metagRoot

F470125

General Info

Members	Datasets	Scaffolds	Average Seq Length
622	235	619	293

Family's Representative Sequence

Representative Sequence	3300044658\|Ga0466972_0000047\|Ga0466972_0000047_70592_71617
Length	341
Sequence	VPDPTAGQKDVSACKCFIYIALPNHPFVWFKPSLGSFKQFDNALCSLLYMNAFTIKDLENLSGIKAHTIRIWEQRYSFLRPQRTTTNIRYYTNEELKIVLNIALLNKYGYKISHIDKMSAEEVREKIVTLSHAEAQQERLVNDLLQYMIDLDLEKFEDLLDNYIQAKGIDKVISFLIFPFLDKIGILWQASHIHPAQEHVVTNIIRQKLIVGIECVVSHITVNKKVILFLPEGEYHELGLLYTYYLLKSRGVQVIYLGANVPFHDLEFITSYKQPDYLYTHLTCIAGNFNFEKFLTKIHQHAPKVQIIVSGLLTNCNMKKLPAGVLLKRSLSEVLEFIAAL

Samples

	Sample ID	Description	Type	Environment
1	2738541278	Niastella sp. CF465	Isolate	Unclassified
2	2833640130	Mariniflexile sp. TRM1-10	Isolate	Rhizosphere
3	2929154850	Filimonas sp. R-72421 Hybrid assembly	Isolate	Unclassified
4	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
5	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
6	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
7	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
8	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
9	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
10	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
11	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
12	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
13	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
14	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
15	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
16	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
17	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
18	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
19	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
20	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
21	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
22	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
23	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
24	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
25	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
26	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
27	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
28	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
29	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
30	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
31	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
32	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
33	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
34	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
35	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
36	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
37	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
38	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
39	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
40	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
41	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
42	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
43	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
44	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
45	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
46	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
47	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
48	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
49	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
50	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
51	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
52	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
53	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
54	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
55	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
56	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
57	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
58	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
59	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
60	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
61	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
62	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
63	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
64	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
65	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
66	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
67	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
69	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
71	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
72	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
73	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
74	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
75	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
76	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
77	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
78	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
79	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
80	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
81	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
82	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
83	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
84	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
85	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
86	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
87	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
88	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
89	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
90	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
91	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
92	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
93	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
94	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
95	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
96	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
97	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
148	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
152	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
153	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
154	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
155	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
156	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
157	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
158	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
159	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
160	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
161	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
162	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
163	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
164	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
165	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
166	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
167	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
168	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
169	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
170	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
171	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
172	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
173	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
174	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
175	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
176	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
177	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
178	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
179	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
180	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
181	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
182	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
183	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
184	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
185	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
186	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
187	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
188	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
189	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
190	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
191	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
192	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
193	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
194	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
195	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
196	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
197	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
198	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
199	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
200	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
202	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
203	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
204	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
205	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
206	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
207	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
211	3300049703	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control	Metagenome	Rhizosphere
212	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
213	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
214	3300049771	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control	Metagenome	Rhizosphere
215	3300050005	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought	Metagenome	Rhizosphere
216	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
217	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
218	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
219	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
220	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
221	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
222	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
223	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
224	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
225	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
226	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
227	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
228	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
229	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
230	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
231	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
232	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
233	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
234	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
235	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.52
Metatranscriptomes	0
Isolates	0.48

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	6.11
Nodule	0
Rhizoplane	0.8
Rhizosphere	86.98
Stem	0
Stem Tuber	0
Unclassified	6.11

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	rootH2_10010709	3300003320	Bacteria	8116
2	rootH2_10013030	3300003320	Bacteria	7264
3	rootL2_10029799	3300003322	Bacteria	5218
4	rootL2_10059993	3300003322	Bacteria	2755
5	rootL2_10068385	3300003322	Bacteria	5147
6	rootL2_10080435	3300003322	Bacteria	1623
7	rootL2_10303913	3300003322	Bacteria	1984
8	rootL2_10319575	3300003322	Unclassified	2408
9	rootH1_10021882	3300003323	Bacteria	5598
10	rootH1_10044956	3300003323	Bacteria	2246
11	rootH1_10205358	3300003323	Bacteria	3597
12	rootH1_10324603	3300003323	Bacteria	1335
13	Ga0065712_10082662	3300005290	Bacteria	2896
14	Ga0070658_10056607	3300005327	Bacteria	3188
15	Ga0070658_10155473	3300005327	Bacteria	1917
16	Ga0070658_10299328	3300005327	Unclassified	1371
17	Ga0070676_10100128	3300005328	Bacteria	1789
18	Ga0070683_100017900	3300005329	Bacteria	6264
19	Ga0070683_100023597	3300005329	Bacteria	5503
20	Ga0070690_100238979	3300005330	Bacteria	1280
21	Ga0070670_100004105	3300005331	Bacteria	12167
22	Ga0070670_100128773	3300005331	Bacteria	2185
23	Ga0070670_100139901	3300005331	Bacteria	2093
24	Ga0070670_100393065	3300005331	Unclassified	1223
25	Ga0070677_10014997	3300005333	Bacteria	2739
26	Ga0070677_10083052	3300005333	Bacteria	1375
27	Ga0068869_100005652	3300005334	Bacteria	7881
28	Ga0068869_100043566	3300005334	Bacteria	3224
29	Ga0068869_100068795	3300005334	Bacteria	2616
30	Ga0068869_100378054	3300005334	Bacteria	1160
31	Ga0070666_10000050	3300005335	Bacteria	100280
32	Ga0070666_10100196	3300005335	Bacteria	1995
33	Ga0070666_10105517	3300005335	Bacteria	1946
34	Ga0070682_100000019	3300005337	Bacteria	220844
35	Ga0070682_100003137	3300005337	Bacteria	9155
36	Ga0070682_100004566	3300005337	Bacteria	7699
37	Ga0070682_100092991	3300005337	Bacteria	1977
38	Ga0068868_100001389	3300005338	Bacteria	16714
39	Ga0068868_100059240	3300005338	Bacteria	3028
40	Ga0068868_100068576	3300005338	Unclassified	2825
41	Ga0068868_100129980	3300005338	Bacteria	2060
42	Ga0068868_100146432	3300005338	Unclassified	1942
43	Ga0068868_100208769	3300005338	Bacteria	1631
44	Ga0068868_100242709	3300005338	Bacteria	1514
45	Ga0070660_100017246	3300005339	Bacteria	5261
46	Ga0070660_100030338	3300005339	Bacteria	4056
47	Ga0070689_100010348	3300005340	Bacteria	6650
48	Ga0070689_100010789	3300005340	Bacteria	6528
49	Ga0070689_100110054	3300005340	Bacteria	2190
50	Ga0070687_100106481	3300005343	Bacteria	1579
51	Ga0070661_100020346	3300005344	Bacteria	4731
52	Ga0070661_100042758	3300005344	Unclassified	3308
53	Ga0070668_100057655	3300005347	Bacteria	3002
54	Ga0070669_100007084	3300005353	Bacteria	8054
55	Ga0070669_100174352	3300005353	Unclassified	1679
56	Ga0070669_100194297	3300005353	Bacteria	1593
57	Ga0070675_100009761	3300005354	Bacteria	7476
58	Ga0070675_100224977	3300005354	Bacteria	1635
59	Ga0070675_100336294	3300005354	Unclassified	1337
60	Ga0070671_100015427	3300005355	Bacteria	6172
61	Ga0070671_100038053	3300005355	Bacteria	3993
62	Ga0070671_100072533	3300005355	Bacteria	2876
63	Ga0070671_100121636	3300005355	Bacteria	2197
64	Ga0070671_100237046	3300005355	Bacteria	1549
65	Ga0070671_100478108	3300005355	Bacteria	1070
66	Ga0070673_100019908	3300005364	Bacteria	4828
67	Ga0070673_100102840	3300005364	Bacteria	2356
68	Ga0070673_100133465	3300005364	Bacteria	2087
69	Ga0070673_100158562	3300005364	Unclassified	1922
70	Ga0070673_100219778	3300005364	Bacteria	1644
71	Ga0070673_100220105	3300005364	Unclassified	1643
72	Ga0070673_100295044	3300005364	Bacteria	1426
73	Ga0070673_100318351	3300005364	Bacteria	1374
74	Ga0070688_100000950	3300005365	Bacteria	14486
75	Ga0070688_100031501	3300005365	Bacteria	3191
76	Ga0070659_100006321	3300005366	Bacteria	8555
77	Ga0070659_100025107	3300005366	Bacteria	4575
78	Ga0070667_100004077	3300005367	Bacteria	12356
79	Ga0070667_100019648	3300005367	Bacteria	5604
80	Ga0070667_100082420	3300005367	Bacteria	2754
81	Ga0070667_100322842	3300005367	Unclassified	1393
82	Ga0070678_100034684	3300005456	Bacteria	3516
83	Ga0070678_100344057	3300005456	Bacteria	1280
84	Ga0070662_100011043	3300005457	Bacteria	5947
85	Ga0070681_10035416	3300005458	Bacteria	5014
86	Ga0070681_10208490	3300005458	Bacteria	1871
87	Ga0070681_10254868	3300005458	Bacteria	1667
88	Ga0070681_10351764	3300005458	Bacteria	1384
89	Ga0068867_100037914	3300005459	Bacteria	3506
90	Ga0068867_100054642	3300005459	Unclassified	2950
91	Ga0068867_100093598	3300005459	Bacteria	2284
92	Ga0070685_10001967	3300005466	Bacteria	10670
93	Ga0070685_10043939	3300005466	Bacteria	2556
94	Ga0070685_10098102	3300005466	Bacteria	1785
95	Ga0070699_100463655	3300005518	Bacteria	1149
96	Ga0070679_100107690	3300005530	Unclassified	2773
97	Ga0070684_100083885	3300005535	Bacteria	2824
98	Ga0070684_100238627	3300005535	Bacteria	1660
99	Ga0068853_100000422	3300005539	Bacteria	28780
100	Ga0068853_100027614	3300005539	Bacteria	4768
101	Ga0068853_100038249	3300005539	Bacteria	4086
102	Ga0068853_100051185	3300005539	Bacteria	3555
103	Ga0068853_100138689	3300005539	Bacteria	2182
104	Ga0068853_100180425	3300005539	Bacteria	1915
105	Ga0068853_100193368	3300005539	Bacteria	1849
106	Ga0070672_100224483	3300005543	Bacteria	1576
107	Ga0070672_100242845	3300005543	Bacteria	1515
108	Ga0070686_100031154	3300005544	Bacteria	3258
109	Ga0070686_100074732	3300005544	Bacteria	2228
110	Ga0070686_100116717	3300005544	Bacteria	1827
111	Ga0070693_100088450	3300005547	Bacteria	1862
112	Ga0068855_100000284	3300005563	Bacteria	62592
113	Ga0068855_100014854	3300005563	Bacteria	9377
114	Ga0068855_100047133	3300005563	Bacteria	5093
115	Ga0068855_100049387	3300005563	Bacteria	4962
116	Ga0068855_100098246	3300005563	Unclassified	3373
117	Ga0070664_100177992	3300005564	Bacteria	1889
118	Ga0070664_100334372	3300005564	Bacteria	1375
119	Ga0068857_100039979	3300005577	Bacteria	4158
120	Ga0068857_100058363	3300005577	Bacteria	3427
121	Ga0068857_100077626	3300005577	Bacteria	2964
122	Ga0068857_100194031	3300005577	Bacteria	1850
123	Ga0068854_100093898	3300005578	Bacteria	2237
124	Ga0068854_100148615	3300005578	Bacteria	1804
125	Ga0068854_100202870	3300005578	Bacteria	1560
126	Ga0068856_100004457	3300005614	Bacteria	13946
127	Ga0068856_100021107	3300005614	Bacteria	6329
128	Ga0068856_100266857	3300005614	Bacteria	1728
129	Ga0070702_100027268	3300005615	Bacteria	3080
130	Ga0068852_100001058	3300005616	Bacteria	18146
131	Ga0068852_100001594	3300005616	Bacteria	15433
132	Ga0068852_100004569	3300005616	Bacteria	9798
133	Ga0068852_100005952	3300005616	Bacteria	8777
134	Ga0068852_100052562	3300005616	Bacteria	3502
135	Ga0068852_100248355	3300005616	Bacteria	1704
136	Ga0068852_100405273	3300005616	Bacteria	1342
137	Ga0068852_100477267	3300005616	Bacteria	1239
138	Ga0068859_100000025	3300005617	Bacteria	191679
139	Ga0068859_100000333	3300005617	Bacteria	47025
140	Ga0068859_100037181	3300005617	Bacteria	4886
141	Ga0068859_100097716	3300005617	Bacteria	2989
142	Ga0068859_100224661	3300005617	Bacteria	1966
143	Ga0068859_100254376	3300005617	Bacteria	1847
144	Ga0068859_100319723	3300005617	Unclassified	1646
145	Ga0068864_100011190	3300005618	Bacteria	7415
146	Ga0068864_100031001	3300005618	Unclassified	4535
147	Ga0068864_100125010	3300005618	Bacteria	2304
148	Ga0068866_10003836	3300005718	Bacteria	6169
149	Ga0068861_100012159	3300005719	Bacteria	5999
150	Ga0068861_100061051	3300005719	Bacteria	2892
151	Ga0068861_100345614	3300005719	Bacteria	1303
152	Ga0068851_10007997	3300005834	Bacteria	4877
153	Ga0068870_10015498	3300005840	Bacteria	3617
154	Ga0068870_10036736	3300005840	Bacteria	2521
155	Ga0068863_100002841	3300005841	Bacteria	17144
156	Ga0068863_100009555	3300005841	Bacteria	9456
157	Ga0068863_100011473	3300005841	Bacteria	8568
158	Ga0068863_100039654	3300005841	Bacteria	4480
159	Ga0068863_100211538	3300005841	Bacteria	1868
160	Ga0068863_100314161	3300005841	Bacteria	1521
161	Ga0068858_100045256	3300005842	Bacteria	4077
162	Ga0068860_100000061	3300005843	Bacteria	192548
163	Ga0068860_100003010	3300005843	Bacteria	17411
164	Ga0068860_100082322	3300005843	Unclassified	3061
165	Ga0068860_100114924	3300005843	Bacteria	2573
166	Ga0068860_100156586	3300005843	Bacteria	2196
167	Ga0068860_100383726	3300005843	Bacteria	1387
168	Ga0068860_100708844	3300005843	Bacteria	1016
169	Ga0068862_100023190	3300005844	Bacteria	5197
170	Ga0068862_100240092	3300005844	Bacteria	1647
171	Ga0081455_10213299	3300005937	Unclassified	1437
172	Ga0070717_10068394	3300006028	Bacteria	2956
173	Ga0075366_10002847	3300006195	Bacteria	8960
174	Ga0075366_10018639	3300006195	Bacteria	4009
175	Ga0075366_10092347	3300006195	Bacteria	1813
176	Ga0075366_10155400	3300006195	Bacteria	1385
177	Ga0097621_100000465	3300006237	Bacteria	28387
178	Ga0097621_100055128	3300006237	Bacteria	3245
179	Ga0097621_100064176	3300006237	Bacteria	3019
180	Ga0097621_100240554	3300006237	Bacteria	1582
181	Ga0097621_100249915	3300006237	Bacteria	1552
182	Ga0068871_100001644	3300006358	Bacteria	15052
183	Ga0068871_100008210	3300006358	Bacteria	7499
184	Ga0068871_100115398	3300006358	Unclassified	2264
185	Ga0068871_100129479	3300006358	Bacteria	2139
186	Ga0068871_100322387	3300006358	Bacteria	1361
187	Ga0068871_100351653	3300006358	Bacteria	1303
188	Ga0075431_100036428	3300006847	Bacteria	5068
189	Ga0075429_100108673	3300006880	Bacteria	2424
190	Ga0075429_100152863	3300006880	Bacteria	2021
191	Ga0068865_100053551	3300006881	Bacteria	2800
192	Ga0068865_100117296	3300006881	Unclassified	1973
193	Ga0097620_100000025	3300006931	Bacteria	191679
194	Ga0097620_100000333	3300006931	Bacteria	47025
195	Ga0097620_100037181	3300006931	Bacteria	4886
196	Ga0097620_100097715	3300006931	Bacteria	2989
197	Ga0097620_100224664	3300006931	Bacteria	1966
198	Ga0097620_100254382	3300006931	Bacteria	1847
199	Ga0097620_100319708	3300006931	Unclassified	1646
200	Ga0105240_10000198	3300009093	Bacteria	122388
201	Ga0105240_10015994	3300009093	Bacteria	10170
202	Ga0105240_10027122	3300009093	Bacteria	7505
203	Ga0105240_10065857	3300009093	Bacteria	4497
204	Ga0105240_10154049	3300009093	Bacteria	2735
205	Ga0105240_10378572	3300009093	Bacteria	1599
206	Ga0105240_10456035	3300009093	Bacteria	1430
207	Ga0111539_10001644	3300009094	Bacteria	29841
208	Ga0111539_10008682	3300009094	Bacteria	12899
209	Ga0111539_10191689	3300009094	Bacteria	2385
210	Ga0105245_10073893	3300009098	Bacteria	3101
211	Ga0105247_10002225	3300009101	Bacteria	13361
212	Ga0105241_10002300	3300009174	Bacteria	14357
213	Ga0105241_10006585	3300009174	Bacteria	8557
214	Ga0105241_10083775	3300009174	Bacteria	2502
215	Ga0105241_10389270	3300009174	Bacteria	1220
216	Ga0105242_10015996	3300009176	Bacteria	5830
217	Ga0105242_10056033	3300009176	Bacteria	3225
218	Ga0105242_10162689	3300009176	Unclassified	1955
219	Ga0105242_10248656	3300009176	Bacteria	1601
220	Ga0105248_10027947	3300009177	Bacteria	6281
221	Ga0105237_10000409	3300009545	Bacteria	61096
222	Ga0105237_10005617	3300009545	Bacteria	14137
223	Ga0105237_10006807	3300009545	Bacteria	12603
224	Ga0105237_10052481	3300009545	Unclassified	4093
225	Ga0105238_10007301	3300009551	Bacteria	11064
226	Ga0105238_10062384	3300009551	Bacteria	3728
227	Ga0105249_10021479	3300009553	Bacteria	5779
228	Ga0105249_10023257	3300009553	Bacteria	5559
229	Ga0105249_10049926	3300009553	Bacteria	3815
230	Ga0105249_10091235	3300009553	Bacteria	2850
231	Ga0105249_10104644	3300009553	Bacteria	2667
232	Ga0105249_10112374	3300009553	Bacteria	2576
233	Ga0105249_10169249	3300009553	Bacteria	2118
234	Ga0105239_10000343	3300010375	Bacteria	67956
235	Ga0105239_10001227	3300010375	Bacteria	34941
236	Ga0105239_10005439	3300010375	Bacteria	14944
237	Ga0105239_10042514	3300010375	Bacteria	4980
238	Ga0105239_10053665	3300010375	Bacteria	4421
239	Ga0105239_10093829	3300010375	Bacteria	3314
240	Ga0105246_10032151	3300011119	Bacteria	3478
241	Ga0157373_10007794	3300013100	Bacteria	7960
242	Ga0157373_10011698	3300013100	Bacteria	6444
243	Ga0157373_10035159	3300013100	Bacteria	3598
244	Ga0157373_10230294	3300013100	Unclassified	1308
245	Ga0157371_10046454	3300013102	Bacteria	3088
246	Ga0157371_10061794	3300013102	Bacteria	2656
247	Ga0157371_10128836	3300013102	Bacteria	1800
248	Ga0157371_10139240	3300013102	Bacteria	1729
249	Ga0157371_10140078	3300013102	Unclassified	1723
250	Ga0157370_10002115	3300013104	Bacteria	24264
251	Ga0157370_10010926	3300013104	Bacteria	9533
252	Ga0157369_10008539	3300013105	Bacteria	11746
253	Ga0157369_10023988	3300013105	Bacteria	6786
254	Ga0157369_10045618	3300013105	Bacteria	4765
255	Ga0157374_10000011	3300013296	Bacteria	466749
256	Ga0157374_10028328	3300013296	Bacteria	5061
257	Ga0157374_10046057	3300013296	Bacteria	4037
258	Ga0157374_10172868	3300013296	Bacteria	2108
259	Ga0157378_10002905	3300013297	Bacteria	15257
260	Ga0157378_10003189	3300013297	Bacteria	14572
261	Ga0157378_10012666	3300013297	Bacteria	7378
262	Ga0157378_10044839	3300013297	Bacteria	3928
263	Ga0157378_10120123	3300013297	Bacteria	2421
264	Ga0157378_10180875	3300013297	Bacteria	1984
265	Ga0157378_10216045	3300013297	Bacteria	1820
266	Ga0157378_10223040	3300013297	Unclassified	1793
267	Ga0157378_10352149	3300013297	Unclassified	1439
268	Ga0157378_10901627	3300013297	Unclassified	915
269	Ga0163162_10000151	3300013306	Bacteria	64454
270	Ga0163162_10000344	3300013306	Bacteria	42218
271	Ga0163162_10000782	3300013306	Bacteria	29601
272	Ga0163162_10011601	3300013306	Bacteria	8593
273	Ga0163162_10014906	3300013306	Bacteria	7590
274	Ga0163162_10393231	3300013306	Bacteria	1519
275	Ga0163162_10400165	3300013306	Bacteria	1506
276	Ga0163162_10426231	3300013306	Bacteria	1459
277	Ga0163162_10755012	3300013306	Bacteria	1092
278	Ga0157372_10056150	3300013307	Bacteria	4399
279	Ga0157372_10086555	3300013307	Bacteria	3555
280	Ga0157372_10125841	3300013307	Unclassified	2947
281	Ga0157372_10127461	3300013307	Unclassified	2926
282	Ga0157372_10153496	3300013307	Bacteria	2659
283	Ga0157372_10216330	3300013307	Unclassified	2221
284	Ga0157372_10277134	3300013307	Bacteria	1950
285	Ga0157372_10509874	3300013307	Bacteria	1402
286	Ga0157372_10666623	3300013307	Bacteria	1211
287	Ga0157372_10695300	3300013307	Unclassified	1183
288	Ga0157372_10933891	3300013307	Bacteria	1006
289	Ga0157375_10000911	3300013308	Bacteria	25700
290	Ga0157375_10004190	3300013308	Bacteria	12518
291	Ga0157375_10052035	3300013308	Bacteria	4024
292	Ga0157375_10218267	3300013308	Bacteria	2065
293	Ga0163163_10000215	3300014325	Bacteria	60028
294	Ga0163163_10090713	3300014325	Bacteria	3070
295	Ga0163163_10116980	3300014325	Bacteria	2697
296	Ga0163163_10189538	3300014325	Bacteria	2105
297	Ga0163163_10274408	3300014325	Bacteria	1737
298	Ga0163163_10342358	3300014325	Bacteria	1551
299	Ga0163163_10357622	3300014325	Unclassified	1516
300	Ga0163163_10503692	3300014325	Bacteria	1273
301	Ga0157380_10004165	3300014326	Bacteria	9990
302	Ga0157380_10057056	3300014326	Unclassified	3108
303	Ga0157380_10121024	3300014326	Bacteria	2217
304	Ga0157380_10184886	3300014326	Bacteria	1834
305	Ga0157380_10261465	3300014326	Bacteria	1572
306	Ga0157377_10005894	3300014745	Bacteria	5799
307	Ga0157377_10066796	3300014745	Unclassified	2069
308	Ga0157377_10234136	3300014745	Unclassified	1182
309	Ga0157379_10147775	3300014968	Bacteria	2119
310	Ga0157379_10184606	3300014968	Bacteria	1884
311	Ga0157376_10003806	3300014969	Bacteria	10437
312	Ga0157376_10033522	3300014969	Bacteria	4135
313	Ga0157376_10037872	3300014969	Bacteria	3920
314	Ga0157376_10225958	3300014969	Bacteria	1736
315	Ga0163161_10015639	3300017792	Bacteria	5292
316	Ga0163161_10017879	3300017792	Bacteria	4967
317	Ga0163161_10022905	3300017792	Bacteria	4401
318	Ga0163161_10031415	3300017792	Bacteria	3783
319	Ga0163161_10034766	3300017792	Bacteria	3605
320	Ga0163161_10102000	3300017792	Bacteria	2137
321	Ga0163161_10246501	3300017792	Bacteria	1391
322	Ga0213876_10005782	3300021384	Bacteria	6773
323	Ga0213876_10022792	3300021384	Bacteria	3308
324	Ga0209646_1002933	3300025246	Bacteria	3550
325	Ga0207426_1000211	3300025302	Bacteria	137322
326	Ga0207656_10012744	3300025321	Bacteria	3202
327	Ga0207682_10098637	3300025893	Bacteria	1275
328	Ga0207682_10100061	3300025893	Bacteria	1267
329	Ga0207680_10000032	3300025903	Bacteria	77485
330	Ga0207680_10193625	3300025903	Bacteria	1381
331	Ga0207647_10000096	3300025904	Bacteria	67468
332	Ga0207647_10015067	3300025904	Bacteria	5313
333	Ga0207647_10169603	3300025904	Bacteria	1271
334	Ga0207645_10020806	3300025907	Unclassified	4287
335	Ga0207645_10047256	3300025907	Bacteria	2748
336	Ga0207645_10136377	3300025907	Bacteria	1598
337	Ga0207643_10061490	3300025908	Bacteria	2145
338	Ga0207643_10202892	3300025908	Unclassified	1208
339	Ga0207705_10081762	3300025909	Bacteria	2355
340	Ga0207705_10190207	3300025909	Bacteria	1552
341	Ga0207654_10003193	3300025911	Bacteria	8286
342	Ga0207654_10011353	3300025911	Bacteria	4545
343	Ga0207707_10049929	3300025912	Bacteria	3645
344	Ga0207707_10172454	3300025912	Bacteria	1890
345	Ga0207695_10000313	3300025913	Bacteria	117072
346	Ga0207695_10000346	3300025913	Bacteria	107028
347	Ga0207695_10001638	3300025913	Bacteria	36175
348	Ga0207695_10050880	3300025913	Bacteria	4355
349	Ga0207695_10054308	3300025913	Bacteria	4185
350	Ga0207695_10062575	3300025913	Bacteria	3841
351	Ga0207671_10000402	3300025914	Bacteria	60371
352	Ga0207671_10001317	3300025914	Bacteria	29052
353	Ga0207671_10002977	3300025914	Bacteria	17383
354	Ga0207671_10013961	3300025914	Bacteria	6374
355	Ga0207671_10036676	3300025914	Unclassified	3637
356	Ga0207662_10066259	3300025918	Bacteria	2176
357	Ga0207657_10004720	3300025919	Bacteria	14380
358	Ga0207657_10024469	3300025919	Bacteria	5588
359	Ga0207649_10229123	3300025920	Bacteria	1328
360	Ga0207652_10100142	3300025921	Bacteria	2558
361	Ga0207652_10102840	3300025921	Bacteria	2525
362	Ga0207681_10069963	3300025923	Bacteria	2443
363	Ga0207681_10181955	3300025923	Bacteria	1602
364	Ga0207694_10006626	3300025924	Bacteria	8801
365	Ga0207694_10293829	3300025924	Unclassified	1336
366	Ga0207650_10170939	3300025925	Bacteria	1727
367	Ga0207650_10309073	3300025925	Unclassified	1293
368	Ga0207650_10392873	3300025925	Bacteria	1147
369	Ga0207659_10022872	3300025926	Bacteria	4167
370	Ga0207659_10346646	3300025926	Bacteria	1231
371	Ga0207687_10162263	3300025927	Unclassified	1716
372	Ga0207644_10011068	3300025931	Bacteria	5959
373	Ga0207644_10112557	3300025931	Bacteria	2060
374	Ga0207690_10016196	3300025932	Bacteria	4532
375	Ga0207706_10019629	3300025933	Bacteria	6080
376	Ga0207686_10007658	3300025934	Bacteria	5820
377	Ga0207670_10000687	3300025936	Bacteria	17875
378	Ga0207670_10060183	3300025936	Bacteria	2586
379	Ga0207704_10317372	3300025938	Unclassified	1200
380	Ga0207691_10022153	3300025940	Bacteria	5994
381	Ga0207691_10050794	3300025940	Bacteria	3794
382	Ga0207691_10054463	3300025940	Bacteria	3648
383	Ga0207691_10070418	3300025940	Bacteria	3158
384	Ga0207691_10164457	3300025940	Bacteria	1945
385	Ga0207691_10224890	3300025940	Unclassified	1626
386	Ga0207691_10310181	3300025940	Bacteria	1354
387	Ga0207689_10013487	3300025942	Bacteria	6981
388	Ga0207689_10014027	3300025942	Bacteria	6821
389	Ga0207689_10065690	3300025942	Unclassified	2984
390	Ga0207689_10095473	3300025942	Bacteria	2442
391	Ga0207689_10114825	3300025942	Bacteria	2213
392	Ga0207661_10074126	3300025944	Bacteria	2790
393	Ga0207661_10262985	3300025944	Bacteria	1537
394	Ga0207679_10022335	3300025945	Bacteria	4307
395	Ga0207679_10041903	3300025945	Bacteria	3287
396	Ga0207679_10435026	3300025945	Bacteria	1160
397	Ga0207667_10006159	3300025949	Bacteria	14576
398	Ga0207667_10006640	3300025949	Bacteria	13981
399	Ga0207667_10179079	3300025949	Bacteria	2177
400	Ga0207667_10196837	3300025949	Bacteria	2067
401	Ga0207651_10011668	3300025960	Bacteria	4930
402	Ga0207651_10077507	3300025960	Bacteria	2380
403	Ga0207651_10084359	3300025960	Unclassified	2301
404	Ga0207651_10099925	3300025960	Bacteria	2150
405	Ga0207651_10190099	3300025960	Bacteria	1637
406	Ga0207712_10006471	3300025961	Bacteria	7385
407	Ga0207712_10010020	3300025961	Bacteria	6007
408	Ga0207712_10060531	3300025961	Bacteria	2685
409	Ga0207712_10066018	3300025961	Bacteria	2585
410	Ga0207712_10118404	3300025961	Unclassified	1999
411	Ga0207668_10044565	3300025972	Unclassified	3019
412	Ga0207668_10234938	3300025972	Unclassified	1480
413	Ga0207640_10010753	3300025981	Bacteria	5163
414	Ga0207640_10179777	3300025981	Bacteria	1585
415	Ga0207658_10022886	3300025986	Unclassified	4354
416	Ga0207658_10302059	3300025986	Bacteria	1379
417	Ga0207677_10003307	3300026023	Bacteria	8525
418	Ga0207677_10074356	3300026023	Unclassified	2411
419	Ga0207677_10079398	3300026023	Bacteria	2346
420	Ga0207677_10221248	3300026023	Bacteria	1518
421	Ga0207703_10051094	3300026035	Bacteria	3349
422	Ga0207703_10264914	3300026035	Bacteria	1554
423	Ga0207639_10100899	3300026041	Bacteria	2332
424	Ga0207639_10129480	3300026041	Bacteria	2087
425	Ga0207639_10161842	3300026041	Unclassified	1886
426	Ga0207639_10444145	3300026041	Bacteria	1176
427	Ga0207639_10463400	3300026041	Bacteria	1152
428	Ga0207708_10032194	3300026075	Bacteria	3983
429	Ga0207702_10020850	3300026078	Bacteria	5422
430	Ga0207702_10080465	3300026078	Bacteria	2827
431	Ga0207702_10217787	3300026078	Bacteria	1778
432	Ga0207641_10000111	3300026088	Bacteria	120527
433	Ga0207641_10000661	3300026088	Bacteria	37590
434	Ga0207641_10033650	3300026088	Bacteria	4258
435	Ga0207641_10070217	3300026088	Bacteria	3009
436	Ga0207641_10179755	3300026088	Bacteria	1937
437	Ga0207641_10209917	3300026088	Unclassified	1800
438	Ga0207641_10301183	3300026088	Bacteria	1514
439	Ga0207648_10002777	3300026089	Bacteria	18581
440	Ga0207648_10060891	3300026089	Bacteria	3291
441	Ga0207648_10082006	3300026089	Bacteria	2812
442	Ga0207648_10176774	3300026089	Bacteria	1888
443	Ga0207648_10199466	3300026089	Bacteria	1775
444	Ga0207676_10023886	3300026095	Bacteria	4518
445	Ga0207676_10065397	3300026095	Bacteria	2895
446	Ga0207676_10093940	3300026095	Bacteria	2470
447	Ga0207676_10230035	3300026095	Bacteria	1657
448	Ga0207674_10003288	3300026116	Bacteria	19877
449	Ga0207674_10048957	3300026116	Bacteria	4323
450	Ga0207674_10095134	3300026116	Bacteria	2965
451	Ga0207674_10107427	3300026116	Bacteria	2768
452	Ga0207675_100001864	3300026118	Bacteria	21105
453	Ga0207675_100109379	3300026118	Bacteria	2608
454	Ga0207683_10054465	3300026121	Bacteria	3508
455	Ga0207683_10068803	3300026121	Bacteria	3126
456	Ga0207683_10132424	3300026121	Bacteria	2243
457	Ga0207683_10312746	3300026121	Bacteria	1438
458	Ga0207698_10003425	3300026142	Bacteria	9545
459	Ga0207698_10008099	3300026142	Bacteria	6624
460	Ga0207698_10013530	3300026142	Bacteria	5387
461	Ga0207698_10045743	3300026142	Bacteria	3299
462	Ga0207698_10046965	3300026142	Bacteria	3266
463	Ga0207698_10189150	3300026142	Bacteria	1832
464	Ga0207698_10424121	3300026142	Bacteria	1277
465	Ga0209984_1006277	3300027424	Bacteria	1454
466	Ga0207428_10009365	3300027907	Bacteria	8785
467	Ga0207428_10407325	3300027907	Bacteria	995
468	Ga0268266_10000068	3300028379	Bacteria	241100
469	Ga0268265_10344632	3300028380	Bacteria	1358
470	Ga0268264_10000079	3300028381	Bacteria	249516
471	Ga0268264_10002203	3300028381	Bacteria	17296
472	Ga0268264_10004438	3300028381	Bacteria	11968
473	Ga0268264_10008001	3300028381	Bacteria	8792
474	Ga0268264_10078043	3300028381	Bacteria	2822
475	Ga0268264_10622846	3300028381	Unclassified	1065
476	Ga0307517_10002947	3300028786	Bacteria	26911
477	Ga0307517_10266897	3300028786	Unclassified	988
478	Ga0307515_10000001	3300028794	Bacteria	4259510
479	Ga0307515_10000162	3300028794	Bacteria	163720
480	Ga0307511_10002426	3300030521	Bacteria	19480
481	Ga0265327_10000211	3300031251	Bacteria	121722
482	Ga0265327_10000511	3300031251	Bacteria	67370
483	Ga0307513_10011825	3300031456	Bacteria	10818
484	Ga0307513_10030364	3300031456	Bacteria	6141
485	Ga0307513_10293036	3300031456	Bacteria	1398
486	Ga0307509_10025814	3300031507	Bacteria	6561
487	Ga0307509_10131536	3300031507	Bacteria	2457
488	Ga0307509_10207190	3300031507	Bacteria	1790
489	Ga0307508_10000686	3300031616	Bacteria	40604
490	Ga0316578_10045193	3300031728	Bacteria	2563
491	Ga0307516_10003590	3300031730	Bacteria	19774
492	Ga0307516_10109739	3300031730	Bacteria	2563
493	Ga0307518_10163597	3300031838	Bacteria	1526
494	Ga0307412_10069031	3300031911	Bacteria	2405
495	Ga0307416_100332025	3300032002	Bacteria	1529
496	Ga0307414_10000249	3300032004	Bacteria	33948
497	Ga0307510_10009449	3300033180	Bacteria	11612
498	Ga0316582_0047235	3300036647	Bacteria	2717
499	Ga0316584_0000921	3300036712	Bacteria	16756
500	Ga0395898_0089761	3300037466	Unclassified	2958
501	Ga0400483_189665	3300039062	Bacteria	1631
502	Ga0400483_213583	3300039062	Bacteria	2695
503	Ga0436365_1482664	3300039437	Bacteria	28756
504	Ga0436365_1743396	3300039437	Bacteria	55864
505	Ga0439439_0023499	3300041406	Bacteria	1544
506	Ga0439465_0019623	3300041413	Bacteria	2114
507	Ga0451804_1163584	3300041463	Bacteria	2034
508	Ga0451837_1153393	3300041494	Bacteria	1359
509	Ga0439448_0024728	3300042005	Bacteria	1880
510	Ga0439457_007741	3300042014	Bacteria	2567
511	Ga0439462_0000316	3300042015	Bacteria	8967
512	Ga0451577_0000090	3300042876	Bacteria	202241
513	Ga0451577_0010418	3300042876	Bacteria	8892
514	Ga0451577_0020879	3300042876	Bacteria	6004
515	Ga0451577_0028937	3300042876	Bacteria	5010
516	Ga0451577_0068302	3300042876	Bacteria	3170
517	Ga0451577_0075660	3300042876	Bacteria	3002
518	Ga0451577_0077486	3300042876	Bacteria	2964
519	Ga0451577_0185511	3300042876	Unclassified	1876
520	Ga0451577_0191379	3300042876	Bacteria	1846
521	Ga0466972_0000026	3300044658	Bacteria	184739
522	Ga0466972_0000047	3300044658	Bacteria	122901
523	Ga0453683_0000023	3300044673	Bacteria	264522
524	Ga0453683_0002411	3300044673	Bacteria	14555
525	Ga0453683_0057182	3300044673	Bacteria	2440
526	Ga0453683_0273851	3300044673	Bacteria	1077
527	Ga0466966_0000047	3300044684	Bacteria	91962
528	Ga0453684_0000322	3300044712	Bacteria	202241
529	Ga0453684_0000630	3300044712	Bacteria	128059
530	Ga0453684_0001093	3300044712	Bacteria	85531
531	Ga0453684_0002109	3300044712	Bacteria	50197
532	Ga0453684_0006379	3300044712	Bacteria	22467
533	Ga0453684_0030173	3300044712	Bacteria	7668
534	Ga0453684_0143501	3300044712	Bacteria	2847
535	Ga0453684_0186962	3300044712	Bacteria	2426
536	Ga0453684_0187942	3300044712	Unclassified	2419
537	Ga0453684_0219851	3300044712	Bacteria	2201
538	Ga0453684_0553105	3300044712	Bacteria	1267
539	Ga0466957_0000937	3300044842	Bacteria	14932
540	Ga0466957_0023370	3300044842	Bacteria	3655
541	Ga0466959_0000065	3300045049	Bacteria	73931
542	Ga0451576_0001114	3300045051	Bacteria	48965
543	Ga0451576_0021859	3300045051	Bacteria	6947
544	Ga0451576_0023763	3300045051	Bacteria	6633
545	Ga0451576_0082645	3300045051	Bacteria	3341
546	Ga0451576_0265309	3300045051	Bacteria	1795
547	Ga0451576_0776334	3300045051	Bacteria	1006
548	Ga0466967_0129114	3300045976	Bacteria	2344
549	Ga0495638_0194535	3300046460	Bacteria	1149
550	Ga0495606_0065493	3300046507	Bacteria	2308
551	Ga0495648_0003925	3300046524	Bacteria	12873
552	Ga0495668_0001854	3300046616	Bacteria	19009
553	Ga0495611_0000435	3300046648	Bacteria	25748
554	Ga0495625_0097770	3300046660	Bacteria	2020
555	Ga0495649_0118345	3300046694	Bacteria	1402
556	Ga0495600_0090666	3300046809	Bacteria	1994
557	Ga0495672_0013953	3300047320	Bacteria	5524
558	Ga0495672_0042036	3300047320	Bacteria	2759
559	Ga0495686_0000005	3300047472	Bacteria	827143
560	Ga0496100_0022116	3300048903	Bacteria	3843
561	Ga0496101_0135966	3300048904	Bacteria	1870
562	Ga0496105_0104890	3300048908	Bacteria	2333
563	Ga0496114_0060428	3300048917	Bacteria	3168
564	Ga0501031_0011346	3300049568	Bacteria	5804
565	Ga0501032_0016212	3300049569	Bacteria	5242
566	Ga0501034_0000004	3300049571	Bacteria	382255
567	Ga0501034_0156703	3300049571	Bacteria	2250
568	Ga0501036_0064864	3300049572	Bacteria	3090
569	Ga0501037_0073362	3300049573	Bacteria	2488
570	Ga0501038_0031875	3300049574	Bacteria	4655
571	Ga0501039_0215284	3300049575	Unclassified	1510
572	Ga0501046_0059769	3300049580	Bacteria	2985
573	Ga0501047_0104968	3300049581	Bacteria	2706
574	Ga0501047_0197800	3300049581	Bacteria	1872
575	Ga0501047_0227791	3300049581	Unclassified	1718
576	Ga0501048_0210764	3300049582	Bacteria	1378
577	Ga0501073_0243757	3300049589	Unclassified	1241
578	Ga0501219_001286	3300049703	Bacteria	2625
579	Ga0501080_0071157	3300049742	Unclassified	3235
580	Ga0501241_006354	3300049758	Bacteria	2175
581	Ga0501274_003780	3300049771	Unclassified	1232
582	Ga0501284_00017	3300050005	Bacteria	96362
583	nmdc:mga0k408_100822_c1	3300050493	Bacteria	1702
584	nmdc:mga0k408_15433_c1	3300050493	Bacteria	4225
585	nmdc:mga0k408_35592_c1	3300050493	Bacteria	2855
586	nmdc:mga0k408_56925_c1	3300050493	Bacteria	2269
587	nmdc:mga0k408_84507_c1	3300050493	Bacteria	1862
588	nmdc:mga09592_142272_c1	3300050508	Bacteria	2068
589	nmdc:mga08y16_109274_c1	3300050511	Bacteria	2879
590	nmdc:mga08y16_13908_c1	3300050511	Bacteria	8469
591	nmdc:mga08y16_216100_c1	3300050511	Unclassified	1985
592	Ga0500578_0000765	3300053086	Bacteria	37890
593	Ga0500578_0071393	3300053086	Bacteria	2213
594	Ga0500646_0005187	3300053090	Bacteria	3299
595	Ga0500583_0000003	3300053092	Bacteria	229587
596	Ga0500583_0000114	3300053092	Bacteria	39145
597	Ga0500583_0008462	3300053092	Unclassified	3693
598	Ga0500641_0008479	3300053096	Bacteria	3670
599	Ga0500555_002160	3300053103	Bacteria	5763
600	Ga0500556_0016645	3300053104	Bacteria	2290
601	Ga0500562_000005	3300053108	Bacteria	266746
602	Ga0500594_0021515	3300053118	Unclassified	1618
603	Ga0500594_0045709	3300053118	Bacteria	1216
604	Ga0500642_0006418	3300053130	Bacteria	3871
605	Ga0500568_0000155	3300053139	Bacteria	59396
606	Ga0500588_0039119	3300053146	Bacteria	1418
607	Ga0500604_0004024	3300053151	Bacteria	3920
608	Ga0500604_0022003	3300053151	Bacteria	1807
609	Ga0500616_0003349	3300053153	Bacteria	12329
610	Ga0500616_0076556	3300053153	Bacteria	1691
611	Ga0500622_0000143	3300053156	Bacteria	76095
612	Ga0500622_0017523	3300053156	Bacteria	3812
613	Ga0500622_0020789	3300053156	Unclassified	3483
614	Ga0500622_0046969	3300053156	Bacteria	2230
615	Ga0500622_0070691	3300053156	Unclassified	1765
616	Ga0500611_000155	3300053727	Bacteria	10865
617	Ga0500611_009192	3300053727	Bacteria	1557
618	Ga0500645_007324	3300053730	Bacteria	3856
619	Ga0500661_008754	3300055283	Bacteria	1862

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300042876	Ga0451577_0075660	Ga0451577_0075660_113_823	234
2	3300013102	Ga0157371_10140078	Ga0157371_101400782	268
3	3300013307	Ga0157372_10153496	Ga0157372_101534962	268
4	3300005843	Ga0068860_100708844	Ga0068860_1007088441	272
5	3300042876	Ga0451577_0020879	Ga0451577_0020879_2193_3101	278
6	3300044712	Ga0453684_0186962	Ga0453684_0186962_227_1135	278
7	3300049568	Ga0501031_0011346	Ga0501031_0011346_2886_3764	278
8	3300049569	Ga0501032_0016212	Ga0501032_0016212_2196_3074	278
9	3300049571	Ga0501034_0156703	Ga0501034_0156703_973_1851	278
10	3300049572	Ga0501036_0064864	Ga0501036_0064864_397_1275	278
11	3300049573	Ga0501037_0073362	Ga0501037_0073362_1562_2440	278
12	3300049574	Ga0501038_0031875	Ga0501038_0031875_3478_4356	278
13	3300049575	Ga0501039_0215284	Ga0501039_0215284_77_955	278
14	3300049580	Ga0501046_0059769	Ga0501046_0059769_225_1103	278
15	3300049581	Ga0501047_0227791	Ga0501047_0227791_565_1443	278
16	3300049589	Ga0501073_0243757	Ga0501073_0243757_287_1165	278
17	3300021384	Ga0213876_10005782	Ga0213876_100057823	279
18	3300039437	Ga0436365_1743396	Ga0436365_1743396_27567_28529	279
19	3300014326	Ga0157380_10057056	Ga0157380_100570562	280
20	3300005331	Ga0070670_100139901	Ga0070670_1001399012	281
21	3300005335	Ga0070666_10105517	Ga0070666_101055171	281
22	3300005338	Ga0068868_100129980	Ga0068868_1001299802	281
23	3300005355	Ga0070671_100015427	Ga0070671_1000154273	281
24	3300005456	Ga0070678_100034684	Ga0070678_1000346843	281
25	3300005841	Ga0068863_100314161	Ga0068863_1003141612	281
26	3300006237	Ga0097621_100000465	Ga0097621_1000004659	281
27	3300006358	Ga0068871_100001644	Ga0068871_1000016449	281
28	3300009177	Ga0105248_10027947	Ga0105248_100279473	281
29	3300009553	Ga0105249_10169249	Ga0105249_101692491	281
30	3300013306	Ga0163162_10014906	Ga0163162_100149063	281
31	3300013308	Ga0157375_10000911	Ga0157375_1000091111	281
32	3300014325	Ga0163163_10000215	Ga0163163_1000021510	281
33	3300014968	Ga0157379_10184606	Ga0157379_101846061	281
34	3300014969	Ga0157376_10033522	Ga0157376_100335224	281
35	3300017792	Ga0163161_10015639	Ga0163161_100156395	281
36	3300025931	Ga0207644_10011068	Ga0207644_100110682	281
37	3300026088	Ga0207641_10301183	Ga0207641_103011832	281
38	3300026121	Ga0207683_10054465	Ga0207683_100544653	281
39	3300048903	Ga0496100_0022116	Ga0496100_0022116_2194_3069	281
40	3300048904	Ga0496101_0135966	Ga0496101_0135966_172_1047	281
41	3300048917	Ga0496114_0060428	Ga0496114_0060428_1568_2443	281
42	3300009553	Ga0105249_10104644	Ga0105249_101046442	283
43	3300013306	Ga0163162_10000782	Ga0163162_100007829	283
44	3300017792	Ga0163161_10017879	Ga0163161_100178794	283
45	3300025961	Ga0207712_10060531	Ga0207712_100605312	283
46	3300006028	Ga0070717_10068394	Ga0070717_100683942	286
47	iso_pu_bacteria	2738541278	2738725805	286
48	iso_pu_bacteria	2929154850	2929159942	286
49	3300032002	Ga0307416_100332025	Ga0307416_1003320251	287
50	3300044712	Ga0453684_0219851	Ga0453684_0219851_329_1210	287
51	3300045051	Ga0451576_0021859	Ga0451576_0021859_4582_5463	287
52	3300003323	rootH1_10044956	rootH1_100449561	288
53	3300003323	rootH1_10205358	rootH1_102053583	288
54	3300005339	Ga0070660_100017246	Ga0070660_1000172464	288
55	3300005458	Ga0070681_10254868	Ga0070681_102548681	288
56	3300005539	Ga0068853_100051185	Ga0068853_1000511851	288
57	3300005563	Ga0068855_100098246	Ga0068855_1000982462	288
58	3300005616	Ga0068852_100001058	Ga0068852_1000010588	288
59	3300013102	Ga0157371_10061794	Ga0157371_100617942	288
60	3300013307	Ga0157372_10086555	Ga0157372_100865552	288
61	3300014326	Ga0157380_10261465	Ga0157380_102614652	288
62	3300025919	Ga0207657_10024469	Ga0207657_100244693	288
63	3300025944	Ga0207661_10074126	Ga0207661_100741263	288
64	3300026142	Ga0207698_10045743	Ga0207698_100457433	288
65	3300031456	Ga0307513_10293036	Ga0307513_102930362	288
66	3300032004	Ga0307414_10000249	Ga0307414_100002494	288
67	3300039062	Ga0400483_189665	Ga0400483_189665_26_910	288
68	3300041413	Ga0439465_0019623	Ga0439465_0019623_1082_1957	288
69	3300041494	Ga0451837_1153393	Ga0451837_1153393_125_1024	288
70	3300042876	Ga0451577_0028937	Ga0451577_0028937_3061_3933	288
71	3300042876	Ga0451577_0068302	Ga0451577_0068302_802_1674	288
72	3300042876	Ga0451577_0191379	Ga0451577_0191379_651_1523	288
73	3300044673	Ga0453683_0000023	Ga0453683_0000023_172186_173058	288
74	3300044673	Ga0453683_0273851	Ga0453683_0273851_42_914	288
75	3300044712	Ga0453684_0002109	Ga0453684_0002109_45137_46009	288
76	3300044712	Ga0453684_0030173	Ga0453684_0030173_2607_3479	288
77	3300045051	Ga0451576_0023763	Ga0451576_0023763_5590_6462	288
78	3300045051	Ga0451576_0265309	Ga0451576_0265309_265_1146	288
79	3300045051	Ga0451576_0776334	Ga0451576_0776334_110_982	288
80	iso_pu_bacteria	2833640130	2833643016	288
81	3300005327	Ga0070658_10056607	Ga0070658_100566073	289
82	3300005327	Ga0070658_10299328	Ga0070658_102993282	289
83	3300005328	Ga0070676_10100128	Ga0070676_101001282	289
84	3300005329	Ga0070683_100023597	Ga0070683_1000235976	289
85	3300005331	Ga0070670_100128773	Ga0070670_1001287733	289
86	3300005337	Ga0070682_100092991	Ga0070682_1000929911	289
87	3300005338	Ga0068868_100068576	Ga0068868_1000685761	289
88	3300005338	Ga0068868_100208769	Ga0068868_1002087691	289
89	3300005340	Ga0070689_100010789	Ga0070689_1000107896	289
90	3300005340	Ga0070689_100110054	Ga0070689_1001100542	289
91	3300005344	Ga0070661_100042758	Ga0070661_1000427582	289
92	3300005353	Ga0070669_100007084	Ga0070669_1000070848	289
93	3300005354	Ga0070675_100009761	Ga0070675_1000097618	289
94	3300005355	Ga0070671_100237046	Ga0070671_1002370461	289
95	3300005364	Ga0070673_100219778	Ga0070673_1002197782	289
96	3300005364	Ga0070673_100295044	Ga0070673_1002950441	289
97	3300005365	Ga0070688_100000950	Ga0070688_10000095011	289
98	3300005366	Ga0070659_100025107	Ga0070659_1000251072	289
99	3300005457	Ga0070662_100011043	Ga0070662_1000110433	289
100	3300005458	Ga0070681_10035416	Ga0070681_100354163	289
101	3300005530	Ga0070679_100107690	Ga0070679_1001076902	289
102	3300005535	Ga0070684_100083885	Ga0070684_1000838852	289
103	3300005539	Ga0068853_100193368	Ga0068853_1001933682	289
104	3300005543	Ga0070672_100224483	Ga0070672_1002244832	289
105	3300005544	Ga0070686_100031154	Ga0070686_1000311543	289
106	3300005563	Ga0068855_100014854	Ga0068855_1000148547	289
107	3300005563	Ga0068855_100049387	Ga0068855_1000493873	289
108	3300005577	Ga0068857_100194031	Ga0068857_1001940311	289
109	3300005578	Ga0068854_100093898	Ga0068854_1000938983	289
110	3300005614	Ga0068856_100004457	Ga0068856_1000044573	289
111	3300005615	Ga0070702_100027268	Ga0070702_1000272681	289
112	3300005616	Ga0068852_100001594	Ga0068852_10000159417	289
113	3300005616	Ga0068852_100405273	Ga0068852_1004052732	289
114	3300005719	Ga0068861_100012159	Ga0068861_1000121597	289
115	3300005719	Ga0068861_100345614	Ga0068861_1003456142	289
116	3300005840	Ga0068870_10015498	Ga0068870_100154982	289
117	3300005844	Ga0068862_100023190	Ga0068862_1000231902	289
118	3300006195	Ga0075366_10002847	Ga0075366_100028474	289
119	3300006847	Ga0075431_100036428	Ga0075431_1000364282	289
120	3300006880	Ga0075429_100108673	Ga0075429_1001086732	289
121	3300006880	Ga0075429_100152863	Ga0075429_1001528632	289
122	3300006881	Ga0068865_100117296	Ga0068865_1001172962	289
123	3300009093	Ga0105240_10015994	Ga0105240_100159947	289
124	3300009094	Ga0111539_10001644	Ga0111539_1000164410	289
125	3300009094	Ga0111539_10008682	Ga0111539_100086829	289
126	3300009174	Ga0105241_10006585	Ga0105241_100065853	289
127	3300009553	Ga0105249_10091235	Ga0105249_100912353	289
128	3300010375	Ga0105239_10005439	Ga0105239_100054396	289
129	3300013100	Ga0157373_10011698	Ga0157373_100116982	289
130	3300013100	Ga0157373_10035159	Ga0157373_100351592	289
131	3300013102	Ga0157371_10128836	Ga0157371_101288362	289
132	3300013102	Ga0157371_10139240	Ga0157371_101392402	289
133	3300013105	Ga0157369_10008539	Ga0157369_100085398	289
134	3300013105	Ga0157369_10045618	Ga0157369_100456184	289
135	3300013297	Ga0157378_10003189	Ga0157378_100031898	289
136	3300013306	Ga0163162_10426231	Ga0163162_104262311	289
137	3300013306	Ga0163162_10755012	Ga0163162_107550122	289
138	3300013307	Ga0157372_10056150	Ga0157372_100561502	289
139	3300013307	Ga0157372_10695300	Ga0157372_106953001	289
140	3300013308	Ga0157375_10052035	Ga0157375_100520353	289
141	3300014325	Ga0163163_10342358	Ga0163163_103423582	289
142	3300014745	Ga0157377_10005894	Ga0157377_100058942	289
143	3300021384	Ga0213876_10022792	Ga0213876_100227924	289
144	3300025904	Ga0207647_10000096	Ga0207647_1000009657	289
145	3300025907	Ga0207645_10136377	Ga0207645_101363772	289
146	3300025908	Ga0207643_10061490	Ga0207643_100614902	289
147	3300025909	Ga0207705_10081762	Ga0207705_100817622	289
148	3300025911	Ga0207654_10011353	Ga0207654_100113533	289
149	3300025912	Ga0207707_10049929	Ga0207707_100499293	289
150	3300025913	Ga0207695_10001638	Ga0207695_100016383	289
151	3300025920	Ga0207649_10229123	Ga0207649_102291232	289
152	3300025921	Ga0207652_10100142	Ga0207652_101001423	289
153	3300025925	Ga0207650_10170939	Ga0207650_101709392	289
154	3300025926	Ga0207659_10022872	Ga0207659_100228725	289
155	3300025931	Ga0207644_10112557	Ga0207644_101125572	289
156	3300025932	Ga0207690_10016196	Ga0207690_100161962	289
157	3300025933	Ga0207706_10019629	Ga0207706_100196295	289
158	3300025936	Ga0207670_10060183	Ga0207670_100601833	289
159	3300025940	Ga0207691_10022153	Ga0207691_100221534	289
160	3300025940	Ga0207691_10054463	Ga0207691_100544634	289
161	3300025945	Ga0207679_10022335	Ga0207679_100223352	289
162	3300025945	Ga0207679_10435026	Ga0207679_104350261	289
163	3300025949	Ga0207667_10006640	Ga0207667_100066407	289
164	3300025972	Ga0207668_10044565	Ga0207668_100445652	289
165	3300025981	Ga0207640_10010753	Ga0207640_100107533	289
166	3300026023	Ga0207677_10074356	Ga0207677_100743562	289
167	3300026035	Ga0207703_10264914	Ga0207703_102649142	289
168	3300026041	Ga0207639_10129480	Ga0207639_101294802	289
169	3300026078	Ga0207702_10020850	Ga0207702_100208501	289
170	3300026116	Ga0207674_10003288	Ga0207674_1000328815	289
171	3300026118	Ga0207675_100001864	Ga0207675_10000186412	289
172	3300026142	Ga0207698_10008099	Ga0207698_100080993	289
173	3300026142	Ga0207698_10013530	Ga0207698_100135304	289
174	3300026142	Ga0207698_10189150	Ga0207698_101891502	289
175	3300027424	Ga0209984_1006277	Ga0209984_10062772	289
176	3300027907	Ga0207428_10009365	Ga0207428_100093658	289
177	3300031911	Ga0307412_10069031	Ga0307412_100690312	289
178	3300037466	Ga0395898_0089761	Ga0395898_0089761_1409_2287	289
179	3300039437	Ga0436365_1482664	Ga0436365_1482664_21094_21966	289
180	3300042876	Ga0451577_0000090	Ga0451577_0000090_182909_183838	289
181	3300044673	Ga0453683_0002411	Ga0453683_0002411_3154_4083	289
182	3300044712	Ga0453684_0000322	Ga0453684_0000322_182909_183838	289
183	3300044712	Ga0453684_0001093	Ga0453684_0001093_53085_53972	289
184	3300044712	Ga0453684_0143501	Ga0453684_0143501_242_1117	289
185	3300045051	Ga0451576_0001114	Ga0451576_0001114_18404_19333	289
186	3300049571	Ga0501034_0000004	Ga0501034_0000004_209536_210414	289
187	3300049771	Ga0501274_003780	Ga0501274_003780_340_1218	289
188	3300050508	nmdc:mga09592_142272_c1	nmdc:mga09592_142272_c1_1060_1935	289
189	3300050511	nmdc:mga08y16_109274_c1	nmdc:mga08y16_109274_c1_379_1254	289
190	3300050511	nmdc:mga08y16_13908_c1	nmdc:mga08y16_13908_c1_1754_2629	289
191	3300053139	Ga0500568_0000155	Ga0500568_0000155_39067_39942	289
192	3300003320	rootH2_10013030	rootH2_100130304	290
193	3300003322	rootL2_10029799	rootL2_100297995	290
194	3300003322	rootL2_10059993	rootL2_100599932	290
195	3300003322	rootL2_10068385	rootL2_100683855	290
196	3300003322	rootL2_10080435	rootL2_100804351	290
197	3300003322	rootL2_10303913	rootL2_103039131	290
198	3300003322	rootL2_10319575	rootL2_103195752	290
199	3300003323	rootH1_10021882	rootH1_100218824	290
200	3300003323	rootH1_10324603	rootH1_103246031	290
201	3300005290	Ga0065712_10082662	Ga0065712_100826622	290
202	3300005327	Ga0070658_10155473	Ga0070658_101554731	290
203	3300005329	Ga0070683_100017900	Ga0070683_1000179002	290
204	3300005330	Ga0070690_100238979	Ga0070690_1002389791	290
205	3300005331	Ga0070670_100004105	Ga0070670_1000041056	290
206	3300005331	Ga0070670_100393065	Ga0070670_1003930651	290
207	3300005333	Ga0070677_10014997	Ga0070677_100149973	290
208	3300005333	Ga0070677_10083052	Ga0070677_100830521	290
209	3300005334	Ga0068869_100005652	Ga0068869_1000056523	290
210	3300005334	Ga0068869_100043566	Ga0068869_1000435664	290
211	3300005334	Ga0068869_100068795	Ga0068869_1000687951	290
212	3300005334	Ga0068869_100378054	Ga0068869_1003780541	290
213	3300005335	Ga0070666_10000050	Ga0070666_1000005074	290
214	3300005335	Ga0070666_10100196	Ga0070666_101001962	290
215	3300005337	Ga0070682_100000019	Ga0070682_10000001944	290
216	3300005337	Ga0070682_100003137	Ga0070682_10000313710	290
217	3300005337	Ga0070682_100004566	Ga0070682_1000045665	290
218	3300005338	Ga0068868_100001389	Ga0068868_10000138911	290
219	3300005338	Ga0068868_100059240	Ga0068868_1000592403	290
220	3300005338	Ga0068868_100146432	Ga0068868_1001464322	290
221	3300005338	Ga0068868_100242709	Ga0068868_1002427092	290
222	3300005339	Ga0070660_100030338	Ga0070660_1000303382	290
223	3300005340	Ga0070689_100010348	Ga0070689_1000103486	290
224	3300005343	Ga0070687_100106481	Ga0070687_1001064812	290
225	3300005344	Ga0070661_100020346	Ga0070661_1000203465	290
226	3300005347	Ga0070668_100057655	Ga0070668_1000576552	290
227	3300005353	Ga0070669_100174352	Ga0070669_1001743521	290
228	3300005353	Ga0070669_100194297	Ga0070669_1001942972	290
229	3300005354	Ga0070675_100224977	Ga0070675_1002249773	290
230	3300005354	Ga0070675_100336294	Ga0070675_1003362942	290
231	3300005355	Ga0070671_100038053	Ga0070671_1000380533	290
232	3300005355	Ga0070671_100072533	Ga0070671_1000725331	290
233	3300005355	Ga0070671_100121636	Ga0070671_1001216361	290
234	3300005355	Ga0070671_100478108	Ga0070671_1004781081	290
235	3300005364	Ga0070673_100019908	Ga0070673_1000199085	290
236	3300005364	Ga0070673_100102840	Ga0070673_1001028402	290
237	3300005364	Ga0070673_100133465	Ga0070673_1001334653	290
238	3300005364	Ga0070673_100158562	Ga0070673_1001585622	290
239	3300005364	Ga0070673_100220105	Ga0070673_1002201052	290
240	3300005364	Ga0070673_100318351	Ga0070673_1003183511	290
241	3300005365	Ga0070688_100031501	Ga0070688_1000315013	290
242	3300005366	Ga0070659_100006321	Ga0070659_1000063215	290
243	3300005367	Ga0070667_100004077	Ga0070667_1000040779	290
244	3300005367	Ga0070667_100019648	Ga0070667_1000196482	290
245	3300005367	Ga0070667_100082420	Ga0070667_1000824201	290
246	3300005367	Ga0070667_100322842	Ga0070667_1003228421	290
247	3300005456	Ga0070678_100344057	Ga0070678_1003440572	290
248	3300005458	Ga0070681_10208490	Ga0070681_102084901	290
249	3300005458	Ga0070681_10351764	Ga0070681_103517642	290
250	3300005459	Ga0068867_100037914	Ga0068867_1000379141	290
251	3300005459	Ga0068867_100054642	Ga0068867_1000546423	290
252	3300005459	Ga0068867_100093598	Ga0068867_1000935982	290
253	3300005466	Ga0070685_10001967	Ga0070685_1000196710	290
254	3300005466	Ga0070685_10043939	Ga0070685_100439391	290
255	3300005466	Ga0070685_10098102	Ga0070685_100981022	290
256	3300005518	Ga0070699_100463655	Ga0070699_1004636551	290
257	3300005535	Ga0070684_100238627	Ga0070684_1002386272	290
258	3300005539	Ga0068853_100000422	Ga0068853_1000004229	290
259	3300005539	Ga0068853_100027614	Ga0068853_1000276141	290
260	3300005539	Ga0068853_100038249	Ga0068853_1000382494	290
261	3300005539	Ga0068853_100138689	Ga0068853_1001386891	290
262	3300005539	Ga0068853_100180425	Ga0068853_1001804251	290
263	3300005543	Ga0070672_100242845	Ga0070672_1002428451	290
264	3300005544	Ga0070686_100074732	Ga0070686_1000747322	290
265	3300005544	Ga0070686_100116717	Ga0070686_1001167172	290
266	3300005547	Ga0070693_100088450	Ga0070693_1000884501	290
267	3300005563	Ga0068855_100000284	Ga0068855_10000028436	290
268	3300005563	Ga0068855_100047133	Ga0068855_1000471332	290
269	3300005564	Ga0070664_100177992	Ga0070664_1001779922	290
270	3300005564	Ga0070664_100334372	Ga0070664_1003343722	290
271	3300005577	Ga0068857_100039979	Ga0068857_1000399792	290
272	3300005577	Ga0068857_100058363	Ga0068857_1000583633	290
273	3300005577	Ga0068857_100077626	Ga0068857_1000776262	290
274	3300005578	Ga0068854_100148615	Ga0068854_1001486152	290
275	3300005578	Ga0068854_100202870	Ga0068854_1002028702	290
276	3300005614	Ga0068856_100021107	Ga0068856_1000211078	290
277	3300005614	Ga0068856_100266857	Ga0068856_1002668572	290
278	3300005616	Ga0068852_100004569	Ga0068852_1000045697	290
279	3300005616	Ga0068852_100005952	Ga0068852_1000059528	290
280	3300005616	Ga0068852_100052562	Ga0068852_1000525622	290
281	3300005616	Ga0068852_100248355	Ga0068852_1002483551	290
282	3300005616	Ga0068852_100477267	Ga0068852_1004772671	290
283	3300005617	Ga0068859_100000025	Ga0068859_10000002596	290
284	3300005617	Ga0068859_100000333	Ga0068859_10000033336	290
285	3300005617	Ga0068859_100037181	Ga0068859_1000371813	290
286	3300005617	Ga0068859_100097716	Ga0068859_1000977163	290
287	3300005617	Ga0068859_100224661	Ga0068859_1002246612	290
288	3300005617	Ga0068859_100254376	Ga0068859_1002543762	290
289	3300005617	Ga0068859_100319723	Ga0068859_1003197232	290
290	3300005618	Ga0068864_100011190	Ga0068864_1000111907	290
291	3300005618	Ga0068864_100031001	Ga0068864_1000310013	290
292	3300005618	Ga0068864_100125010	Ga0068864_1001250102	290
293	3300005718	Ga0068866_10003836	Ga0068866_100038365	290
294	3300005719	Ga0068861_100061051	Ga0068861_1000610513	290
295	3300005834	Ga0068851_10007997	Ga0068851_100079972	290
296	3300005840	Ga0068870_10036736	Ga0068870_100367362	290
297	3300005841	Ga0068863_100002841	Ga0068863_10000284115	290
298	3300005841	Ga0068863_100009555	Ga0068863_1000095558	290
299	3300005841	Ga0068863_100011473	Ga0068863_1000114733	290
300	3300005841	Ga0068863_100039654	Ga0068863_1000396545	290
301	3300005841	Ga0068863_100211538	Ga0068863_1002115381	290
302	3300005842	Ga0068858_100045256	Ga0068858_1000452562	290
303	3300005843	Ga0068860_100000061	Ga0068860_100000061158	290
304	3300005843	Ga0068860_100003010	Ga0068860_1000030105	290
305	3300005843	Ga0068860_100082322	Ga0068860_1000823222	290
306	3300005843	Ga0068860_100114924	Ga0068860_1001149244	290
307	3300005843	Ga0068860_100156586	Ga0068860_1001565863	290
308	3300005843	Ga0068860_100383726	Ga0068860_1003837262	290
309	3300005844	Ga0068862_100240092	Ga0068862_1002400922	290
310	3300005937	Ga0081455_10213299	Ga0081455_102132992	290
311	3300006195	Ga0075366_10018639	Ga0075366_100186392	290
312	3300006195	Ga0075366_10092347	Ga0075366_100923471	290
313	3300006195	Ga0075366_10155400	Ga0075366_101554002	290
314	3300006237	Ga0097621_100055128	Ga0097621_1000551283	290
315	3300006237	Ga0097621_100064176	Ga0097621_1000641763	290
316	3300006237	Ga0097621_100240554	Ga0097621_1002405542	290
317	3300006237	Ga0097621_100249915	Ga0097621_1002499152	290
318	3300006358	Ga0068871_100008210	Ga0068871_1000082103	290
319	3300006358	Ga0068871_100115398	Ga0068871_1001153982	290
320	3300006358	Ga0068871_100129479	Ga0068871_1001294791	290
321	3300006358	Ga0068871_100322387	Ga0068871_1003223871	290
322	3300006358	Ga0068871_100351653	Ga0068871_1003516531	290
323	3300006881	Ga0068865_100053551	Ga0068865_1000535513	290
324	3300006931	Ga0097620_100000025	Ga0097620_10000002596	290
325	3300006931	Ga0097620_100000333	Ga0097620_10000033336	290
326	3300006931	Ga0097620_100037181	Ga0097620_1000371813	290
327	3300006931	Ga0097620_100097715	Ga0097620_1000977153	290
328	3300006931	Ga0097620_100224664	Ga0097620_1002246643	290
329	3300006931	Ga0097620_100254382	Ga0097620_1002543822	290
330	3300006931	Ga0097620_100319708	Ga0097620_1003197082	290
331	3300009093	Ga0105240_10000198	Ga0105240_1000019849	290
332	3300009093	Ga0105240_10027122	Ga0105240_100271225	290
333	3300009093	Ga0105240_10065857	Ga0105240_100658574	290
334	3300009093	Ga0105240_10154049	Ga0105240_101540494	290
335	3300009093	Ga0105240_10378572	Ga0105240_103785722	290
336	3300009093	Ga0105240_10456035	Ga0105240_104560352	290
337	3300009094	Ga0111539_10191689	Ga0111539_101916891	290
338	3300009098	Ga0105245_10073893	Ga0105245_100738932	290
339	3300009101	Ga0105247_10002225	Ga0105247_1000222510	290
340	3300009174	Ga0105241_10002300	Ga0105241_1000230012	290
341	3300009174	Ga0105241_10083775	Ga0105241_100837752	290
342	3300009174	Ga0105241_10389270	Ga0105241_103892701	290
343	3300009176	Ga0105242_10015996	Ga0105242_100159963	290
344	3300009176	Ga0105242_10056033	Ga0105242_100560332	290
345	3300009176	Ga0105242_10162689	Ga0105242_101626892	290
346	3300009176	Ga0105242_10248656	Ga0105242_102486562	290
347	3300009545	Ga0105237_10000409	Ga0105237_1000040935	290
348	3300009545	Ga0105237_10005617	Ga0105237_100056179	290
349	3300009545	Ga0105237_10006807	Ga0105237_100068076	290
350	3300009545	Ga0105237_10052481	Ga0105237_100524812	290
351	3300009551	Ga0105238_10007301	Ga0105238_100073018	290
352	3300009551	Ga0105238_10062384	Ga0105238_100623842	290
353	3300009553	Ga0105249_10021479	Ga0105249_100214793	290
354	3300009553	Ga0105249_10023257	Ga0105249_100232574	290
355	3300009553	Ga0105249_10049926	Ga0105249_100499263	290
356	3300009553	Ga0105249_10112374	Ga0105249_101123742	290
357	3300010375	Ga0105239_10000343	Ga0105239_1000034361	290
358	3300010375	Ga0105239_10001227	Ga0105239_1000122728	290
359	3300010375	Ga0105239_10042514	Ga0105239_100425144	290
360	3300010375	Ga0105239_10053665	Ga0105239_100536652	290
361	3300010375	Ga0105239_10093829	Ga0105239_100938294	290
362	3300011119	Ga0105246_10032151	Ga0105246_100321513	290
363	3300013100	Ga0157373_10007794	Ga0157373_100077943	290
364	3300013100	Ga0157373_10230294	Ga0157373_102302941	290
365	3300013102	Ga0157371_10046454	Ga0157371_100464543	290
366	3300013104	Ga0157370_10002115	Ga0157370_100021156	290
367	3300013104	Ga0157370_10010926	Ga0157370_100109262	290
368	3300013105	Ga0157369_10023988	Ga0157369_100239886	290
369	3300013296	Ga0157374_10000011	Ga0157374_10000011169	290
370	3300013296	Ga0157374_10028328	Ga0157374_100283283	290
371	3300013296	Ga0157374_10046057	Ga0157374_100460572	290
372	3300013296	Ga0157374_10172868	Ga0157374_101728682	290
373	3300013297	Ga0157378_10002905	Ga0157378_1000290515	290
374	3300013297	Ga0157378_10012666	Ga0157378_100126665	290
375	3300013297	Ga0157378_10044839	Ga0157378_100448394	290
376	3300013297	Ga0157378_10120123	Ga0157378_101201233	290
377	3300013297	Ga0157378_10180875	Ga0157378_101808752	290
378	3300013297	Ga0157378_10216045	Ga0157378_102160452	290
379	3300013297	Ga0157378_10223040	Ga0157378_102230402	290
380	3300013297	Ga0157378_10352149	Ga0157378_103521491	290
381	3300013297	Ga0157378_10901627	Ga0157378_109016271	290
382	3300013306	Ga0163162_10000151	Ga0163162_1000015153	290
383	3300013306	Ga0163162_10000344	Ga0163162_100003448	290
384	3300013306	Ga0163162_10011601	Ga0163162_100116013	290
385	3300013306	Ga0163162_10393231	Ga0163162_103932311	290
386	3300013306	Ga0163162_10400165	Ga0163162_104001651	290
387	3300013307	Ga0157372_10125841	Ga0157372_101258413	290
388	3300013307	Ga0157372_10127461	Ga0157372_101274612	290
389	3300013307	Ga0157372_10216330	Ga0157372_102163303	290
390	3300013307	Ga0157372_10277134	Ga0157372_102771341	290
391	3300013307	Ga0157372_10509874	Ga0157372_105098741	290
392	3300013307	Ga0157372_10666623	Ga0157372_106666231	290
393	3300013307	Ga0157372_10933891	Ga0157372_109338911	290
394	3300013308	Ga0157375_10004190	Ga0157375_1000419011	290
395	3300013308	Ga0157375_10218267	Ga0157375_102182672	290
396	3300014325	Ga0163163_10090713	Ga0163163_100907133	290
397	3300014325	Ga0163163_10116980	Ga0163163_101169803	290
398	3300014325	Ga0163163_10189538	Ga0163163_101895381	290
399	3300014325	Ga0163163_10274408	Ga0163163_102744082	290
400	3300014325	Ga0163163_10357622	Ga0163163_103576222	290
401	3300014325	Ga0163163_10503692	Ga0163163_105036921	290
402	3300014326	Ga0157380_10004165	Ga0157380_100041658	290
403	3300014326	Ga0157380_10121024	Ga0157380_101210242	290
404	3300014326	Ga0157380_10184886	Ga0157380_101848861	290
405	3300014745	Ga0157377_10066796	Ga0157377_100667961	290
406	3300014745	Ga0157377_10234136	Ga0157377_102341361	290
407	3300014968	Ga0157379_10147775	Ga0157379_101477752	290
408	3300014969	Ga0157376_10003806	Ga0157376_1000380611	290
409	3300014969	Ga0157376_10037872	Ga0157376_100378722	290
410	3300014969	Ga0157376_10225958	Ga0157376_102259582	290
411	3300017792	Ga0163161_10022905	Ga0163161_100229052	290
412	3300017792	Ga0163161_10031415	Ga0163161_100314152	290
413	3300017792	Ga0163161_10034766	Ga0163161_100347663	290
414	3300017792	Ga0163161_10102000	Ga0163161_101020002	290
415	3300017792	Ga0163161_10246501	Ga0163161_102465011	290
416	3300025246	Ga0209646_1002933	Ga0209646_10029333	290
417	3300025302	Ga0207426_1000211	Ga0207426_100021168	290
418	3300025321	Ga0207656_10012744	Ga0207656_100127442	290
419	3300025893	Ga0207682_10098637	Ga0207682_100986372	290
420	3300025893	Ga0207682_10100061	Ga0207682_101000611	290
421	3300025903	Ga0207680_10000032	Ga0207680_1000003270	290
422	3300025903	Ga0207680_10193625	Ga0207680_101936252	290
423	3300025904	Ga0207647_10015067	Ga0207647_100150671	290
424	3300025904	Ga0207647_10169603	Ga0207647_101696031	290
425	3300025907	Ga0207645_10020806	Ga0207645_100208063	290
426	3300025907	Ga0207645_10047256	Ga0207645_100472562	290
427	3300025908	Ga0207643_10202892	Ga0207643_102028922	290
428	3300025909	Ga0207705_10190207	Ga0207705_101902071	290
429	3300025911	Ga0207654_10003193	Ga0207654_100031933	290
430	3300025912	Ga0207707_10172454	Ga0207707_101724541	290
431	3300025913	Ga0207695_10000313	Ga0207695_10000313102	290
432	3300025913	Ga0207695_10000346	Ga0207695_1000034647	290
433	3300025913	Ga0207695_10050880	Ga0207695_100508804	290
434	3300025913	Ga0207695_10054308	Ga0207695_100543082	290
435	3300025913	Ga0207695_10062575	Ga0207695_100625752	290
436	3300025914	Ga0207671_10000402	Ga0207671_1000040225	290
437	3300025914	Ga0207671_10001317	Ga0207671_1000131727	290
438	3300025914	Ga0207671_10002977	Ga0207671_1000297710	290
439	3300025914	Ga0207671_10013961	Ga0207671_100139614	290
440	3300025914	Ga0207671_10036676	Ga0207671_100366764	290
441	3300025918	Ga0207662_10066259	Ga0207662_100662592	290
442	3300025919	Ga0207657_10004720	Ga0207657_100047205	290
443	3300025921	Ga0207652_10102840	Ga0207652_101028403	290
444	3300025923	Ga0207681_10069963	Ga0207681_100699633	290
445	3300025923	Ga0207681_10181955	Ga0207681_101819552	290
446	3300025924	Ga0207694_10006626	Ga0207694_100066263	290
447	3300025924	Ga0207694_10293829	Ga0207694_102938291	290
448	3300025925	Ga0207650_10309073	Ga0207650_103090732	290
449	3300025925	Ga0207650_10392873	Ga0207650_103928731	290
450	3300025926	Ga0207659_10346646	Ga0207659_103466463	290
451	3300025927	Ga0207687_10162263	Ga0207687_101622632	290
452	3300025934	Ga0207686_10007658	Ga0207686_100076584	290
453	3300025936	Ga0207670_10000687	Ga0207670_1000068718	290
454	3300025938	Ga0207704_10317372	Ga0207704_103173722	290
455	3300025940	Ga0207691_10050794	Ga0207691_100507943	290
456	3300025940	Ga0207691_10070418	Ga0207691_100704184	290
457	3300025940	Ga0207691_10164457	Ga0207691_101644571	290
458	3300025940	Ga0207691_10224890	Ga0207691_102248901	290
459	3300025940	Ga0207691_10310181	Ga0207691_103101811	290
460	3300025942	Ga0207689_10013487	Ga0207689_100134875	290
461	3300025942	Ga0207689_10014027	Ga0207689_100140276	290
462	3300025942	Ga0207689_10065690	Ga0207689_100656903	290
463	3300025942	Ga0207689_10095473	Ga0207689_100954732	290
464	3300025942	Ga0207689_10114825	Ga0207689_101148251	290
465	3300025944	Ga0207661_10262985	Ga0207661_102629852	290
466	3300025945	Ga0207679_10041903	Ga0207679_100419031	290
467	3300025949	Ga0207667_10006159	Ga0207667_100061593	290
468	3300025949	Ga0207667_10179079	Ga0207667_101790792	290
469	3300025949	Ga0207667_10196837	Ga0207667_101968372	290
470	3300025960	Ga0207651_10011668	Ga0207651_100116682	290
471	3300025960	Ga0207651_10077507	Ga0207651_100775073	290
472	3300025960	Ga0207651_10084359	Ga0207651_100843593	290
473	3300025960	Ga0207651_10099925	Ga0207651_100999252	290
474	3300025960	Ga0207651_10190099	Ga0207651_101900991	290
475	3300025961	Ga0207712_10006471	Ga0207712_100064716	290
476	3300025961	Ga0207712_10010020	Ga0207712_100100202	290
477	3300025961	Ga0207712_10066018	Ga0207712_100660183	290
478	3300025961	Ga0207712_10118404	Ga0207712_101184041	290
479	3300025972	Ga0207668_10234938	Ga0207668_102349382	290
480	3300025981	Ga0207640_10179777	Ga0207640_101797772	290
481	3300025986	Ga0207658_10022886	Ga0207658_100228862	290
482	3300025986	Ga0207658_10302059	Ga0207658_103020592	290
483	3300026023	Ga0207677_10003307	Ga0207677_100033075	290
484	3300026023	Ga0207677_10079398	Ga0207677_100793981	290
485	3300026023	Ga0207677_10221248	Ga0207677_102212481	290
486	3300026035	Ga0207703_10051094	Ga0207703_100510943	290
487	3300026041	Ga0207639_10100899	Ga0207639_101008991	290
488	3300026041	Ga0207639_10161842	Ga0207639_101618423	290
489	3300026041	Ga0207639_10444145	Ga0207639_104441451	290
490	3300026041	Ga0207639_10463400	Ga0207639_104634001	290
491	3300026075	Ga0207708_10032194	Ga0207708_100321943	290
492	3300026078	Ga0207702_10080465	Ga0207702_100804654	290
493	3300026078	Ga0207702_10217787	Ga0207702_102177871	290
494	3300026088	Ga0207641_10000111	Ga0207641_1000011128	290
495	3300026088	Ga0207641_10000661	Ga0207641_1000066137	290
496	3300026088	Ga0207641_10033650	Ga0207641_100336503	290
497	3300026088	Ga0207641_10070217	Ga0207641_100702173	290
498	3300026088	Ga0207641_10179755	Ga0207641_101797553	290
499	3300026088	Ga0207641_10209917	Ga0207641_102099171	290
500	3300026089	Ga0207648_10002777	Ga0207648_100027779	290
501	3300026089	Ga0207648_10060891	Ga0207648_100608912	290
502	3300026089	Ga0207648_10082006	Ga0207648_100820061	290
503	3300026089	Ga0207648_10176774	Ga0207648_101767742	290
504	3300026089	Ga0207648_10199466	Ga0207648_101994662	290
505	3300026095	Ga0207676_10023886	Ga0207676_100238864	290
506	3300026095	Ga0207676_10065397	Ga0207676_100653973	290
507	3300026095	Ga0207676_10093940	Ga0207676_100939402	290
508	3300026095	Ga0207676_10230035	Ga0207676_102300352	290
509	3300026116	Ga0207674_10048957	Ga0207674_100489572	290
510	3300026116	Ga0207674_10095134	Ga0207674_100951342	290
511	3300026116	Ga0207674_10107427	Ga0207674_101074271	290
512	3300026118	Ga0207675_100109379	Ga0207675_1001093793	290
513	3300026121	Ga0207683_10068803	Ga0207683_100688033	290
514	3300026121	Ga0207683_10132424	Ga0207683_101324241	290
515	3300026121	Ga0207683_10312746	Ga0207683_103127462	290
516	3300026142	Ga0207698_10003425	Ga0207698_100034258	290
517	3300026142	Ga0207698_10046965	Ga0207698_100469655	290
518	3300026142	Ga0207698_10424121	Ga0207698_104241211	290
519	3300027907	Ga0207428_10407325	Ga0207428_104073252	290
520	3300028379	Ga0268266_10000068	Ga0268266_1000006872	290
521	3300028380	Ga0268265_10344632	Ga0268265_103446322	290
522	3300028381	Ga0268264_10000079	Ga0268264_1000007926	290
523	3300028381	Ga0268264_10002203	Ga0268264_1000220313	290
524	3300028381	Ga0268264_10004438	Ga0268264_100044382	290
525	3300028381	Ga0268264_10008001	Ga0268264_100080017	290
526	3300028381	Ga0268264_10078043	Ga0268264_100780433	290
527	3300028381	Ga0268264_10622846	Ga0268264_106228461	290
528	3300028786	Ga0307517_10002947	Ga0307517_1000294712	290
529	3300028786	Ga0307517_10266897	Ga0307517_102668971	290
530	3300028794	Ga0307515_10000001	Ga0307515_100000013531	290
531	3300028794	Ga0307515_10000162	Ga0307515_1000016297	290
532	3300030521	Ga0307511_10002426	Ga0307511_100024266	290
533	3300031251	Ga0265327_10000211	Ga0265327_1000021150	290
534	3300031251	Ga0265327_10000511	Ga0265327_1000051146	290
535	3300031456	Ga0307513_10011825	Ga0307513_100118259	290
536	3300031456	Ga0307513_10030364	Ga0307513_100303646	290
537	3300031507	Ga0307509_10025814	Ga0307509_100258144	290
538	3300031507	Ga0307509_10131536	Ga0307509_101315362	290
539	3300031507	Ga0307509_10207190	Ga0307509_102071902	290
540	3300031616	Ga0307508_10000686	Ga0307508_1000068614	290
541	3300031728	Ga0316578_10045193	Ga0316578_100451932	290
542	3300031730	Ga0307516_10003590	Ga0307516_1000359020	290
543	3300031838	Ga0307518_10163597	Ga0307518_101635972	290
544	3300033180	Ga0307510_10009449	Ga0307510_100094492	290
545	3300036647	Ga0316582_0047235	Ga0316582_0047235_1034_1924	290
546	3300036712	Ga0316584_0000921	Ga0316584_0000921_1402_2292	290
547	3300039062	Ga0400483_213583	Ga0400483_213583_1099_2004	290
548	3300041406	Ga0439439_0023499	Ga0439439_0023499_113_991	290
549	3300041463	Ga0451804_1163584	Ga0451804_1163584_388_1266	290
550	3300042005	Ga0439448_0024728	Ga0439448_0024728_155_1030	290
551	3300042014	Ga0439457_007741	Ga0439457_007741_51_929	290
552	3300042015	Ga0439462_0000316	Ga0439462_0000316_6971_7849	290
553	3300042876	Ga0451577_0010418	Ga0451577_0010418_6092_6973	290
554	3300042876	Ga0451577_0077486	Ga0451577_0077486_1481_2359	290
555	3300042876	Ga0451577_0185511	Ga0451577_0185511_887_1786	290
556	3300044658	Ga0466972_0000026	Ga0466972_0000026_128484_129362	290
557	3300044658	Ga0466972_0000047	Ga0466972_0000047_70592_71617	290
558	3300044673	Ga0453683_0057182	Ga0453683_0057182_1361_2251	290
559	3300044684	Ga0466966_0000047	Ga0466966_0000047_59172_60050	290
560	3300044712	Ga0453684_0000630	Ga0453684_0000630_15547_16437	290
561	3300044712	Ga0453684_0006379	Ga0453684_0006379_3761_4651	290
562	3300044712	Ga0453684_0553105	Ga0453684_0553105_344_1243	290
563	3300044842	Ga0466957_0000937	Ga0466957_0000937_4839_5717	290
564	3300044842	Ga0466957_0023370	Ga0466957_0023370_1856_2734	290
565	3300045049	Ga0466959_0000065	Ga0466959_0000065_50248_51126	290
566	3300045051	Ga0451576_0082645	Ga0451576_0082645_1368_2258	290
567	3300045976	Ga0466967_0129114	Ga0466967_0129114_946_1830	290
568	3300046460	Ga0495638_0194535	Ga0495638_0194535_158_1036	290
569	3300046507	Ga0495606_0065493	Ga0495606_0065493_1239_2120	290
570	3300046524	Ga0495648_0003925	Ga0495648_0003925_8787_9665	290
571	3300046616	Ga0495668_0001854	Ga0495668_0001854_15646_16524	290
572	3300046648	Ga0495611_0000435	Ga0495611_0000435_15555_16436	290
573	3300046660	Ga0495625_0097770	Ga0495625_0097770_405_1283	290
574	3300046694	Ga0495649_0118345	Ga0495649_0118345_438_1316	290
575	3300046809	Ga0495600_0090666	Ga0495600_0090666_560_1438	290
576	3300047320	Ga0495672_0013953	Ga0495672_0013953_4276_5157	290
577	3300047320	Ga0495672_0042036	Ga0495672_0042036_1426_2304	290
578	3300047472	Ga0495686_0000005	Ga0495686_0000005_374198_375073	290
579	3300048908	Ga0496105_0104890	Ga0496105_0104890_252_1130	290
580	3300049581	Ga0501047_0104968	Ga0501047_0104968_793_1671	290
581	3300049581	Ga0501047_0197800	Ga0501047_0197800_746_1624	290
582	3300049582	Ga0501048_0210764	Ga0501048_0210764_90_968	290
583	3300049703	Ga0501219_001286	Ga0501219_001286_283_1161	290
584	3300049742	Ga0501080_0071157	Ga0501080_0071157_223_1101	290
585	3300049758	Ga0501241_006354	Ga0501241_006354_693_1571	290
586	3300050005	Ga0501284_00017	Ga0501284_00017_780_1658	290
587	3300050493	nmdc:mga0k408_100822_c1	nmdc:mga0k408_100822_c1_330_1208	290
588	3300050493	nmdc:mga0k408_15433_c1	nmdc:mga0k408_15433_c1_1556_2434	290
589	3300050493	nmdc:mga0k408_35592_c1	nmdc:mga0k408_35592_c1_1758_2636	290
590	3300050493	nmdc:mga0k408_56925_c1	nmdc:mga0k408_56925_c1_1298_2176	290
591	3300050493	nmdc:mga0k408_84507_c1	nmdc:mga0k408_84507_c1_192_1070	290
592	3300050511	nmdc:mga08y16_216100_c1	nmdc:mga08y16_216100_c1_617_1495	290
593	3300053086	Ga0500578_0000765	Ga0500578_0000765_18160_19038	290
594	3300053086	Ga0500578_0071393	Ga0500578_0071393_756_1634	290
595	3300053090	Ga0500646_0005187	Ga0500646_0005187_1179_2057	290
596	3300053092	Ga0500583_0000003	Ga0500583_0000003_72951_73829	290
597	3300053092	Ga0500583_0000114	Ga0500583_0000114_690_1568	290
598	3300053092	Ga0500583_0008462	Ga0500583_0008462_1982_2860	290
599	3300053096	Ga0500641_0008479	Ga0500641_0008479_2293_3174	290
600	3300053103	Ga0500555_002160	Ga0500555_002160_3056_3934	290
601	3300053104	Ga0500556_0016645	Ga0500556_0016645_304_1182	290
602	3300053108	Ga0500562_000005	Ga0500562_000005_133914_134807	290
603	3300053118	Ga0500594_0021515	Ga0500594_0021515_501_1379	290
604	3300053118	Ga0500594_0045709	Ga0500594_0045709_320_1198	290
605	3300053130	Ga0500642_0006418	Ga0500642_0006418_1653_2531	290
606	3300053146	Ga0500588_0039119	Ga0500588_0039119_81_956	290
607	3300053151	Ga0500604_0004024	Ga0500604_0004024_1414_2292	290
608	3300053151	Ga0500604_0022003	Ga0500604_0022003_619_1497	290
609	3300053153	Ga0500616_0003349	Ga0500616_0003349_8102_8986	290
610	3300053153	Ga0500616_0076556	Ga0500616_0076556_541_1434	290
611	3300053156	Ga0500622_0000143	Ga0500622_0000143_32245_33126	290
612	3300053156	Ga0500622_0017523	Ga0500622_0017523_547_1425	290
613	3300053156	Ga0500622_0020789	Ga0500622_0020789_672_1550	290
614	3300053156	Ga0500622_0046969	Ga0500622_0046969_236_1114	290
615	3300053156	Ga0500622_0070691	Ga0500622_0070691_333_1211	290
616	3300053727	Ga0500611_000155	Ga0500611_000155_4424_5302	290
617	3300053727	Ga0500611_009192	Ga0500611_009192_194_1072	290
618	3300053730	Ga0500645_007324	Ga0500645_007324_2907_3800	290
619	3300055283	Ga0500661_008754	Ga0500661_008754_246_1121	290
620	3300003320	rootH2_10010709	rootH2_100107095	291
621	3300031730	Ga0307516_10109739	Ga0307516_101097393	291
622	3300044712	Ga0453684_0187942	Ga0453684_0187942_527_1411	291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

54

91

0.98 PF13411

MerR_1

MerR HTH family regulatory protein

53

122

0.96 PF02607

B12-binding_2

B12 binding domain

140

211

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7tea-assembly2.cif.gz_C	crystal structure of s. aureus glnr-dna complex	0.9206	1	68
4r4e-assembly1.cif.gz_A	structure of glnr-dna complex	0.869	1	67
5cjv-assembly1.cif.gz_B	isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate isovaleryl-coenzyme a	0.8245	173	290
4r4e-assembly1.cif.gz_B	structure of glnr-dna complex	0.8157	1	81
5cjw-assembly1.cif.gz_A	isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate pivalyl-coenzyme a	0.8116	171	290

ID	Description	Score	Start	End	Superfamily
af_P33358_1_73_1.10.1660.10	Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2;	0.9567	1	66	1.10.1660.10
af_O06302_4_79_1.10.1660.10	Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2;	0.8977	2	68	1.10.1660.10
5i44J00	Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2;	0.8893	1	65	1.10.1660.10
4r4eA00	Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2;	0.869	1	67	1.10.1660.10
af_P33358_1_73_1.10.1660.10	Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2;	0.8575	1	66	1.10.1660.10

ID	Description	Score	Start	End	GO Terms
AF-A0A3D1BG22-F1-model_v4	HTH merR-type domain-containing protein	0.9094	3	84	GO:0003677 GO:0003700
AF-A0A5B8UHN5-F1-model_v4	MerR family transcriptional regulator	0.9092	1	291	GO:0003677 GO:0006355
AF-A0A5B8UHN5-F1-model_v4	MerR family transcriptional regulator	0.8974	1	291	GO:0003677 GO:0006355
AF-A0A4Q3T335-F1-model_v4	deleted	0.8793	168	290
AF-A0A3N5HMQ9-F1-model_v4	B12-binding domain-containing protein	0.8627	146	291	GO:0031419 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
90.35	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F470125

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00376

MerR

MerR family regulatory protein

54

91

0.98

PF13411

MerR_1

MerR HTH family regulatory protein

53

122

0.96

PF02607

B12-binding_2

B12 binding domain

140

211

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map