F470093

General Info

Members Datasets Scaffolds Average Seq Length
622 259 1244 282

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10015432|Ga0105248_100154323
Length 329
Sequence MTIVFANSFTKQLLGQARGIAFQLSEQRPAAQHEKIVKIIGSRMRPKPRISPDLEDHRDASWCREGTRQIATPFDAERFIEQLGFAACLTDSRRPGPSLYVAVCGRRDAVMPRNVQKDPEASLTWQLKDEILRRGQVYYGKLARGKATFLAARMIPYFHAVWGMRRSEEKRRLSKNAKAILKVLRREWEMATPDLREESGVADRAAFTRAIDELQAAMIVVPSEVVYVPKFTYIWTLGIGRFPDALMRRVSRETALREIARAFLAGAGMTIPGELARVTGLSRRDAGLGNRALVAEGCATSPATGVYYASPALYNASSLPHARSASALL

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.98
Nodule 0
Rhizoplane 3.05
Rhizosphere 91.48
Stem 0
Stem Tuber 0
Unclassified 18.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10015432 3300009177 Bacteria 8421
2 JGI25406J46586_10005698 3300003203 Bacteria 5758
3 JGI25406J46586_10012296 3300003203 Bacteria 3721
4 JGI25406J46586_10072706 3300003203 Unclassified 1074
5 Ga0065712_10077673 3300005290 Unclassified 3459
6 Ga0065712_10083295 3300005290 Bacteria 2849
7 Ga0065712_10086645 3300005290 Bacteria 2623
8 Ga0065715_10090263 3300005293 Bacteria 7328
9 Ga0065715_10132727 3300005293 Bacteria 1985
10 Ga0065707_10007056 3300005295 Bacteria 2797
11 Ga0065707_10011639 3300005295 Unclassified 2328
12 Ga0065707_10145027 3300005295 Bacteria 1725
13 Ga0070676_10001882 3300005328 Bacteria 10664
14 Ga0070690_100076364 3300005330 Bacteria 2186
15 Ga0070670_100017062 3300005331 Bacteria 6231
16 Ga0070670_100091727 3300005331 Bacteria 2612
17 Ga0070670_100122954 3300005331 Bacteria 2239
18 Ga0070677_10009972 3300005333 Bacteria 3235
19 Ga0068869_100000617 3300005334 Bacteria 20128
20 Ga0070666_10173028 3300005335 Bacteria 1513
21 Ga0070682_100077591 3300005337 Bacteria 2141
22 Ga0068868_100324092 3300005338 Bacteria 1313
23 Ga0068868_100479133 3300005338 Bacteria 1087
24 Ga0070660_100015335 3300005339 Bacteria 5531
25 Ga0070689_100151852 3300005340 Bacteria 1868
26 Ga0070691_10100604 3300005341 Bacteria 1435
27 Ga0070661_100076068 3300005344 Bacteria 2474
28 Ga0070661_100077228 3300005344 Bacteria 2455
29 Ga0070692_10045548 3300005345 Unclassified 2263
30 Ga0070668_100040024 3300005347 Bacteria 3586
31 Ga0070668_100293942 3300005347 Bacteria 1361
32 Ga0070669_100001341 3300005353 Bacteria 17730
33 Ga0070669_100055819 3300005353 Bacteria 2894
34 Ga0070669_100062773 3300005353 Bacteria 2733
35 Ga0070669_100079399 3300005353 Bacteria 2440
36 Ga0070669_100390355 3300005353 Unclassified 1137
37 Ga0070675_100000862 3300005354 Bacteria 21579
38 Ga0070675_100002674 3300005354 Bacteria 13397
39 Ga0070675_100006377 3300005354 Bacteria 9057
40 Ga0070675_100022773 3300005354 Bacteria 5006
41 Ga0070675_100038409 3300005354 Bacteria 3902
42 Ga0070675_100091488 3300005354 Bacteria 2549
43 Ga0070675_100216903 3300005354 Bacteria 1665
44 Ga0070671_100094587 3300005355 Bacteria 2505
45 Ga0070674_100006480 3300005356 Bacteria 6834
46 Ga0070674_100028096 3300005356 Bacteria 3692
47 Ga0070673_100016724 3300005364 Bacteria 5196
48 Ga0070673_100022451 3300005364 Bacteria 4593
49 Ga0070673_100074866 3300005364 Bacteria 2729
50 Ga0070673_100126517 3300005364 Bacteria 2139
51 Ga0070673_100308911 3300005364 Unclassified 1394
52 Ga0070688_100012769 3300005365 Bacteria 4716
53 Ga0070688_100064965 3300005365 Bacteria 2317
54 Ga0070688_100104214 3300005365 Bacteria 1875
55 Ga0070688_100298203 3300005365 Bacteria 1164
56 Ga0070659_100033151 3300005366 Unclassified 4010
57 Ga0070659_100038608 3300005366 Bacteria 3725
58 Ga0070667_100027806 3300005367 Bacteria 4706
59 Ga0070667_100122006 3300005367 Unclassified 2267
60 Ga0070667_100246426 3300005367 Bacteria 1597
61 Ga0070703_10033037 3300005406 Bacteria 1574
62 Ga0070713_100004753 3300005436 Bacteria 9186
63 Ga0070701_10001097 3300005438 Bacteria 9880
64 Ga0070701_10118220 3300005438 Bacteria 1490
65 Ga0070705_100000627 3300005440 Bacteria 20377
66 Ga0070700_100176237 3300005441 Unclassified 1484
67 Ga0070694_100022821 3300005444 Bacteria 4015
68 Ga0070694_100247272 3300005444 Bacteria 1348
69 Ga0070708_100155496 3300005445 Bacteria 2129
70 Ga0070663_100035425 3300005455 Bacteria 3464
71 Ga0070678_100034364 3300005456 Bacteria 3530
72 Ga0070678_100060921 3300005456 Bacteria 2780
73 Ga0070678_100124992 3300005456 Unclassified 2035
74 Ga0070662_100292487 3300005457 Bacteria 1321
75 Ga0070662_100448038 3300005457 Unclassified 1071
76 Ga0070681_10040179 3300005458 Unclassified 4689
77 Ga0068867_100014302 3300005459 Bacteria 5622
78 Ga0068867_100102407 3300005459 Bacteria 2189
79 Ga0068867_100191808 3300005459 Unclassified 1631
80 Ga0068867_100266228 3300005459 Bacteria 1399
81 Ga0070685_10189955 3300005466 Bacteria 1328
82 Ga0070707_100042102 3300005468 Bacteria 4371
83 Ga0070707_100073971 3300005468 Unclassified 3285
84 Ga0070707_100137070 3300005468 Bacteria 2381
85 Ga0070698_100003797 3300005471 Bacteria 16594
86 Ga0070698_100098859 3300005471 Bacteria 2892
87 Ga0070698_100154092 3300005471 Unclassified 2244
88 Ga0070698_100583752 3300005471 Bacteria 1058
89 Ga0070699_100002749 3300005518 Bacteria 15693
90 Ga0070699_100025075 3300005518 Bacteria 5142
91 Ga0070699_100163527 3300005518 Unclassified 1971
92 Ga0070684_100090960 3300005535 Bacteria 2714
93 Ga0070684_100236311 3300005535 Bacteria 1669
94 Ga0070684_100442415 3300005535 Bacteria 1201
95 Ga0070697_100040175 3300005536 Bacteria 3783
96 Ga0070697_100077691 3300005536 Bacteria 2731
97 Ga0070672_100063977 3300005543 Bacteria 2906
98 Ga0070672_100124083 3300005543 Bacteria 2117
99 Ga0070672_100225784 3300005543 Bacteria 1572
100 Ga0070695_100001243 3300005545 Bacteria 14004
101 Ga0070695_100069484 3300005545 Bacteria 2302
102 Ga0070665_100006178 3300005548 Bacteria 12251
103 Ga0070665_100330421 3300005548 Bacteria 1529
104 Ga0070704_100087102 3300005549 Unclassified 2317
105 Ga0070704_100150227 3300005549 Bacteria 1830
106 Ga0070704_100237856 3300005549 Bacteria 1489
107 Ga0068855_100189726 3300005563 Unclassified 2319
108 Ga0068855_100313333 3300005563 Bacteria 1735
109 Ga0068855_100324446 3300005563 Bacteria 1701
110 Ga0068855_100371321 3300005563 Unclassified 1572
111 Ga0070664_100082140 3300005564 Bacteria 2778
112 Ga0070664_100121589 3300005564 Unclassified 2287
113 Ga0070664_100265210 3300005564 Bacteria 1546
114 Ga0070664_100292689 3300005564 Bacteria 1470
115 Ga0068857_100028222 3300005577 Bacteria 4952
116 Ga0068857_100058786 3300005577 Unclassified 3415
117 Ga0068857_100116471 3300005577 Bacteria 2404
118 Ga0068854_100115344 3300005578 Bacteria 2032
119 Ga0068854_100164057 3300005578 Bacteria 1723
120 Ga0068856_100118589 3300005614 Bacteria 2647
121 Ga0068856_100380828 3300005614 Bacteria 1430
122 Ga0070702_100084610 3300005615 Bacteria 1908
123 Ga0070702_100349437 3300005615 Bacteria 1041
124 Ga0068859_100008260 3300005617 Bacteria 10555
125 Ga0068859_100016183 3300005617 Bacteria 7491
126 Ga0068859_100018385 3300005617 Bacteria 7026
127 Ga0068859_100023566 3300005617 Bacteria 6178
128 Ga0068859_100108159 3300005617 Bacteria 2842
129 Ga0068859_100803618 3300005617 Bacteria 1028
130 Ga0068864_100027211 3300005618 Bacteria 4827
131 Ga0068864_100071452 3300005618 Unclassified 3022
132 Ga0068861_100043805 3300005719 Bacteria 3362
133 Ga0068861_100173028 3300005719 Bacteria 1791
134 Ga0068851_10002491 3300005834 Bacteria 8095
135 Ga0068870_10067432 3300005840 Bacteria 1941
136 Ga0068863_100156499 3300005841 Bacteria 2182
137 Ga0068863_100516538 3300005841 Bacteria 1177
138 Ga0068858_100028239 3300005842 Bacteria 5213
139 Ga0068858_100046609 3300005842 Bacteria 4018
140 Ga0068858_100067110 3300005842 Bacteria 3322
141 Ga0068858_100450096 3300005842 Unclassified 1241
142 Ga0068858_100566110 3300005842 Bacteria 1101
143 Ga0068860_100015393 3300005843 Bacteria 7474
144 Ga0068860_100037873 3300005843 Bacteria 4616
145 Ga0068860_100124291 3300005843 Bacteria 2473
146 Ga0068860_100690397 3300005843 Unclassified 1030
147 Ga0068862_100009172 3300005844 Bacteria 8194
148 Ga0068862_100033773 3300005844 Bacteria 4327
149 Ga0068862_100055257 3300005844 Unclassified 3401
150 Ga0068862_100076795 3300005844 Bacteria 2891
151 Ga0068862_100148207 3300005844 Bacteria 2087
152 Ga0068862_100283104 3300005844 Bacteria 1520
153 Ga0068862_100350162 3300005844 Unclassified 1370
154 Ga0081539_10000013 3300005985 Bacteria 432395
155 Ga0081539_10000164 3300005985 Bacteria 154639
156 Ga0081539_10002616 3300005985 Bacteria 24630
157 Ga0075365_10006103 3300006038 Bacteria 6586
158 Ga0075365_10062235 3300006038 Bacteria 2495
159 Ga0075368_10037475 3300006042 Unclassified 1896
160 Ga0075368_10123669 3300006042 Bacteria 1073
161 Ga0075364_10002388 3300006051 Bacteria 10531
162 Ga0075364_10006995 3300006051 Bacteria 6664
163 Ga0075364_10063932 3300006051 Bacteria 2416
164 Ga0075364_10284101 3300006051 Bacteria 1126
165 Ga0075364_10384074 3300006051 Bacteria 958
166 Ga0075367_10016452 3300006178 Bacteria 4038
167 Ga0075367_10092575 3300006178 Unclassified 1840
168 Ga0075367_10146468 3300006178 Bacteria 1465
169 Ga0075366_10006305 3300006195 Bacteria 6488
170 Ga0075366_10017088 3300006195 Unclassified 4171
171 Ga0075366_10036147 3300006195 Bacteria 2912
172 Ga0097621_100118577 3300006237 Unclassified 2243
173 Ga0097621_100431927 3300006237 Bacteria 1184
174 Ga0075370_10005341 3300006353 Bacteria 6372
175 Ga0068871_100019081 3300006358 Bacteria 5229
176 Ga0075428_100007610 3300006844 Bacteria 12007
177 Ga0075428_100120761 3300006844 Unclassified 2853
178 Ga0075428_100616698 3300006844 Bacteria 1158
179 Ga0075430_100200513 3300006846 Unclassified 1657
180 Ga0075431_100017564 3300006847 Bacteria 7273
181 Ga0075431_100209551 3300006847 Unclassified 1991
182 Ga0075431_100284419 3300006847 Bacteria 1674
183 Ga0075431_100362358 3300006847 Bacteria 1456
184 Ga0075431_100574303 3300006847 Bacteria 1113
185 Ga0075433_10005015 3300006852 Bacteria 10370
186 Ga0075433_10016110 3300006852 Bacteria 6149
187 Ga0075433_10017448 3300006852 Bacteria 5945
188 Ga0075433_10037168 3300006852 Bacteria 4198
189 Ga0075433_10075447 3300006852 Unclassified 2967
190 Ga0075433_10077139 3300006852 Unclassified 2935
191 Ga0075433_10077965 3300006852 Bacteria 2919
192 Ga0075433_10138509 3300006852 Bacteria 2163
193 Ga0075433_10198674 3300006852 Bacteria 1783
194 Ga0075433_10531845 3300006852 Unclassified 1034
195 Ga0075434_100000328 3300006871 Bacteria 34123
196 Ga0075434_100002588 3300006871 Bacteria 15973
197 Ga0075434_100007278 3300006871 Bacteria 10238
198 Ga0075434_100010351 3300006871 Bacteria 8741
199 Ga0075434_100012709 3300006871 Bacteria 7987
200 Ga0075434_100115519 3300006871 Bacteria 2697
201 Ga0075434_100152969 3300006871 Unclassified 2327
202 Ga0075434_100221019 3300006871 Bacteria 1914
203 Ga0075434_100290731 3300006871 Bacteria 1654
204 Ga0075434_100797973 3300006871 Unclassified 960
205 Ga0075429_100049180 3300006880 Bacteria 3666
206 Ga0075429_100124412 3300006880 Unclassified 2255
207 Ga0075429_100215576 3300006880 Bacteria 1682
208 Ga0075429_100294925 3300006880 Unclassified 1420
209 Ga0068865_100000895 3300006881 Bacteria 16908
210 Ga0068865_100048271 3300006881 Bacteria 2929
211 Ga0068865_100243086 3300006881 Unclassified 1417
212 Ga0075436_100003879 3300006914 Bacteria 10247
213 Ga0075436_100015032 3300006914 Bacteria 5304
214 Ga0075436_100124514 3300006914 Unclassified 1805
215 Ga0075436_100280617 3300006914 Unclassified 1191
216 Ga0097620_100008260 3300006931 Bacteria 10555
217 Ga0097620_100016183 3300006931 Bacteria 7491
218 Ga0097620_100018386 3300006931 Bacteria 7026
219 Ga0097620_100023566 3300006931 Bacteria 6178
220 Ga0097620_100108150 3300006931 Bacteria 2842
221 Ga0097620_100803704 3300006931 Bacteria 1028
222 Ga0075435_100000032 3300007076 Bacteria 71881
223 Ga0075435_100013286 3300007076 Bacteria 6119
224 Ga0075435_100014715 3300007076 Bacteria 5862
225 Ga0075435_100037835 3300007076 Bacteria 3845
226 Ga0075435_100067628 3300007076 Unclassified 2909
227 Ga0075435_100326128 3300007076 Unclassified 1314
228 Ga0105240_10063116 3300009093 Bacteria 4609
229 Ga0105240_10101141 3300009093 Unclassified 3507
230 Ga0105240_10150392 3300009093 Unclassified 2774
231 Ga0111539_10001097 3300009094 Bacteria 35758
232 Ga0111539_10001694 3300009094 Bacteria 29381
233 Ga0111539_10002024 3300009094 Bacteria 27072
234 Ga0111539_10010685 3300009094 Bacteria 11561
235 Ga0111539_10017051 3300009094 Bacteria 8990
236 Ga0111539_10081166 3300009094 Bacteria 3815
237 Ga0111539_10129472 3300009094 Bacteria 2955
238 Ga0111539_10138107 3300009094 Bacteria 2855
239 Ga0111539_10270264 3300009094 Bacteria 1979
240 Ga0105245_10106929 3300009098 Bacteria 2597
241 Ga0105245_10245355 3300009098 Bacteria 1738
242 Ga0105245_10381717 3300009098 Bacteria 1403
243 Ga0114129_10000797 3300009147 Bacteria 40445
244 Ga0114129_10005902 3300009147 Bacteria 17323
245 Ga0114129_10020055 3300009147 Bacteria 9514
246 Ga0114129_10042246 3300009147 Bacteria 6418
247 Ga0114129_10090635 3300009147 Bacteria 4238
248 Ga0114129_10098605 3300009147 Bacteria 4045
249 Ga0114129_10119868 3300009147 Bacteria 3623
250 Ga0114129_10126275 3300009147 Unclassified 3517
251 Ga0114129_10151342 3300009147 Unclassified 3175
252 Ga0114129_10198191 3300009147 Bacteria 2721
253 Ga0114129_10798970 3300009147 Bacteria 1204
254 Ga0114129_10820471 3300009147 Bacteria 1185
255 Ga0114129_10831124 3300009147 Bacteria 1176
256 Ga0114129_11065512 3300009147 Bacteria 1014
257 Ga0105243_10010646 3300009148 Bacteria 6976
258 Ga0105243_10116892 3300009148 Bacteria 2241
259 Ga0105241_10345038 3300009174 Bacteria 1291
260 Ga0105242_10005223 3300009176 Bacteria 10025
261 Ga0105242_10006077 3300009176 Bacteria 9311
262 Ga0105242_10098699 3300009176 Bacteria 2470
263 Ga0105248_10003322 3300009177 Bacteria 17856
264 Ga0105248_10006608 3300009177 Bacteria 12706
265 Ga0105248_10086152 3300009177 Bacteria 3535
266 Ga0105248_10224602 3300009177 Bacteria 2114
267 Ga0105248_10234292 3300009177 Unclassified 2067
268 Ga0105248_10305470 3300009177 Bacteria 1792
269 Ga0105248_10348805 3300009177 Unclassified 1666
270 Ga0105248_10353099 3300009177 Bacteria 1655
271 Ga0105248_10610552 3300009177 Bacteria 1230
272 Ga0105237_10127912 3300009545 Bacteria 2534
273 Ga0105249_10000452 3300009553 Bacteria 38667
274 Ga0105249_10062954 3300009553 Bacteria 3407
275 Ga0105249_10274249 3300009553 Unclassified 1681
276 Ga0105249_10577509 3300009553 Bacteria 1177
277 Ga0105249_10886534 3300009553 Unclassified 959
278 Ga0163162_10017416 3300013306 Bacteria 7028
279 Ga0157375_10055666 3300013308 Bacteria 3901
280 Ga0157375_10075454 3300013308 Bacteria 3396
281 Ga0157375_10354111 3300013308 Unclassified 1634
282 Ga0163163_10052664 3300014325 Bacteria 4016
283 Ga0163163_10099684 3300014325 Bacteria 2927
284 Ga0163163_10200663 3300014325 Bacteria 2043
285 Ga0163163_10257874 3300014325 Bacteria 1794
286 Ga0163163_10332560 3300014325 Bacteria 1574
287 Ga0157380_10005673 3300014326 Bacteria 8730
288 Ga0157380_10092838 3300014326 Bacteria 2495
289 Ga0157380_10158283 3300014326 Bacteria 1965
290 Ga0157380_10451348 3300014326 Bacteria 1235
291 Ga0157380_10478186 3300014326 Unclassified 1204
292 Ga0157377_10012844 3300014745 Bacteria 4222
293 Ga0157377_10026904 3300014745 Bacteria 3083
294 Ga0157379_10079659 3300014968 Bacteria 2934
295 Ga0157379_10127264 3300014968 Unclassified 2292
296 Ga0157379_10311583 3300014968 Bacteria 1436
297 Ga0157379_10634780 3300014968 Unclassified 999
298 Ga0157376_10034851 3300014969 Bacteria 4067
299 Ga0157376_10049147 3300014969 Bacteria 3493
300 Ga0157376_10404981 3300014969 Unclassified 1320
301 Ga0157376_10634438 3300014969 Unclassified 1067
302 Ga0206353_11853494 3300020082 Bacteria 953
303 Ga0213876_10084839 3300021384 Bacteria 1676
304 Ga0213876_10174982 3300021384 Unclassified 1142
305 Ga0207697_10040073 3300025315 Bacteria 1923
306 Ga0207656_10002006 3300025321 Bacteria 6791
307 Ga0207682_10006906 3300025893 Bacteria 4553
308 Ga0207642_10010194 3300025899 Bacteria 3300
309 Ga0207680_10090277 3300025903 Unclassified 1947
310 Ga0207680_10093538 3300025903 Bacteria 1918
311 Ga0207680_10103388 3300025903 Unclassified 1834
312 Ga0207680_10105089 3300025903 Bacteria 1821
313 Ga0207685_10029903 3300025905 Bacteria 1933
314 Ga0207645_10019947 3300025907 Bacteria 4388
315 Ga0207645_10268632 3300025907 Unclassified 1131
316 Ga0207643_10013407 3300025908 Bacteria 4438
317 Ga0207643_10029211 3300025908 Bacteria 3066
318 Ga0207684_10593495 3300025910 Bacteria 946
319 Ga0207707_10060767 3300025912 Bacteria 3287
320 Ga0207707_10065194 3300025912 Bacteria 3172
321 Ga0207707_10228083 3300025912 Unclassified 1621
322 Ga0207695_10107624 3300025913 Unclassified 2773
323 Ga0207660_10590393 3300025917 Bacteria 904
324 Ga0207662_10108555 3300025918 Bacteria 1728
325 Ga0207657_10016876 3300025919 Bacteria 7026
326 Ga0207649_10020851 3300025920 Bacteria 3764
327 Ga0207649_10188121 3300025920 Bacteria 1450
328 Ga0207646_10005246 3300025922 Bacteria 13673
329 Ga0207646_10360329 3300025922 Bacteria 1314
330 Ga0207681_10272353 3300025923 Bacteria 1329
331 Ga0207681_10333631 3300025923 Bacteria 1209
332 Ga0207681_10373131 3300025923 Bacteria 1147
333 Ga0207694_10011434 3300025924 Bacteria 6699
334 Ga0207650_10007047 3300025925 Bacteria 7666
335 Ga0207650_10048925 3300025925 Bacteria 3120
336 Ga0207650_10050793 3300025925 Bacteria 3068
337 Ga0207659_10000610 3300025926 Bacteria 21345
338 Ga0207659_10001440 3300025926 Bacteria 14186
339 Ga0207659_10003203 3300025926 Bacteria 9784
340 Ga0207659_10024407 3300025926 Bacteria 4050
341 Ga0207659_10028499 3300025926 Bacteria 3796
342 Ga0207659_10037952 3300025926 Bacteria 3348
343 Ga0207659_10101614 3300025926 Bacteria 2169
344 Ga0207659_10228291 3300025926 Bacteria 1500
345 Ga0207687_10310854 3300025927 Bacteria 1272
346 Ga0207700_10003503 3300025928 Bacteria 9143
347 Ga0207644_10034429 3300025931 Bacteria 3544
348 Ga0207644_10066826 3300025931 Bacteria 2619
349 Ga0207690_10318704 3300025932 Bacteria 1221
350 Ga0207706_10304499 3300025933 Bacteria 1388
351 Ga0207706_10477241 3300025933 Bacteria 1078
352 Ga0207686_10022979 3300025934 Unclassified 3596
353 Ga0207709_10011973 3300025935 Bacteria 4782
354 Ga0207709_10014242 3300025935 Bacteria 4388
355 Ga0207670_10017603 3300025936 Bacteria 4322
356 Ga0207670_10151982 3300025936 Bacteria 1719
357 Ga0207670_10526546 3300025936 Bacteria 963
358 Ga0207669_10009583 3300025937 Bacteria 4624
359 Ga0207669_10051079 3300025937 Bacteria 2475
360 Ga0207691_10002347 3300025940 Bacteria 18531
361 Ga0207691_10047287 3300025940 Bacteria 3948
362 Ga0207691_10063694 3300025940 Bacteria 3344
363 Ga0207691_10112402 3300025940 Bacteria 2421
364 Ga0207711_10019774 3300025941 Bacteria 5611
365 Ga0207711_10021701 3300025941 Bacteria 5364
366 Ga0207711_10113981 3300025941 Bacteria 2407
367 Ga0207711_10411124 3300025941 Bacteria 1258
368 Ga0207689_10001755 3300025942 Bacteria 20472
369 Ga0207689_10103437 3300025942 Bacteria 2340
370 Ga0207661_10263245 3300025944 Bacteria 1537
371 Ga0207679_10098969 3300025945 Unclassified 2276
372 Ga0207679_10145177 3300025945 Bacteria 1923
373 Ga0207679_10221308 3300025945 Bacteria 1593
374 Ga0207679_10257898 3300025945 Bacteria 1486
375 Ga0207679_10459976 3300025945 Bacteria 1130
376 Ga0207667_10087515 3300025949 Bacteria 3222
377 Ga0207651_10003416 3300025960 Bacteria 7803
378 Ga0207651_10369775 3300025960 Bacteria 1212
379 Ga0207712_10052534 3300025961 Bacteria 2855
380 Ga0207712_10280782 3300025961 Unclassified 1359
381 Ga0207668_10025564 3300025972 Bacteria 3823
382 Ga0207668_10133358 3300025972 Bacteria 1900
383 Ga0207668_10503295 3300025972 Bacteria 1042
384 Ga0207640_10011872 3300025981 Bacteria 4946
385 Ga0207640_10103598 3300025981 Bacteria 2001
386 Ga0207658_10015669 3300025986 Bacteria 5203
387 Ga0207677_10038492 3300026023 Bacteria 3136
388 Ga0207703_10018205 3300026035 Bacteria 5486
389 Ga0207703_10024023 3300026035 Bacteria 4795
390 Ga0207703_10063885 3300026035 Bacteria 3020
391 Ga0207703_10083025 3300026035 Bacteria 2676
392 Ga0207678_10007673 3300026067 Bacteria 9531
393 Ga0207678_10024020 3300026067 Bacteria 5327
394 Ga0207678_10177781 3300026067 Unclassified 1817
395 Ga0207708_10055368 3300026075 Bacteria 3024
396 Ga0207708_10063229 3300026075 Bacteria 2827
397 Ga0207708_10151839 3300026075 Bacteria 1824
398 Ga0207702_10319467 3300026078 Bacteria 1478
399 Ga0207641_10145290 3300026088 Bacteria 2144
400 Ga0207641_10501497 3300026088 Bacteria 1179
401 Ga0207641_10673346 3300026088 Bacteria 1017
402 Ga0207648_10004510 3300026089 Bacteria 14279
403 Ga0207648_10034138 3300026089 Bacteria 4486
404 Ga0207648_10473387 3300026089 Unclassified 1143
405 Ga0207676_10224565 3300026095 Bacteria 1675
406 Ga0207676_10359189 3300026095 Unclassified 1349
407 Ga0207674_10078009 3300026116 Bacteria 3318
408 Ga0207674_10175806 3300026116 Bacteria 2093
409 Ga0207674_10218074 3300026116 Bacteria 1856
410 Ga0207675_100019318 3300026118 Bacteria 6358
411 Ga0207675_100603173 3300026118 Unclassified 1101
412 Ga0207675_100708674 3300026118 Unclassified 1016
413 Ga0207683_10028278 3300026121 Bacteria 4847
414 Ga0207683_10053185 3300026121 Bacteria 3550
415 Ga0207683_10095824 3300026121 Bacteria 2646
416 Ga0207683_10188057 3300026121 Bacteria 1874
417 Ga0207683_10579987 3300026121 Bacteria 1037
418 Ga0207698_10324966 3300026142 Bacteria 1442
419 Ga0207428_10003062 3300027907 Bacteria 16458
420 Ga0207428_10006183 3300027907 Bacteria 11062
421 Ga0207428_10015156 3300027907 Bacteria 6671
422 Ga0207428_10025185 3300027907 Bacteria 4982
423 Ga0207428_10066449 3300027907 Bacteria 2841
424 Ga0207428_10095592 3300027907 Bacteria 2302
425 Ga0268266_10019903 3300028379 Bacteria 5720
426 Ga0268266_10034404 3300028379 Bacteria 4309
427 Ga0268265_10013619 3300028380 Bacteria 5530
428 Ga0268265_10023576 3300028380 Bacteria 4340
429 Ga0268265_10038737 3300028380 Bacteria 3508
430 Ga0268265_10099271 3300028380 Bacteria 2347
431 Ga0268265_10120819 3300028380 Bacteria 2158
432 Ga0268265_10125107 3300028380 Bacteria 2126
433 Ga0268264_10011472 3300028381 Bacteria 7316
434 Ga0268264_10025831 3300028381 Bacteria 4796
435 Ga0268264_10136545 3300028381 Bacteria 2181
436 Ga0268264_10435678 3300028381 Bacteria 1267
437 Ga0307413_10029745 3300031824 Bacteria 3061
438 Ga0307410_10070232 3300031852 Bacteria 2425
439 Ga0307410_10081236 3300031852 Bacteria 2277
440 Ga0307410_10278309 3300031852 Unclassified 1312
441 Ga0307407_10007881 3300031903 Bacteria 4853
442 Ga0307412_10025337 3300031911 Bacteria 3673
443 Ga0307412_10265014 3300031911 Bacteria 1342
444 Ga0307409_100133846 3300031995 Bacteria 2123
445 Ga0307416_100848700 3300032002 Bacteria 1011
446 Ga0307411_10015801 3300032005 Bacteria 4253
447 Ga0373929_0000273 3300035085 Bacteria 9549
448 Ga0373934_0035195 3300035086 Unclassified 1970
449 Ga0373944_0079871 3300035089 Unclassified 1079
450 Ga0373949_0001245 3300035090 Bacteria 7504
451 Ga0373951_0003672 3300035091 Unclassified 3702
452 Ga0373952_0003509 3300035092 Bacteria 2828
453 Ga0373932_0001044 3300035112 Bacteria 7984
454 Ga0373939_0000189 3300035114 Bacteria 17148
455 Ga0373941_0000183 3300035115 Bacteria 11798
456 Ga0373945_0011240 3300035116 Bacteria 2958
457 Ga0373954_0091203 3300035118 Bacteria 1464
458 Ga0373960_0000196 3300035121 Bacteria 10991
459 Ga0373946_0226784 3300035171 Unclassified 904
460 Ga0373942_0022846 3300035207 Bacteria 1591
461 Ga0373961_0000343 3300035241 Bacteria 20426
462 Ga0373962_0003919 3300035242 Bacteria 3581
463 Ga0373931_0018651 3300035691 Bacteria 3451
464 Ga0373935_0245624 3300035692 Bacteria 1251
465 Ga0373933_0131978 3300035724 Bacteria 1571
466 Ga0373947_0137360 3300035725 Bacteria 1565
467 Ga0373937_0123592 3300036401 Unclassified 2413
468 Ga0373937_0218277 3300036401 Bacteria 1795
469 Ga0373937_0364989 3300036401 Bacteria 1369
470 Ga0373925_0018568 3300037068 Bacteria 5055
471 Ga0373925_0097825 3300037068 Unclassified 2251
472 Ga0436365_1153154 3300039437 Bacteria 2333
473 Ga0450896_003167 3300042133 Bacteria 2172
474 Ga0451576_0521202 3300045051 Bacteria 1249
475 Ga0495603_0136594 3300046455 Unclassified 1427
476 Ga0495594_0155955 3300046499 Unclassified 1297
477 Ga0495594_0247707 3300046499 Bacteria 1015
478 Ga0495628_0060037 3300046516 Unclassified 2985
479 Ga0495598_0008234 3300046537 Unclassified 2420
480 Ga0495598_0058233 3300046537 Unclassified 1185
481 Ga0495609_0059011 3300046538 Bacteria 1697
482 Ga0495621_0038989 3300046539 Unclassified 1660
483 Ga0495621_0039476 3300046539 Bacteria 1651
484 Ga0495645_0051741 3300046543 Unclassified 2988
485 Ga0495635_0124472 3300046663 Unclassified 1758
486 Ga0495658_0005732 3300046683 Bacteria 6102
487 Ga0495658_0089717 3300046683 Unclassified 1818
488 Ga0495658_0337721 3300046683 Unclassified 957
489 Ga0495677_0068505 3300047445 Bacteria 1321
490 Ga0495685_064887 3300047447 Bacteria 1227
491 Ga0496101_0000839 3300048904 Bacteria 18065
492 Ga0496103_0185650 3300048906 Bacteria 1337
493 Ga0496104_0002272 3300048907 Bacteria 16566
494 Ga0496104_0006069 3300048907 Bacteria 10602
495 Ga0496104_0108573 3300048907 Bacteria 2660
496 Ga0496105_0179882 3300048908 Bacteria 1732
497 Ga0496106_0024604 3300048909 Bacteria 4478
498 Ga0496107_0282162 3300048910 Bacteria 1236
499 Ga0496108_0002708 3300048911 Bacteria 14161
500 Ga0496110_0432703 3300048913 Bacteria 1199
501 Ga0496112_0038143 3300048915 Bacteria 4691
502 Ga0496113_0077420 3300048916 Bacteria 2543
503 Ga0496113_0089916 3300048916 Unclassified 2364
504 Ga0496113_0100635 3300048916 Bacteria 2240
505 Ga0496113_0439847 3300048916 Bacteria 1047
506 Ga0496114_0001918 3300048917 Bacteria 15830
507 Ga0496114_0153534 3300048917 Bacteria 1998
508 Ga0496114_0318567 3300048917 Unclassified 1374
509 Ga0496115_0083620 3300048918 Bacteria 2602
510 Ga0501034_0001470 3300049571 Bacteria 31214
511 Ga0501034_0195103 3300049571 Bacteria 1985
512 Ga0501036_0493839 3300049572 Bacteria 1019
513 Ga0501040_0300544 3300049576 Bacteria 1147
514 Ga0501041_0069751 3300049577 Bacteria 2157
515 Ga0501046_0204380 3300049580 Bacteria 1469
516 Ga0501047_0075783 3300049581 Bacteria 3237
517 Ga0501069_0053885 3300049585 Unclassified 2240
518 Ga0501072_0105465 3300049588 Unclassified 2241
519 Ga0501073_0302410 3300049589 Bacteria 1104
520 Ga0501074_0024025 3300049590 Unclassified 4430
521 Ga0501075_0006427 3300049591 Bacteria 8091
522 Ga0501076_0025906 3300049592 Unclassified 4540
523 Ga0501076_0110045 3300049592 Bacteria 2227
524 Ga0501076_0272002 3300049592 Bacteria 1387
525 Ga0501076_0483840 3300049592 Bacteria 1020
526 Ga0501077_0024964 3300049593 Unclassified 3795
527 Ga0501077_0073413 3300049593 Bacteria 2168
528 Ga0501079_0038137 3300049741 Unclassified 3706
529 Ga0501079_0097838 3300049741 Bacteria 2275
530 Ga0501081_0108069 3300049743 Bacteria 1973
531 Ga0501081_0200538 3300049743 Bacteria 1447
532 Ga0501081_0283912 3300049743 Bacteria 1212
533 Ga0501083_0019874 3300049744 Bacteria 4675
534 Ga0501083_0230319 3300049744 Bacteria 1207
535 Ga0501035_0543629 3300049822 Unclassified 952
536 Ga0501045_0059416 3300049824 Bacteria 2801
537 Ga0501045_0108984 3300049824 Unclassified 2053
538 Ga0501045_0193094 3300049824 Bacteria 1517
539 nmdc:mga03683_524_c1 3300050489 Bacteria 7793
540 nmdc:mga00v17_20425_c1 3300050491 Bacteria 3794
541 nmdc:mga0yw44_322304_c1 3300050492 Bacteria 1038
542 nmdc:mga0k408_16606_c1 3300050493 Bacteria 4087
543 nmdc:mga0k408_31063_c1 3300050493 Bacteria 3048
544 nmdc:mga0k408_43446_c1 3300050493 Bacteria 2590
545 nmdc:mga0k408_6938_c1 3300050493 Bacteria 6041
546 nmdc:mga06z11_7729_c1 3300050494 Bacteria 4440
547 nmdc:mga06z11_9540_c1 3300050494 Bacteria 4094
548 nmdc:mga04h51_47344_c1 3300050495 Bacteria 1429
549 nmdc:mga04h51_97725_c1 3300050495 Unclassified 1066
550 nmdc:mga07m45_5012_c1 3300050496 Bacteria 6539
551 nmdc:mga05p37_117489_c1 3300050507 Bacteria 3268
552 nmdc:mga05p37_172628_c1 3300050507 Bacteria 2636
553 nmdc:mga05p37_269588_c1 3300050507 Bacteria 2035
554 nmdc:mga05p37_3183_c1 3300050507 Bacteria 19098
555 nmdc:mga05p37_336314_c1 3300050507 Bacteria 1782
556 nmdc:mga05p37_35558_c1 3300050507 Bacteria 6109
557 nmdc:mga05p37_3751_c1 3300050507 Bacteria 17782
558 nmdc:mga05p37_54954_c1 3300050507 Unclassified 4898
559 nmdc:mga05p37_78996_c1 3300050507 Unclassified 4052
560 nmdc:mga05p37_87143_c1 3300050507 Bacteria 3848
561 nmdc:mga09592_186414_c1 3300050508 Bacteria 1795
562 nmdc:mga09592_413899_c1 3300050508 Unclassified 1165
563 nmdc:mga0qj67_1679_c1 3300050509 Bacteria 15592
564 nmdc:mga0qj67_242789_c1 3300050509 Unclassified 1461
565 nmdc:mga0qj67_278107_c1 3300050509 Unclassified 1357
566 nmdc:mga06r32_130352_c1 3300050510 Bacteria 2486
567 nmdc:mga06r32_261773_c1 3300050510 Bacteria 1717
568 nmdc:mga06r32_69463_c1 3300050510 Bacteria 3405
569 nmdc:mga08y16_115_c1 3300050511 Bacteria 68657
570 nmdc:mga08y16_118120_c1 3300050511 Bacteria 2760
571 nmdc:mga08y16_15532_c1 3300050511 Bacteria 8007
572 nmdc:mga08y16_276385_c1 3300050511 Bacteria 1733
573 nmdc:mga08y16_288128_c1 3300050511 Bacteria 1693
574 nmdc:mga08y16_65863_c1 3300050511 Bacteria 3781
575 nmdc:mga08y16_704_c1 3300050511 Bacteria 31826
576 nmdc:mga08y16_721551_c1 3300050511 Bacteria 995
577 nmdc:mga08y16_91113_c1 3300050511 Bacteria 3178
578 nmdc:mga0n895_131630_c1 3300050512 Bacteria 2526
579 nmdc:mga0n895_1585_c1 3300050512 Bacteria 17095
580 nmdc:mga0n895_262_c1 3300050512 Bacteria 34169
581 nmdc:mga0n895_2758_c1 3300050512 Bacteria 13875
582 nmdc:mga0n895_548822_c1 3300050512 Unclassified 1161
583 nmdc:mga0n895_610823_c1 3300050512 Bacteria 1092
584 nmdc:mga0n895_66869_c1 3300050512 Unclassified 3558
585 nmdc:mga0n895_98754_c1 3300050512 Bacteria 2927
586 nmdc:mga0rr50_104835_c1 3300050513 Bacteria 2228
587 nmdc:mga0rr50_285947_c1 3300050513 Unclassified 1377
588 nmdc:mga0rr50_30_c1 3300050513 Bacteria 105385
589 nmdc:mga0rr50_407365_c1 3300050513 Bacteria 1149
590 nmdc:mga0rr50_7157_c1 3300050513 Bacteria 6855
591 nmdc:mga08x19_1883_c1 3300050514 Bacteria 12852
592 nmdc:mga08x19_47498_c1 3300050514 Unclassified 2748
593 nmdc:mga08x19_56011_c1 3300050514 Unclassified 2543
594 nmdc:mga0a205_113470_c1 3300050515 Bacteria 2609
595 nmdc:mga0a205_121038_c1 3300050515 Bacteria 2516
596 nmdc:mga0a205_305653_c1 3300050515 Bacteria 1463
597 nmdc:mga0a205_3612_c1 3300050515 Bacteria 12687
598 nmdc:mga0a205_44539_c1 3300050515 Bacteria 4278
599 nmdc:mga0a205_765_c1 3300050515 Bacteria 25996
600 nmdc:mga0a205_89607_c1 3300050515 Unclassified 2973
601 nmdc:mga0a205_97139_c1 3300050515 Unclassified 2845
602 Ga0495601_0093981 3300053077 Unclassified 1932
603 Ga0495595_0086187 3300053084 Bacteria 1502
604 Ga0495619_0026437 3300053085 Bacteria 3734
605 Ga0500641_0000374 3300053096 Bacteria 16601
606 Ga0500555_000295 3300053103 Bacteria 21530
607 Ga0500645_000220 3300053730 Bacteria 43452
608 Ga0501084_0153265 3300054114 Unclassified 1943
609 Ga0501084_0337448 3300054114 Unclassified 1273
610 Ga0501084_0444949 3300054114 Bacteria 1095
611 Ga0590071_000357 3300059421 Bacteria 13494
612 Ga0590071_000645 3300059421 Bacteria 9914
613 Ga0590074_000645 3300059423 Bacteria 5262
614 Ga0590075_000083 3300059424 Bacteria 24188
615 Ga0590075_000133 3300059424 Bacteria 19395
616 Ga0590077_000027 3300059426 Bacteria 33787
617 Ga0590077_000452 3300059426 Bacteria 11556
618 Ga0501082_0083298 3300060353 Bacteria 2760
619 Ga0501082_0176106 3300060353 Bacteria 1860
620 Ga0501082_0296701 3300060353 Unclassified 1407
621 Ga0530510_0019708 3300061734 Unclassified 4790
622 Ga0530510_0095185 3300061734 Bacteria 2175
623 Ga0105248_10015432
624 JGI25406J46586_10005698
625 JGI25406J46586_10012296
626 JGI25406J46586_10072706
627 Ga0065712_10077673
628 Ga0065712_10083295
629 Ga0065712_10086645
630 Ga0065715_10090263
631 Ga0065715_10132727
632 Ga0065707_10007056
633 Ga0065707_10011639
634 Ga0065707_10145027
635 Ga0070676_10001882
636 Ga0070690_100076364
637 Ga0070670_100017062
638 Ga0070670_100091727
639 Ga0070670_100122954
640 Ga0070677_10009972
641 Ga0068869_100000617
642 Ga0070666_10173028
643 Ga0070682_100077591
644 Ga0068868_100324092
645 Ga0068868_100479133
646 Ga0070660_100015335
647 Ga0070689_100151852
648 Ga0070691_10100604
649 Ga0070661_100076068
650 Ga0070661_100077228
651 Ga0070692_10045548
652 Ga0070668_100040024
653 Ga0070668_100293942
654 Ga0070669_100001341
655 Ga0070669_100055819
656 Ga0070669_100062773
657 Ga0070669_100079399
658 Ga0070669_100390355
659 Ga0070675_100000862
660 Ga0070675_100002674
661 Ga0070675_100006377
662 Ga0070675_100022773
663 Ga0070675_100038409
664 Ga0070675_100091488
665 Ga0070675_100216903
666 Ga0070671_100094587
667 Ga0070674_100006480
668 Ga0070674_100028096
669 Ga0070673_100016724
670 Ga0070673_100022451
671 Ga0070673_100074866
672 Ga0070673_100126517
673 Ga0070673_100308911
674 Ga0070688_100012769
675 Ga0070688_100064965
676 Ga0070688_100104214
677 Ga0070688_100298203
678 Ga0070659_100033151
679 Ga0070659_100038608
680 Ga0070667_100027806
681 Ga0070667_100122006
682 Ga0070667_100246426
683 Ga0070703_10033037
684 Ga0070713_100004753
685 Ga0070701_10001097
686 Ga0070701_10118220
687 Ga0070705_100000627
688 Ga0070700_100176237
689 Ga0070694_100022821
690 Ga0070694_100247272
691 Ga0070708_100155496
692 Ga0070663_100035425
693 Ga0070678_100034364
694 Ga0070678_100060921
695 Ga0070678_100124992
696 Ga0070662_100292487
697 Ga0070662_100448038
698 Ga0070681_10040179
699 Ga0068867_100014302
700 Ga0068867_100102407
701 Ga0068867_100191808
702 Ga0068867_100266228
703 Ga0070685_10189955
704 Ga0070707_100042102
705 Ga0070707_100073971
706 Ga0070707_100137070
707 Ga0070698_100003797
708 Ga0070698_100098859
709 Ga0070698_100154092
710 Ga0070698_100583752
711 Ga0070699_100002749
712 Ga0070699_100025075
713 Ga0070699_100163527
714 Ga0070684_100090960
715 Ga0070684_100236311
716 Ga0070684_100442415
717 Ga0070697_100040175
718 Ga0070697_100077691
719 Ga0070672_100063977
720 Ga0070672_100124083
721 Ga0070672_100225784
722 Ga0070695_100001243
723 Ga0070695_100069484
724 Ga0070665_100006178
725 Ga0070665_100330421
726 Ga0070704_100087102
727 Ga0070704_100150227
728 Ga0070704_100237856
729 Ga0068855_100189726
730 Ga0068855_100313333
731 Ga0068855_100324446
732 Ga0068855_100371321
733 Ga0070664_100082140
734 Ga0070664_100121589
735 Ga0070664_100265210
736 Ga0070664_100292689
737 Ga0068857_100028222
738 Ga0068857_100058786
739 Ga0068857_100116471
740 Ga0068854_100115344
741 Ga0068854_100164057
742 Ga0068856_100118589
743 Ga0068856_100380828
744 Ga0070702_100084610
745 Ga0070702_100349437
746 Ga0068859_100008260
747 Ga0068859_100016183
748 Ga0068859_100018385
749 Ga0068859_100023566
750 Ga0068859_100108159
751 Ga0068859_100803618
752 Ga0068864_100027211
753 Ga0068864_100071452
754 Ga0068861_100043805
755 Ga0068861_100173028
756 Ga0068851_10002491
757 Ga0068870_10067432
758 Ga0068863_100156499
759 Ga0068863_100516538
760 Ga0068858_100028239
761 Ga0068858_100046609
762 Ga0068858_100067110
763 Ga0068858_100450096
764 Ga0068858_100566110
765 Ga0068860_100015393
766 Ga0068860_100037873
767 Ga0068860_100124291
768 Ga0068860_100690397
769 Ga0068862_100009172
770 Ga0068862_100033773
771 Ga0068862_100055257
772 Ga0068862_100076795
773 Ga0068862_100148207
774 Ga0068862_100283104
775 Ga0068862_100350162
776 Ga0081539_10000013
777 Ga0081539_10000164
778 Ga0081539_10002616
779 Ga0075365_10006103
780 Ga0075365_10062235
781 Ga0075368_10037475
782 Ga0075368_10123669
783 Ga0075364_10002388
784 Ga0075364_10006995
785 Ga0075364_10063932
786 Ga0075364_10284101
787 Ga0075364_10384074
788 Ga0075367_10016452
789 Ga0075367_10092575
790 Ga0075367_10146468
791 Ga0075366_10006305
792 Ga0075366_10017088
793 Ga0075366_10036147
794 Ga0097621_100118577
795 Ga0097621_100431927
796 Ga0075370_10005341
797 Ga0068871_100019081
798 Ga0075428_100007610
799 Ga0075428_100120761
800 Ga0075428_100616698
801 Ga0075430_100200513
802 Ga0075431_100017564
803 Ga0075431_100209551
804 Ga0075431_100284419
805 Ga0075431_100362358
806 Ga0075431_100574303
807 Ga0075433_10005015
808 Ga0075433_10016110
809 Ga0075433_10017448
810 Ga0075433_10037168
811 Ga0075433_10075447
812 Ga0075433_10077139
813 Ga0075433_10077965
814 Ga0075433_10138509
815 Ga0075433_10198674
816 Ga0075433_10531845
817 Ga0075434_100000328
818 Ga0075434_100002588
819 Ga0075434_100007278
820 Ga0075434_100010351
821 Ga0075434_100012709
822 Ga0075434_100115519
823 Ga0075434_100152969
824 Ga0075434_100221019
825 Ga0075434_100290731
826 Ga0075434_100797973
827 Ga0075429_100049180
828 Ga0075429_100124412
829 Ga0075429_100215576
830 Ga0075429_100294925
831 Ga0068865_100000895
832 Ga0068865_100048271
833 Ga0068865_100243086
834 Ga0075436_100003879
835 Ga0075436_100015032
836 Ga0075436_100124514
837 Ga0075436_100280617
838 Ga0097620_100008260
839 Ga0097620_100016183
840 Ga0097620_100018386
841 Ga0097620_100023566
842 Ga0097620_100108150
843 Ga0097620_100803704
844 Ga0075435_100000032
845 Ga0075435_100013286
846 Ga0075435_100014715
847 Ga0075435_100037835
848 Ga0075435_100067628
849 Ga0075435_100326128
850 Ga0105240_10063116
851 Ga0105240_10101141
852 Ga0105240_10150392
853 Ga0111539_10001097
854 Ga0111539_10001694
855 Ga0111539_10002024
856 Ga0111539_10010685
857 Ga0111539_10017051
858 Ga0111539_10081166
859 Ga0111539_10129472
860 Ga0111539_10138107
861 Ga0111539_10270264
862 Ga0105245_10106929
863 Ga0105245_10245355
864 Ga0105245_10381717
865 Ga0114129_10000797
866 Ga0114129_10005902
867 Ga0114129_10020055
868 Ga0114129_10042246
869 Ga0114129_10090635
870 Ga0114129_10098605
871 Ga0114129_10119868
872 Ga0114129_10126275
873 Ga0114129_10151342
874 Ga0114129_10198191
875 Ga0114129_10798970
876 Ga0114129_10820471
877 Ga0114129_10831124
878 Ga0114129_11065512
879 Ga0105243_10010646
880 Ga0105243_10116892
881 Ga0105241_10345038
882 Ga0105242_10005223
883 Ga0105242_10006077
884 Ga0105242_10098699
885 Ga0105248_10003322
886 Ga0105248_10006608
887 Ga0105248_10086152
888 Ga0105248_10224602
889 Ga0105248_10234292
890 Ga0105248_10305470
891 Ga0105248_10348805
892 Ga0105248_10353099
893 Ga0105248_10610552
894 Ga0105237_10127912
895 Ga0105249_10000452
896 Ga0105249_10062954
897 Ga0105249_10274249
898 Ga0105249_10577509
899 Ga0105249_10886534
900 Ga0163162_10017416
901 Ga0157375_10055666
902 Ga0157375_10075454
903 Ga0157375_10354111
904 Ga0163163_10052664
905 Ga0163163_10099684
906 Ga0163163_10200663
907 Ga0163163_10257874
908 Ga0163163_10332560
909 Ga0157380_10005673
910 Ga0157380_10092838
911 Ga0157380_10158283
912 Ga0157380_10451348
913 Ga0157380_10478186
914 Ga0157377_10012844
915 Ga0157377_10026904
916 Ga0157379_10079659
917 Ga0157379_10127264
918 Ga0157379_10311583
919 Ga0157379_10634780
920 Ga0157376_10034851
921 Ga0157376_10049147
922 Ga0157376_10404981
923 Ga0157376_10634438
924 Ga0206353_11853494
925 Ga0213876_10084839
926 Ga0213876_10174982
927 Ga0207697_10040073
928 Ga0207656_10002006
929 Ga0207682_10006906
930 Ga0207642_10010194
931 Ga0207680_10090277
932 Ga0207680_10093538
933 Ga0207680_10103388
934 Ga0207680_10105089
935 Ga0207685_10029903
936 Ga0207645_10019947
937 Ga0207645_10268632
938 Ga0207643_10013407
939 Ga0207643_10029211
940 Ga0207684_10593495
941 Ga0207707_10060767
942 Ga0207707_10065194
943 Ga0207707_10228083
944 Ga0207695_10107624
945 Ga0207660_10590393
946 Ga0207662_10108555
947 Ga0207657_10016876
948 Ga0207649_10020851
949 Ga0207649_10188121
950 Ga0207646_10005246
951 Ga0207646_10360329
952 Ga0207681_10272353
953 Ga0207681_10333631
954 Ga0207681_10373131
955 Ga0207694_10011434
956 Ga0207650_10007047
957 Ga0207650_10048925
958 Ga0207650_10050793
959 Ga0207659_10000610
960 Ga0207659_10001440
961 Ga0207659_10003203
962 Ga0207659_10024407
963 Ga0207659_10028499
964 Ga0207659_10037952
965 Ga0207659_10101614
966 Ga0207659_10228291
967 Ga0207687_10310854
968 Ga0207700_10003503
969 Ga0207644_10034429
970 Ga0207644_10066826
971 Ga0207690_10318704
972 Ga0207706_10304499
973 Ga0207706_10477241
974 Ga0207686_10022979
975 Ga0207709_10011973
976 Ga0207709_10014242
977 Ga0207670_10017603
978 Ga0207670_10151982
979 Ga0207670_10526546
980 Ga0207669_10009583
981 Ga0207669_10051079
982 Ga0207691_10002347
983 Ga0207691_10047287
984 Ga0207691_10063694
985 Ga0207691_10112402
986 Ga0207711_10019774
987 Ga0207711_10021701
988 Ga0207711_10113981
989 Ga0207711_10411124
990 Ga0207689_10001755
991 Ga0207689_10103437
992 Ga0207661_10263245
993 Ga0207679_10098969
994 Ga0207679_10145177
995 Ga0207679_10221308
996 Ga0207679_10257898
997 Ga0207679_10459976
998 Ga0207667_10087515
999 Ga0207651_10003416
1000 Ga0207651_10369775
1001 Ga0207712_10052534
1002 Ga0207712_10280782
1003 Ga0207668_10025564
1004 Ga0207668_10133358
1005 Ga0207668_10503295
1006 Ga0207640_10011872
1007 Ga0207640_10103598
1008 Ga0207658_10015669
1009 Ga0207677_10038492
1010 Ga0207703_10018205
1011 Ga0207703_10024023
1012 Ga0207703_10063885
1013 Ga0207703_10083025
1014 Ga0207678_10007673
1015 Ga0207678_10024020
1016 Ga0207678_10177781
1017 Ga0207708_10055368
1018 Ga0207708_10063229
1019 Ga0207708_10151839
1020 Ga0207702_10319467
1021 Ga0207641_10145290
1022 Ga0207641_10501497
1023 Ga0207641_10673346
1024 Ga0207648_10004510
1025 Ga0207648_10034138
1026 Ga0207648_10473387
1027 Ga0207676_10224565
1028 Ga0207676_10359189
1029 Ga0207674_10078009
1030 Ga0207674_10175806
1031 Ga0207674_10218074
1032 Ga0207675_100019318
1033 Ga0207675_100603173
1034 Ga0207675_100708674
1035 Ga0207683_10028278
1036 Ga0207683_10053185
1037 Ga0207683_10095824
1038 Ga0207683_10188057
1039 Ga0207683_10579987
1040 Ga0207698_10324966
1041 Ga0207428_10003062
1042 Ga0207428_10006183
1043 Ga0207428_10015156
1044 Ga0207428_10025185
1045 Ga0207428_10066449
1046 Ga0207428_10095592
1047 Ga0268266_10019903
1048 Ga0268266_10034404
1049 Ga0268265_10013619
1050 Ga0268265_10023576
1051 Ga0268265_10038737
1052 Ga0268265_10099271
1053 Ga0268265_10120819
1054 Ga0268265_10125107
1055 Ga0268264_10011472
1056 Ga0268264_10025831
1057 Ga0268264_10136545
1058 Ga0268264_10435678
1059 Ga0307413_10029745
1060 Ga0307410_10070232
1061 Ga0307410_10081236
1062 Ga0307410_10278309
1063 Ga0307407_10007881
1064 Ga0307412_10025337
1065 Ga0307412_10265014
1066 Ga0307409_100133846
1067 Ga0307416_100848700
1068 Ga0307411_10015801
1069 Ga0373929_0000273
1070 Ga0373934_0035195
1071 Ga0373944_0079871
1072 Ga0373949_0001245
1073 Ga0373951_0003672
1074 Ga0373952_0003509
1075 Ga0373932_0001044
1076 Ga0373939_0000189
1077 Ga0373941_0000183
1078 Ga0373945_0011240
1079 Ga0373954_0091203
1080 Ga0373960_0000196
1081 Ga0373946_0226784
1082 Ga0373942_0022846
1083 Ga0373961_0000343
1084 Ga0373962_0003919
1085 Ga0373931_0018651
1086 Ga0373935_0245624
1087 Ga0373933_0131978
1088 Ga0373947_0137360
1089 Ga0373937_0123592
1090 Ga0373937_0218277
1091 Ga0373937_0364989
1092 Ga0373925_0018568
1093 Ga0373925_0097825
1094 Ga0436365_1153154
1095 Ga0450896_003167
1096 Ga0451576_0521202
1097 Ga0495603_0136594
1098 Ga0495594_0155955
1099 Ga0495594_0247707
1100 Ga0495628_0060037
1101 Ga0495598_0008234
1102 Ga0495598_0058233
1103 Ga0495609_0059011
1104 Ga0495621_0038989
1105 Ga0495621_0039476
1106 Ga0495645_0051741
1107 Ga0495635_0124472
1108 Ga0495658_0005732
1109 Ga0495658_0089717
1110 Ga0495658_0337721
1111 Ga0495677_0068505
1112 Ga0495685_064887
1113 Ga0496101_0000839
1114 Ga0496103_0185650
1115 Ga0496104_0002272
1116 Ga0496104_0006069
1117 Ga0496104_0108573
1118 Ga0496105_0179882
1119 Ga0496106_0024604
1120 Ga0496107_0282162
1121 Ga0496108_0002708
1122 Ga0496110_0432703
1123 Ga0496112_0038143
1124 Ga0496113_0077420
1125 Ga0496113_0089916
1126 Ga0496113_0100635
1127 Ga0496113_0439847
1128 Ga0496114_0001918
1129 Ga0496114_0153534
1130 Ga0496114_0318567
1131 Ga0496115_0083620
1132 Ga0501034_0001470
1133 Ga0501034_0195103
1134 Ga0501036_0493839
1135 Ga0501040_0300544
1136 Ga0501041_0069751
1137 Ga0501046_0204380
1138 Ga0501047_0075783
1139 Ga0501069_0053885
1140 Ga0501072_0105465
1141 Ga0501073_0302410
1142 Ga0501074_0024025
1143 Ga0501075_0006427
1144 Ga0501076_0025906
1145 Ga0501076_0110045
1146 Ga0501076_0272002
1147 Ga0501076_0483840
1148 Ga0501077_0024964
1149 Ga0501077_0073413
1150 Ga0501079_0038137
1151 Ga0501079_0097838
1152 Ga0501081_0108069
1153 Ga0501081_0200538
1154 Ga0501081_0283912
1155 Ga0501083_0019874
1156 Ga0501083_0230319
1157 Ga0501035_0543629
1158 Ga0501045_0059416
1159 Ga0501045_0108984
1160 Ga0501045_0193094
1161 nmdc:mga03683_524_c1
1162 nmdc:mga00v17_20425_c1
1163 nmdc:mga0yw44_322304_c1
1164 nmdc:mga0k408_16606_c1
1165 nmdc:mga0k408_31063_c1
1166 nmdc:mga0k408_43446_c1
1167 nmdc:mga0k408_6938_c1
1168 nmdc:mga06z11_7729_c1
1169 nmdc:mga06z11_9540_c1
1170 nmdc:mga04h51_47344_c1
1171 nmdc:mga04h51_97725_c1
1172 nmdc:mga07m45_5012_c1
1173 nmdc:mga05p37_117489_c1
1174 nmdc:mga05p37_172628_c1
1175 nmdc:mga05p37_269588_c1
1176 nmdc:mga05p37_3183_c1
1177 nmdc:mga05p37_336314_c1
1178 nmdc:mga05p37_35558_c1
1179 nmdc:mga05p37_3751_c1
1180 nmdc:mga05p37_54954_c1
1181 nmdc:mga05p37_78996_c1
1182 nmdc:mga05p37_87143_c1
1183 nmdc:mga09592_186414_c1
1184 nmdc:mga09592_413899_c1
1185 nmdc:mga0qj67_1679_c1
1186 nmdc:mga0qj67_242789_c1
1187 nmdc:mga0qj67_278107_c1
1188 nmdc:mga06r32_130352_c1
1189 nmdc:mga06r32_261773_c1
1190 nmdc:mga06r32_69463_c1
1191 nmdc:mga08y16_115_c1
1192 nmdc:mga08y16_118120_c1
1193 nmdc:mga08y16_15532_c1
1194 nmdc:mga08y16_276385_c1
1195 nmdc:mga08y16_288128_c1
1196 nmdc:mga08y16_65863_c1
1197 nmdc:mga08y16_704_c1
1198 nmdc:mga08y16_721551_c1
1199 nmdc:mga08y16_91113_c1
1200 nmdc:mga0n895_131630_c1
1201 nmdc:mga0n895_1585_c1
1202 nmdc:mga0n895_262_c1
1203 nmdc:mga0n895_2758_c1
1204 nmdc:mga0n895_548822_c1
1205 nmdc:mga0n895_610823_c1
1206 nmdc:mga0n895_66869_c1
1207 nmdc:mga0n895_98754_c1
1208 nmdc:mga0rr50_104835_c1
1209 nmdc:mga0rr50_285947_c1
1210 nmdc:mga0rr50_30_c1
1211 nmdc:mga0rr50_407365_c1
1212 nmdc:mga0rr50_7157_c1
1213 nmdc:mga08x19_1883_c1
1214 nmdc:mga08x19_47498_c1
1215 nmdc:mga08x19_56011_c1
1216 nmdc:mga0a205_113470_c1
1217 nmdc:mga0a205_121038_c1
1218 nmdc:mga0a205_305653_c1
1219 nmdc:mga0a205_3612_c1
1220 nmdc:mga0a205_44539_c1
1221 nmdc:mga0a205_765_c1
1222 nmdc:mga0a205_89607_c1
1223 nmdc:mga0a205_97139_c1
1224 Ga0495601_0093981
1225 Ga0495595_0086187
1226 Ga0495619_0026437
1227 Ga0500641_0000374
1228 Ga0500555_000295
1229 Ga0500645_000220
1230 Ga0501084_0153265
1231 Ga0501084_0337448
1232 Ga0501084_0444949
1233 Ga0590071_000357
1234 Ga0590071_000645
1235 Ga0590074_000645
1236 Ga0590075_000083
1237 Ga0590075_000133
1238 Ga0590077_000027
1239 Ga0590077_000452
1240 Ga0501082_0083298
1241 Ga0501082_0176106
1242 Ga0501082_0296701
1243 Ga0530510_0019708
1244 Ga0530510_0095185

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24741

70

271

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f7p-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes 0.8856 129 192
7bzh-assembly1.cif.gz_A solution structure of a dna binding protein from sulfolobus islandicus 0.8731 212 268
3bp8-assembly2.cif.gz_B crystal structure of mlc/eiib complex 0.8574 131 176
5f7q-assembly1.cif.gz_C rok repressor lmo0178 from listeria monocytogenes bound to operator 0.8566 132 192
2heo-assembly1.cif.gz_A general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.8529 212 265
ID Description Score Start End Superfamily
af_A0A0R4ISV4_565_710_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.8822 211 265 3.30.230.130
af_B2RYJ1_603_746_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.8769 211 268 3.30.230.130
af_Q54S95_10_96_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8622 226 267 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.861 209 265 1.10.10.10
af_Q9VG60_1_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8594 212 256 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V9CKS2-F1-model_v4 Uncharacterized protein 0.9948 206 266
AF-A0A7Y5U5D9-F1-model_v4 Winged helix-turn-helix domain-containing protein 0.9908 1 266
AF-A0A1Q7MSX2-F1-model_v4 Uncharacterized protein 0.9901 1 266
AF-A0A7W0GSM1-F1-model_v4 Uncharacterized protein 0.9899 5 209
AF-A0A2V8SUB2-F1-model_v4 Transcriptional regulator 0.9854 1 267

Map