617
641 Ga0070682_100133346
642 Ga0070682_100305754
643 Ga0070682_101089981
644 Ga0070682_101887669
645 Ga0068868_100006841
646 Ga0070689_100032780
647 Ga0070689_100382233
648 Ga0070691_10009126
649 Ga0070661_100876176
650 Ga0070692_10032070
651 Ga0070668_100000668
652 Ga0070675_100644047
653 Ga0070671_100004655
654 Ga0070671_100100725
655 Ga0070671_100630110
656 Ga0070674_100000670
657 Ga0070674_100483112
658 Ga0070674_100636034
659 Ga0070673_100170531
660 Ga0070688_100247107
661 Ga0070659_100101927
662 Ga0070659_100324355
663 Ga0070659_100502226
664 Ga0070659_101384686
665 Ga0070667_100038153
666 Ga0070667_100758177
667 Ga0070667_100875672
668 Ga0070703_10018256
669 Ga0070709_10041815
670 Ga0070714_100011070
671 Ga0070714_100364249
672 Ga0070713_100008148
673 Ga0070713_100157718
674 Ga0070710_10004825
675 Ga0070710_10019420
676 Ga0070710_10564310
677 Ga0070701_10087661
678 Ga0070711_100000314
679 Ga0070711_100017624
680 Ga0070705_100028759
681 Ga0070705_100383668
682 Ga0070705_100667487
683 Ga0070700_100001750
684 Ga0070700_100315425
685 Ga0070700_100536372
686 Ga0070700_101272530
687 Ga0070663_100064928
688 Ga0070663_100650282
689 Ga0070663_101549789
690 Ga0070678_100000573
691 Ga0070678_100050012
692 Ga0070662_100020856
693 Ga0070662_100164320
694 Ga0070662_100634807
695 Ga0068867_100000498
696 Ga0068867_100028621
697 Ga0070685_10237050
698 Ga0070685_10446737
699 Ga0070685_10767844
700 Ga0070679_100476783
701 Ga0070684_101313165
702 Ga0068853_100002702
703 Ga0068853_100582016
704 Ga0068853_100936796
705 Ga0070672_100248812
706 Ga0070672_100415424
707 Ga0070686_100123768
708 Ga0070695_100000790
709 Ga0070693_100052951
710 Ga0070693_100082566
711 Ga0070693_100475005
712 Ga0070665_100003208
713 Ga0070665_100073216
714 Ga0070665_101366610
715 Ga0070704_100002466
716 Ga0070704_100319966
717 Ga0068855_100642118
718 Ga0070664_100295145
719 Ga0068857_100513870
720 Ga0068854_100000891
721 Ga0068854_100815782
722 Ga0068856_100069711
723 Ga0070702_100000125
724 Ga0070702_100077403
725 Ga0070702_100316797
726 Ga0068852_100332127
727 Ga0068852_100402675
728 Ga0068852_100736056
729 Ga0068859_100008459
730 Ga0068859_100029745
731 Ga0068864_100191598
732 Ga0068864_101606836
733 Ga0068861_100004013
734 Ga0068861_101349880
735 Ga0068851_10109830
736 Ga0068863_100002843
737 Ga0068863_101007469
738 Ga0068863_101308300
739 Ga0068858_100004199
740 Ga0068858_100122950
741 Ga0068858_101034545
742 Ga0068860_100001829
743 Ga0068860_100323240
744 Ga0068862_100001560
745 Ga0068862_100175598
746 Ga0068862_101099150
747 Ga0068862_102715841
748 Ga0081455_10000782
749 Ga0081455_10092186
750 Ga0081455_10285251
751 Ga0081455_10457741
752 Ga0070717_10133129
753 Ga0075365_10013421
754 Ga0075365_10029454
755 Ga0075365_10071492
756 Ga0075365_10107493
757 Ga0075365_10503851
758 Ga0075365_10679994
759 Ga0075363_100005063
760 Ga0075363_100052543
761 Ga0075363_100091304
762 Ga0075363_100099194
763 Ga0075363_100107918
764 Ga0075363_100203480
765 Ga0075363_100386689
766 Ga0075363_100441032
767 Ga0075363_100460117
768 Ga0075363_100514232
769 Ga0075363_100590038
770 Ga0075364_10013803
771 Ga0075364_10028042
772 Ga0075364_10031536
773 Ga0075364_10037456
774 Ga0075364_10043248
775 Ga0075364_10055232
776 Ga0075364_10135452
777 Ga0075364_10149367
778 Ga0075364_10357856
779 Ga0070715_10008190
780 Ga0070715_10310010
781 Ga0070716_100003886
782 Ga0070716_100012845
783 Ga0070712_100004966
784 Ga0070712_100081606
785 Ga0075362_10020823
786 Ga0075362_10041861
787 Ga0075367_10026730
788 Ga0075367_10078284
789 Ga0075367_10130879
790 Ga0075367_10321865
791 Ga0075367_10416666
792 Ga0075369_10005893
793 Ga0075369_10018184
794 Ga0075369_10055752
795 Ga0075369_10110242
796 Ga0075369_10168165
797 Ga0075369_10206178
798 Ga0075369_10341888
799 Ga0075369_10346691
800 Ga0075369_10435604
801 Ga0075366_10935646
802 Ga0097621_100763184
803 Ga0075370_10004013
804 Ga0075370_10069320
805 Ga0075370_10077795
806 Ga0075370_10174297
807 Ga0075370_10284709
808 Ga0075370_10414506
809 Ga0075370_10451563
810 Ga0068871_100124134
811 Ga0068871_100190596
812 Ga0068871_100678769
813 Ga0075428_100039700
814 Ga0075428_101507426
815 Ga0075430_100017061
816 Ga0075431_100186031
817 Ga0068865_100000861
818 Ga0068865_100257255
819 Ga0097620_100008459
820 Ga0097620_100029746
821 Ga0105244_10139803
822 Ga0105240_10231328
823 Ga0111539_10276976
824 Ga0105245_10005820
825 Ga0105245_10157631
826 Ga0105245_10183181
827 Ga0105245_12777168
828 Ga0105247_10005519
829 Ga0105247_10192746
830 Ga0105243_10007672
831 Ga0105243_10300287
832 Ga0105241_10046942
833 Ga0105242_10001151
834 Ga0105248_10014177
835 Ga0105248_10081708
836 Ga0105248_12957152
837 Ga0105237_10264988
838 Ga0105237_10321774
839 Ga0105238_10049395
840 Ga0105238_13024716
841 Ga0105249_10013183
842 Ga0105249_10100746
843 Ga0105147_111674
844 Ga0099796_10021990
845 Ga0105239_10019191
846 Ga0105239_10123145
847 Ga0105246_10071028
848 Ga0157369_10420364
849 Ga0157369_10867240
850 Ga0157374_10046311
851 Ga0157374_10189901
852 Ga0157378_10019709
853 Ga0157378_10191555
854 Ga0163162_10006909
855 Ga0163162_10125942
856 Ga0163162_10194890
857 Ga0157372_10006040
858 Ga0157372_10445550
859 Ga0157372_12171080
860 Ga0157375_10014110
861 Ga0157375_10094534
862 Ga0157375_10208977
863 Ga0157375_11910339
864 Ga0163163_10040397
865 Ga0163163_11141856
866 Ga0163163_11468472
867 Ga0157380_10004610
868 Ga0157380_10370124
869 Ga0157377_10091655
870 Ga0157377_10180876
871 Ga0157377_11109623
872 Ga0157377_11263167
873 Ga0157379_10054029
874 Ga0157379_10439656
875 Ga0157379_10555100
876 Ga0157376_10480813
877 Ga0163161_10003677
878 Ga0163161_10071532
879 Ga0163161_11101857
880 Ga0213875_10542394
881 Ga0209673_1007893
882 Ga0209673_1063466
883 Ga0209051_1000457
884 Ga0209051_1001136
885 Ga0209051_1003245
886 Ga0209051_1011316
887 Ga0207656_10169700
888 Ga0207696_1089576
889 Ga0207653_10011080
890 Ga0207692_10065057
891 Ga0207692_10217714
892 Ga0207642_10002204
893 Ga0207710_10007991
894 Ga0207710_10112171
895 Ga0207688_10001427
896 Ga0207688_10013926
897 Ga0207688_10543246
898 Ga0207647_10044840
899 Ga0207685_10019534
900 Ga0207685_10196061
901 Ga0207699_10016435
902 Ga0207699_10037681
903 Ga0207699_10266172
904 Ga0207645_10201774
905 Ga0207654_10155937
906 Ga0207695_11126946
907 Ga0207671_10203307
908 Ga0207671_10323638
909 Ga0207693_10000698
910 Ga0207693_10004121
911 Ga0207663_10001329
912 Ga0207663_10093458
913 Ga0207649_10518058
914 Ga0207681_10383796
915 Ga0207694_10133188
916 Ga0207687_10004034
917 Ga0207687_10061945
918 Ga0207687_10450159
919 Ga0207687_11535426
920 Ga0207700_10037441
921 Ga0207700_10202376
922 Ga0207700_10651405
923 Ga0207664_10131075
924 Ga0207644_10079177
925 Ga0207644_10290121
926 Ga0207690_10034042
927 Ga0207706_10069770
928 Ga0207706_10124411
929 Ga0207686_10017782
930 Ga0207709_10003375
931 Ga0207709_11138031
932 Ga0207670_10507218
933 Ga0207670_10609520
934 Ga0207669_10006430
935 Ga0207669_10326134
936 Ga0207704_10000279
937 Ga0207665_10019560
938 Ga0207665_10032619
939 Ga0207691_10042301
940 Ga0207691_10168455
941 Ga0207711_10037883
942 Ga0207711_10056465
943 Ga0207711_11604183
944 Ga0207661_10114805
945 Ga0207667_10613153
946 Ga0207651_10147683
947 Ga0207651_11288678
948 Ga0207712_10003208
949 Ga0207712_10207332
950 Ga0207668_10000917
951 Ga0207640_10033813
952 Ga0207640_10056470
953 Ga0207640_10664396
954 Ga0207658_10028503
955 Ga0207658_10068765
956 Ga0207658_10650448
957 Ga0207677_10017261
958 Ga0207677_10736742
959 Ga0207703_10049501
960 Ga0207703_10281280
961 Ga0207703_10714284
962 Ga0207703_10904475
963 Ga0207639_10017157
964 Ga0207639_10139242
965 Ga0207639_10585583
966 Ga0207678_10022201
967 Ga0207678_10044436
968 Ga0207678_10230590
969 Ga0207678_10332301
970 Ga0207678_10350624
971 Ga0207678_10707553
972 Ga0207708_10003268
973 Ga0207708_10080582
974 Ga0207708_11129985
975 Ga0207708_11156308
976 Ga0207702_10158683
977 Ga0207702_10339487
978 Ga0207641_10050027
979 Ga0207641_10262096
980 Ga0207641_10905189
981 Ga0207648_10006557
982 Ga0207676_10441119
983 Ga0207675_100001052
984 Ga0207675_101382889
985 Ga0207683_10001365
986 Ga0207683_10053782
987 Ga0207698_10178996
988 Ga0207698_10250318
989 Ga0207428_10166983
990 Ga0268266_10002931
991 Ga0268266_10518895
992 Ga0268266_11385197
993 Ga0268265_10146212
994 Ga0268265_10646736
995 Ga0268264_10006370
996 Ga0307406_10220748
997 Ga0307409_100612584
998 Ga0307409_100779607
999 Ga0307409_101457772
1000 Ga0307416_101967584
1001 Ga0307411_10670718
1002 Ga0307415_100126532
1003 Ga0307415_100777197
1004 Ga0373929_0051351
1005 Ga0373951_0010229
1006 Ga0373932_0349187
1007 Ga0373942_0073799
1008 Ga0373931_0075260
1009 Ga0373931_0181876
1010 Ga0436364_0515775
1011 Ga0436363_0392846
1012 Ga0439466_0081904
1013 Ga0439466_0103747
1014 Ga0439465_0009928
1015 Ga0439465_0029544
1016 Ga0439465_0056535
1017 Ga0439465_0099385
1018 Ga0451789_0510679
1019 Ga0451793_1315040
1020 Ga0451795_1559105
1021 Ga0451800_0898859
1022 Ga0451800_1546053
1023 Ga0451807_1175032
1024 Ga0451837_0948585
1025 Ga0451839_0105349
1026 Ga0451849_0980699
1027 Ga0451851_0227724
1028 Ga0451853_2862731
1029 Ga0439445_0012957
1030 Ga0439445_0108757
1031 Ga0439435_0047629
1032 Ga0439460_0082887
1033 Ga0466969_0033782
1034 Ga0466972_0405015
1035 Ga0466965_0005457
1036 Ga0466965_0242460
1037 Ga0466966_0041831
1038 Ga0466966_0045653
1039 Ga0466961_0055388
1040 Ga0466961_0073378
1041 Ga0466963_0069880
1042 Ga0466963_0795939
1043 Ga0466964_0091031
1044 Ga0466971_0029425
1045 Ga0466971_0377910
1046 Ga0466968_0008335
1047 Ga0466968_0062270
1048 Ga0466968_0067993
1049 Ga0466970_0024024
1050 Ga0466970_0040986
1051 Ga0466970_0421443
1052 Ga0466957_0003928
1053 Ga0466957_0051845
1054 Ga0466957_0514218
1055 Ga0466960_0091659
1056 Ga0466959_0070895
1057 Ga0466959_0245603
1058 Ga0466958_0000490
1059 Ga0466958_0035562
1060 Ga0466958_0364805
1061 Ga0466967_0146582
1062 Ga0466967_0314298
1063 Ga0495638_0028877
1064 Ga0495606_0485280
1065 Ga0495648_0007578
1066 Ga0495597_0219769
1067 Ga0495672_0152443
1068 Ga0495672_0201845
1069 Ga0495673_0000867
1070 Ga0495686_0003063
1071 Ga0496100_0000369
1072 Ga0496100_0004153
1073 Ga0496100_0122662
1074 Ga0496100_0147585
1075 Ga0496100_0242307
1076 Ga0496101_0000155
1077 Ga0496101_0002507
1078 Ga0496101_0150704
1079 Ga0496101_0367669
1080 Ga0496101_0982762
1081 Ga0496102_0006522
1082 Ga0496102_0036472
1083 Ga0496102_0039071
1084 Ga0496102_0149464
1085 Ga0496102_0423803
1086 Ga0496102_0697074
1087 Ga0496102_0871236
1088 Ga0496103_0002754
1089 Ga0496103_0153849
1090 Ga0496103_0160432
1091 Ga0496103_0199891
1092 Ga0496104_0010542
1093 Ga0496104_0011509
1094 Ga0496104_0346241
1095 Ga0496105_0002962
1096 Ga0496105_0130137
1097 Ga0496105_0187385
1098 Ga0496106_0003043
1099 Ga0496106_0007625
1100 Ga0496106_0012327
1101 Ga0496106_0064292
1102 Ga0496106_0273803
1103 Ga0496106_0457057
1104 Ga0496107_0001655
1105 Ga0496107_0008525
1106 Ga0496107_0331743
1107 Ga0496107_0440062
1108 Ga0496107_0695902
1109 Ga0496107_0929184
1110 Ga0496108_0005182
1111 Ga0496108_0149116
1112 Ga0496108_0389644
1113 Ga0496109_0012186
1114 Ga0496109_0013047
1115 Ga0496109_0959454
1116 Ga0496110_0116670
1117 Ga0496110_1365007
1118 Ga0496111_0987375
1119 Ga0496112_0004227
1120 Ga0496112_0016825
1121 Ga0496112_0076272
1122 Ga0496112_0192477
1123 Ga0496112_0240547
1124 Ga0496112_0789278
1125 Ga0496113_0022340
1126 Ga0496113_0147876
1127 Ga0496113_0554569
1128 Ga0496113_0699506
1129 Ga0496114_0002622
1130 Ga0496114_0012397
1131 Ga0496115_0003099
1132 Ga0496115_0007064
1133 Ga0496115_0075230
1134 Ga0496117_0094235
1135 Ga0496118_0000160
1136 Ga0496119_0051322
1137 Ga0496126_1250463
1138 Ga0501032_0119580
1139 Ga0501032_0885027
1140 Ga0501033_0394893
1141 Ga0501034_0001780
1142 Ga0501034_0228502
1143 Ga0501034_0255271
1144 Ga0501034_0530448
1145 Ga0501036_0005484
1146 Ga0501036_0617813
1147 Ga0501037_0000622
1148 Ga0501037_0375090
1149 Ga0501038_0016039
1150 Ga0501039_0000535
1151 Ga0501039_0753015
1152 Ga0501043_0000232
1153 Ga0501046_0580056
1154 Ga0501047_0038508
1155 Ga0501068_0128966
1156 Ga0501069_0021599
1157 Ga0501070_0000143
1158 Ga0501070_0018231
1159 Ga0501070_0082930
1160 Ga0501070_0815674
1161 Ga0501073_0023104
1162 Ga0501073_0168138
1163 Ga0501077_0554869
1164 Ga0501080_0064593
1165 Ga0501035_0000218
1166 Ga0501044_0000639
1167 Ga0501044_0031267
1168 Ga0501044_0418660
1169 nmdc:mga03683_188988_c1
1170 nmdc:mga03683_29558_c1
1171 nmdc:mga03683_42987_c1
1172 nmdc:mga03n38_130817_c1
1173 nmdc:mga03n38_16296_c1
1174 nmdc:mga03n38_219355_c1
1175 nmdc:mga03n38_31872_c1
1176 nmdc:mga03n38_32214_c1
1177 nmdc:mga03n38_35981_c1
1178 nmdc:mga03n38_363111_c1
1179 nmdc:mga03n38_370150_c1
1180 nmdc:mga03n38_389713_c1
1181 nmdc:mga00v17_26788_c1
1182 nmdc:mga00v17_2833_c2
1183 nmdc:mga00v17_408647_c1
1184 nmdc:mga00v17_42047_c1
1185 nmdc:mga00v17_6159_c1
1186 nmdc:mga00v17_683309_c1
1187 nmdc:mga00v17_92454_c1
1188 nmdc:mga00v17_9722_c1
1189 nmdc:mga00v17_99664_c1
1190 nmdc:mga0yw44_1109872_c1
1191 nmdc:mga0yw44_123710_c1
1192 nmdc:mga0yw44_16499_c1
1193 nmdc:mga0yw44_351597_c1
1194 nmdc:mga0yw44_508450_c1
1195 nmdc:mga0yw44_5441_c1
1196 nmdc:mga0yw44_630842_c1
1197 nmdc:mga0yw44_968303_c1
1198 nmdc:mga0k408_202748_c1
1199 nmdc:mga0k408_791604_c1
1200 nmdc:mga06z11_10243_c1
1201 nmdc:mga06z11_105786_c1
1202 nmdc:mga06z11_574571_c1
1203 nmdc:mga06z11_63688_c1
1204 nmdc:mga06z11_652650_c1
1205 nmdc:mga07m45_101819_c1
1206 nmdc:mga07m45_16996_c1
1207 nmdc:mga07m45_24163_c1
1208 nmdc:mga07m45_29068_c1
1209 nmdc:mga07m45_398098_c1
1210 nmdc:mga07m45_94864_c1
1211 nmdc:mga06r32_93167_c1
1212 nmdc:mga08y16_527988_c1
1213 nmdc:mga0sz30_10822_c1
1214 nmdc:mga0sz30_184485_c1
1215 nmdc:mga0sz30_25865_c1
1216 nmdc:mga0sz30_3347_c1
1217 nmdc:mga0sz30_35420_c1
1218 nmdc:mga0sz30_41213_c1
1219 nmdc:mga0sz30_78730_c1
1220 nmdc:mga0sz30_9137_c2
1221 nmdc:mga0sz30_97734_c1
1222 Ga0500635_0240173
1223 Ga0500643_006078
1224 Ga0500643_010166
1225 Ga0500581_131629
1226 Ga0500583_0223280
1227 Ga0500641_0048801
1228 Ga0500652_000569
1229 Ga0500652_252153
1230 Ga0500658_0077018
1231 Ga0500588_0012243
1232 Ga0500627_0002462
1233 Ga0500645_000020
1234 Ga0500645_013817
1235 Ga0466962_0003654
1236 Ga0466962_0109095
1237 Ga0466962_0389277
1238 2644491385
1239 2738703560
1240 2739328979
1241 2842136532
1242 2902795699
1243 2902800906
1244 2902842558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tpj-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.8357 3 118
3ecf-assembly2.cif.gz_C crystal structure of an ntf2-like protein (ava_4193) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8176 11 123
3f14-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_680363.1) from cytophaga hutchinsonii atcc 33406 at 1.45 a resolution 0.8009 5 118
3t8u-assembly1.cif.gz_A crystal structure of ketosteroid isomerase y14ay55fd99a from pseudomonas testosteroni 0.7999 4 117
8cho-assembly1.cif.gz_A-2 crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni 0.7978 4 124
ID Description Score Start End Superfamily
3ecfD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.815 4 116 3.10.450.50
3f14A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8106 4 118 3.10.450.50
3f14A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7976 4 118 3.10.450.50
2k54A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7969 4 121 3.10.450.50
2bngA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7834 6 117 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A4R2VG02-F1-model_v4 deleted 0.999 3 124
AF-A0A378REU5-F1-model_v4 deleted 0.9979 1 124
AF-A0A5C1RB22-F1-model_v4 deleted 0.9969 2 124
AF-A0A6H0S8Q1-F1-model_v4 Site-specific recombinase XerC 0.9948 1 124
AF-A0A1A0VZR6-F1-model_v4 Site-specific recombinase XerC 0.9943 1 124

Map