F470076

General Info

Members Datasets Scaffolds Average Seq Length
622 341 557 66

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100185441|Ga0070668_1001854412
Length 60
Sequence MMHTYRELVIGGVLVAPIVSYAAIARPLMHFVGFPRLFSNPPIAELSLYVSIFGLLTLLF

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
3 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
6 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
7 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
8 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
9 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
10 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
11 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
12 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
13 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
14 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
15 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
16 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
17 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
18 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
19 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
20 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
21 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
22 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
23 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
24 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
25 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
26 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
27 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
28 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
29 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
30 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
31 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
32 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
33 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
34 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
35 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
36 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
37 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
38 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
39 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
40 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
41 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
42 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
43 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
44 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
45 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
46 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
47 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
48 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
49 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
50 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
54 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
55 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
56 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
75 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
76 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
77 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
78 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
91 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
149 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
150 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
151 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
152 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
199 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
200 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
201 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
226 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
227 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
228 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
298 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
305 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
306 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
307 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
308 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
309 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
310 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
311 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
312 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
313 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
314 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
315 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
316 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
317 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
318 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
319 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
322 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
323 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
327 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
328 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
329 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
330 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
331 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
332 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
333 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
334 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
335 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
336 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
337 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
338 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
339 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
340 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
341 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.55
Metatranscriptomes 0
Isolates 10.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.92
Nodule 7.23
Rhizoplane 4.66
Rhizosphere 62.22
Stem 0
Stem Tuber 0
Unclassified 9.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10002686 3300003215 Bacteria 10147
2 JGI25153J46596_10004447 3300003215 Bacteria 7558
3 rootH2_10124891 3300003320 Bacteria 3733
4 rootH2_10150455 3300003320 Bacteria 2974
5 rootH2_10343363 3300003320 Bacteria 1117
6 rootL2_10166156 3300003322 Bacteria 4292
7 rootL2_10217400 3300003322 Bacteria 1006
8 rootH1_10029805 3300003323 Bacteria 3879
9 JGI25160J50197_1000413 3300003354 Bacteria 27195
10 JGI25404J52841_10000012 3300003659 Bacteria 14692
11 JGI25404J52841_10033417 3300003659 Bacteria 1096
12 JGI25404J52841_10071834 3300003659 Bacteria 723
13 JGI25404J52841_10117062 3300003659 Bacteria 561
14 Ga0055539_1030993 3300003752 Bacteria 605
15 Ga0055526_1094944 3300003771 Bacteria 556
16 Ga0065165_1000342 3300005262 Bacteria 76302
17 Ga0065165_1054931 3300005262 Bacteria 1114
18 Ga0070683_101925011 3300005329 Bacteria 568
19 Ga0068869_100019259 3300005334 Bacteria 4658
20 Ga0068869_101941787 3300005334 Bacteria 528
21 Ga0070682_100071824 3300005337 Bacteria 2216
22 Ga0068868_101850693 3300005338 Bacteria 571
23 Ga0068868_101878884 3300005338 Bacteria 567
24 Ga0070660_101061407 3300005339 Bacteria 685
25 Ga0070668_100011014 3300005347 Bacteria 6731
26 Ga0070668_100185441 3300005347 Unclassified 1702
27 Ga0070668_100185900 3300005347 Bacteria 1699
28 Ga0070668_100242177 3300005347 Bacteria 1494
29 Ga0070668_100667169 3300005347 Bacteria 915
30 Ga0070668_101113761 3300005347 Bacteria 713
31 Ga0070668_101266818 3300005347 Bacteria 669
32 Ga0070668_101772583 3300005347 Bacteria 567
33 Ga0070669_100031584 3300005353 Bacteria 3826
34 Ga0070669_100257383 3300005353 Bacteria 1391
35 Ga0070669_101441262 3300005353 Bacteria 598
36 Ga0070671_100580532 3300005355 Bacteria 968
37 Ga0070674_100224052 3300005356 Bacteria 1464
38 Ga0070674_101064862 3300005356 Bacteria 712
39 Ga0070659_101239161 3300005366 Bacteria 660
40 Ga0070667_100022148 3300005367 Bacteria 5272
41 Ga0070667_100052299 3300005367 Bacteria 3446
42 Ga0070667_102192086 3300005367 Unclassified 520
43 Ga0070709_10036722 3300005434 Bacteria 2987
44 Ga0070714_100058653 3300005435 Bacteria 3299
45 Ga0070713_100055738 3300005436 Bacteria 3286
46 Ga0070710_10035295 3300005437 Bacteria 2726
47 Ga0070710_10638966 3300005437 Bacteria 745
48 Ga0070710_10667638 3300005437 Bacteria 730
49 Ga0070710_11044626 3300005437 Bacteria 597
50 Ga0070701_10584593 3300005438 Bacteria 737
51 Ga0070711_100074374 3300005439 Bacteria 2403
52 Ga0070711_100124860 3300005439 Bacteria 1909
53 Ga0070700_100012251 3300005441 Bacteria 4779
54 Ga0070694_100086152 3300005444 Bacteria 2195
55 Ga0070708_100593417 3300005445 Unclassified 1044
56 Ga0070663_100354774 3300005455 Bacteria 1188
57 Ga0070663_100655294 3300005455 Bacteria 888
58 Ga0070663_101380041 3300005455 Bacteria 623
59 Ga0070678_100150372 3300005456 Bacteria 1875
60 Ga0070662_100313181 3300005457 Bacteria 1278
61 Ga0070662_101750124 3300005457 Bacteria 537
62 Ga0070681_10376649 3300005458 Bacteria 1330
63 Ga0070706_100226248 3300005467 Bacteria 1746
64 Ga0070706_101162190 3300005467 Bacteria 710
65 Ga0070707_100337097 3300005468 Unclassified 1465
66 Ga0070707_101279140 3300005468 Unclassified 700
67 Ga0070698_100015349 3300005471 Bacteria 8095
68 Ga0070698_100095757 3300005471 Bacteria 2946
69 Ga0070698_100380999 3300005471 Bacteria 1343
70 Ga0070698_100469306 3300005471 Bacteria 1195
71 Ga0070698_100627065 3300005471 Bacteria 1016
72 Ga0070699_100096667 3300005518 Bacteria 2587
73 Ga0070699_100108840 3300005518 Bacteria 2432
74 Ga0070699_100406205 3300005518 Bacteria 1232
75 Ga0070699_100677336 3300005518 Bacteria 942
76 Ga0070697_100079666 3300005536 Bacteria 2697
77 Ga0070697_100097391 3300005536 Bacteria 2441
78 Ga0070697_100152396 3300005536 Bacteria 1949
79 Ga0070697_100720662 3300005536 Bacteria 881
80 Ga0068853_100764850 3300005539 Bacteria 924
81 Ga0068853_102249747 3300005539 Bacteria 528
82 Ga0070695_100093345 3300005545 Bacteria 2014
83 Ga0070696_100061223 3300005546 Bacteria 2633
84 Ga0070665_100006644 3300005548 Bacteria 11758
85 Ga0070665_100080394 3300005548 Bacteria 3265
86 Ga0070665_100374202 3300005548 Bacteria 1431
87 Ga0070665_100680351 3300005548 Bacteria 1042
88 Ga0070665_100972565 3300005548 Unclassified 861
89 Ga0070704_100062636 3300005549 Bacteria 2667
90 Ga0070704_101088818 3300005549 Unclassified 725
91 Ga0068856_100789689 3300005614 Bacteria 969
92 Ga0068852_100064911 3300005616 Bacteria 3184
93 Ga0068852_102305404 3300005616 Bacteria 559
94 Ga0068864_101111748 3300005618 Bacteria 787
95 Ga0068866_10955796 3300005718 Bacteria 606
96 Ga0068861_100037191 3300005719 Bacteria 3618
97 Ga0068861_100074237 3300005719 Bacteria 2644
98 Ga0068861_100453376 3300005719 Bacteria 1150
99 Ga0068861_101179429 3300005719 Bacteria 739
100 Ga0068861_101750073 3300005719 Bacteria 616
101 Ga0068861_102593659 3300005719 Bacteria 511
102 Ga0068851_10961323 3300005834 Bacteria 537
103 Ga0068863_100150222 3300005841 Bacteria 2229
104 Ga0068860_100019390 3300005843 Bacteria 6596
105 Ga0068860_100389268 3300005843 Bacteria 1377
106 Ga0068860_100448401 3300005843 Bacteria 1283
107 Ga0068860_101423814 3300005843 Bacteria 714
108 Ga0068860_102717101 3300005843 Bacteria 513
109 Ga0068862_100012728 3300005844 Bacteria 6963
110 Ga0068862_100190430 3300005844 Bacteria 1845
111 Ga0068862_100266425 3300005844 Bacteria 1565
112 Ga0068862_100287451 3300005844 Bacteria 1509
113 Ga0068862_100532200 3300005844 Bacteria 1120
114 Ga0068862_100542401 3300005844 Bacteria 1109
115 Ga0068862_101077521 3300005844 Bacteria 798
116 Ga0081455_10001122 3300005937 Bacteria 33467
117 Ga0081455_10018306 3300005937 Bacteria 6678
118 Ga0081455_10201674 3300005937 Bacteria 1489
119 Ga0081455_10248549 3300005937 Bacteria 1302
120 Ga0081455_10337640 3300005937 Bacteria 1067
121 Ga0081540_1000537 3300005983 Bacteria 36699
122 Ga0081540_1001429 3300005983 Bacteria 20644
123 Ga0081540_1001458 3300005983 Bacteria 20433
124 Ga0081540_1001570 3300005983 Bacteria 19515
125 Ga0081540_1003186 3300005983 Bacteria 13060
126 Ga0081540_1004038 3300005983 Bacteria 11365
127 Ga0081540_1007669 3300005983 Bacteria 7652
128 Ga0081540_1011636 3300005983 Bacteria 5867
129 Ga0081540_1013383 3300005983 Bacteria 5335
130 Ga0081540_1016608 3300005983 Bacteria 4596
131 Ga0081540_1024693 3300005983 Bacteria 3481
132 Ga0081540_1024767 3300005983 Bacteria 3474
133 Ga0081540_1034720 3300005983 Bacteria 2714
134 Ga0081540_1040616 3300005983 Bacteria 2422
135 Ga0081540_1043031 3300005983 Bacteria 2322
136 Ga0081540_1056233 3300005983 Bacteria 1911
137 Ga0081540_1072083 3300005983 Bacteria 1593
138 Ga0081540_1129235 3300005983 Bacteria 1034
139 Ga0070717_10834129 3300006028 Bacteria 839
140 Ga0070717_10888895 3300006028 Bacteria 811
141 Ga0075365_10007043 3300006038 Bacteria 6261
142 Ga0075365_10083553 3300006038 Bacteria 2166
143 Ga0075365_10154786 3300006038 Bacteria 1595
144 Ga0075365_10417326 3300006038 Bacteria 947
145 Ga0075368_10177427 3300006042 Bacteria 897
146 Ga0075363_100753189 3300006048 Bacteria 590
147 Ga0075364_10202128 3300006051 Bacteria 1347
148 Ga0075364_10352485 3300006051 Bacteria 1003
149 Ga0070715_10091841 3300006163 Unclassified 1399
150 Ga0070716_100024782 3300006173 Bacteria 3196
151 Ga0070712_100006325 3300006175 Bacteria 7342
152 Ga0070712_101889846 3300006175 Unclassified 523
153 Ga0075362_10032232 3300006177 Bacteria 2273
154 Ga0075362_10608274 3300006177 Bacteria 565
155 Ga0075367_10017835 3300006178 Bacteria 3904
156 Ga0075367_10028849 3300006178 Bacteria 3169
157 Ga0075367_10234581 3300006178 Bacteria 1149
158 Ga0075367_10629834 3300006178 Bacteria 682
159 Ga0075367_10922883 3300006178 Bacteria 557
160 Ga0075369_10000085 3300006186 Bacteria 24796
161 Ga0075369_10071776 3300006186 Bacteria 1524
162 Ga0075369_10095730 3300006186 Bacteria 1328
163 Ga0075369_10420412 3300006186 Bacteria 631
164 Ga0075366_10113247 3300006195 Bacteria 1633
165 Ga0075366_10191426 3300006195 Bacteria 1243
166 Ga0075370_10004214 3300006353 Bacteria 6946
167 Ga0075370_10018890 3300006353 Bacteria 3744
168 Ga0075370_10081880 3300006353 Bacteria 1856
169 Ga0075370_10220938 3300006353 Bacteria 1120
170 Ga0075370_10228467 3300006353 Bacteria 1101
171 Ga0075370_10648075 3300006353 Bacteria 641
172 Ga0068871_101138848 3300006358 Bacteria 730
173 Ga0075428_100080479 3300006844 Bacteria 3555
174 Ga0075430_100376194 3300006846 Bacteria 1172
175 Ga0097620_101002471 3300006931 Unclassified 917
176 Ga0099823_1000409 3300006944 Bacteria 27729
177 Ga0099794_10062486 3300007265 Bacteria 1811
178 Ga0099794_10186221 3300007265 Unclassified 1061
179 Ga0099795_10009016 3300007788 Plasmid 2877
180 Ga0099795_10179758 3300007788 Bacteria 883
181 Ga0099795_10191184 3300007788 Unclassified 859
182 Ga0099795_10458597 3300007788 Unclassified 588
183 Ga0099795_10573441 3300007788 Unclassified 534
184 Ga0105250_10291857 3300009092 Bacteria 704
185 Ga0105250_10552083 3300009092 Bacteria 529
186 Ga0105240_11255219 3300009093 Bacteria 783
187 Ga0111539_10575836 3300009094 Bacteria 1311
188 Ga0111539_11527290 3300009094 Bacteria 774
189 Ga0105245_10159390 3300009098 Bacteria 2140
190 Ga0105245_11233924 3300009098 Bacteria 796
191 Ga0105247_10429986 3300009101 Bacteria 947
192 Ga0105247_10448234 3300009101 Bacteria 930
193 Ga0114129_11104439 3300009147 Bacteria 993
194 Ga0105243_10034719 3300009148 Bacteria 3907
195 Ga0105243_10430612 3300009148 Bacteria 1233
196 Ga0105242_11139991 3300009176 Bacteria 796
197 Ga0105237_10168679 3300009545 Bacteria 2188
198 Ga0105237_10921843 3300009545 Bacteria 881
199 Ga0105237_12404636 3300009545 Bacteria 537
200 Ga0105237_12579431 3300009545 Bacteria 519
201 Ga0105249_10161484 3300009553 Bacteria 2166
202 Ga0105249_10166676 3300009553 Bacteria 2133
203 Ga0105249_10301578 3300009553 Bacteria 1607
204 Ga0105249_10436711 3300009553 Bacteria 1346
205 Ga0105249_10598387 3300009553 Bacteria 1157
206 Ga0105249_11973536 3300009553 Bacteria 656
207 Ga0099796_10004855 3300010159 Bacteria 3298
208 Ga0099796_10025769 3300010159 Bacteria 1861
209 Ga0099796_10127461 3300010159 Bacteria 984
210 Ga0099796_10147545 3300010159 Bacteria 924
211 Ga0099796_10185341 3300010159 Bacteria 837
212 Ga0099796_10235668 3300010159 Bacteria 755
213 Ga0099796_10258451 3300010159 Unclassified 726
214 Ga0099796_10436824 3300010159 Bacteria 580
215 Ga0099796_10475763 3300010159 Bacteria 558
216 Ga0105239_10026464 3300010375 Bacteria 6383
217 Ga0105239_10186403 3300010375 Bacteria 2322
218 Ga0105239_10902442 3300010375 Bacteria 1014
219 Ga0105239_11337665 3300010375 Bacteria 827
220 Ga0105239_11690867 3300010375 Bacteria 732
221 Ga0105239_12460220 3300010375 Bacteria 607
222 Ga0105246_10068739 3300011119 Bacteria 2485
223 Ga0105246_10975396 3300011119 Unclassified 765
224 Ga0157370_10836466 3300013104 Bacteria 837
225 Ga0157374_10270450 3300013296 Bacteria 1675
226 Ga0157378_10876478 3300013297 Bacteria 927
227 Ga0163162_10059268 3300013306 Bacteria 3859
228 Ga0163162_10144326 3300013306 Bacteria 2495
229 Ga0163162_10257688 3300013306 Bacteria 1876
230 Ga0163162_10838774 3300013306 Bacteria 1035
231 Ga0163162_12950766 3300013306 Bacteria 547
232 Ga0157375_11821330 3300013308 Bacteria 722
233 Ga0163163_10482371 3300014325 Bacteria 1301
234 Ga0163163_12805797 3300014325 Unclassified 544
235 Ga0157380_12183870 3300014326 Bacteria 617
236 Ga0157379_10028712 3300014968 Bacteria 4947
237 Ga0157379_10551672 3300014968 Bacteria 1072
238 Ga0182005_1141650 3300015265 Unclassified 695
239 Ga0163161_10041846 3300017792 Bacteria 3293
240 Ga0213872_10071265 3300021361 Bacteria 1567
241 Ga0213874_10021796 3300021377 Bacteria 1771
242 Ga0213871_10170021 3300021441 Bacteria 670
243 Ga0213871_10239272 3300021441 Bacteria 574
244 Ga0228598_1112391 3300024227 Unclassified 551
245 Ga0209563_115192 3300025230 Bacteria 970
246 Ga0209026_1056680 3300025250 Bacteria 553
247 Ga0209677_101774 3300025253 Bacteria 8921
248 Ga0209564_1008190 3300025295 Bacteria 5219
249 Ga0209758_1002841 3300025297 Bacteria 16832
250 Ga0209758_1004616 3300025297 Bacteria 11306
251 Ga0209758_1056918 3300025297 Bacteria 1317
252 Ga0209758_1095318 3300025297 Bacteria 860
253 Ga0209256_1024045 3300025299 Bacteria 1802
254 Ga0207426_1000237 3300025302 Bacteria 124707
255 Ga0209051_1152695 3300025303 Bacteria 539
256 Ga0209257_1013515 3300025304 Bacteria 3620
257 Ga0207656_10348033 3300025321 Bacteria 739
258 Ga0207642_10854068 3300025899 Bacteria 581
259 Ga0207688_11044053 3300025901 Unclassified 516
260 Ga0207647_10033140 3300025904 Bacteria 3311
261 Ga0207699_10001088 3300025906 Bacteria 12830
262 Ga0207643_10396210 3300025908 Bacteria 872
263 Ga0207705_10098200 3300025909 Bacteria 2151
264 Ga0207684_10286502 3300025910 Unclassified 1420
265 Ga0207671_10056430 3300025914 Bacteria 2910
266 Ga0207671_10194019 3300025914 Bacteria 1584
267 Ga0207693_10001127 3300025915 Bacteria 23971
268 Ga0207693_10602203 3300025915 Bacteria 855
269 Ga0207646_10388994 3300025922 Bacteria 1260
270 Ga0207646_10647662 3300025922 Bacteria 947
271 Ga0207681_10029964 3300025923 Bacteria 3543
272 Ga0207681_10169720 3300025923 Bacteria 1653
273 Ga0207687_10593099 3300025927 Bacteria 933
274 Ga0207700_10072031 3300025928 Bacteria 2663
275 Ga0207664_10020925 3300025929 Bacteria 4855
276 Ga0207644_10312599 3300025931 Bacteria 1269
277 Ga0207690_11233648 3300025932 Bacteria 624
278 Ga0207690_11675192 3300025932 Bacteria 531
279 Ga0207706_10119635 3300025933 Bacteria 2316
280 Ga0207706_10224369 3300025933 Bacteria 1645
281 Ga0207706_11312242 3300025933 Bacteria 598
282 Ga0207709_11152907 3300025935 Bacteria 638
283 Ga0207669_10256259 3300025937 Bacteria 1306
284 Ga0207665_10034187 3300025939 Bacteria 3373
285 Ga0207691_11077091 3300025940 Unclassified 669
286 Ga0207689_10002319 3300025942 Bacteria 17836
287 Ga0207689_10058508 3300025942 Bacteria 3170
288 Ga0207689_10238726 3300025942 Bacteria 1502
289 Ga0207689_11411156 3300025942 Bacteria 583
290 Ga0207661_11726829 3300025944 Bacteria 571
291 Ga0207679_11843514 3300025945 Unclassified 552
292 Ga0207712_10127097 3300025961 Bacteria 1937
293 Ga0207712_10145202 3300025961 Bacteria 1826
294 Ga0207712_10263986 3300025961 Bacteria 1398
295 Ga0207712_11679952 3300025961 Unclassified 569
296 Ga0207712_12005621 3300025961 Bacteria 518
297 Ga0207668_10000974 3300025972 Bacteria 17209
298 Ga0207668_10135925 3300025972 Bacteria 1884
299 Ga0207668_10151191 3300025972 Bacteria 1797
300 Ga0207668_10157242 3300025972 Unclassified 1767
301 Ga0207668_10201984 3300025972 Bacteria 1583
302 Ga0207668_10445048 3300025972 Bacteria 1104
303 Ga0207668_10748181 3300025972 Bacteria 862
304 Ga0207668_10763803 3300025972 Bacteria 853
305 Ga0207668_11109179 3300025972 Bacteria 709
306 Ga0207668_11233224 3300025972 Bacteria 672
307 Ga0207668_11349799 3300025972 Bacteria 642
308 Ga0207658_10187590 3300025986 Bacteria 1716
309 Ga0207658_10319177 3300025986 Bacteria 1344
310 Ga0207658_12149429 3300025986 Bacteria 507
311 Ga0207677_10361369 3300026023 Bacteria 1220
312 Ga0207677_10455391 3300026023 Bacteria 1097
313 Ga0207677_11221932 3300026023 Unclassified 688
314 Ga0207677_11779249 3300026023 Bacteria 572
315 Ga0207639_10549351 3300026041 Bacteria 1060
316 Ga0207639_10576505 3300026041 Bacteria 1035
317 Ga0207678_10035523 3300026067 Bacteria 4339
318 Ga0207678_10067264 3300026067 Bacteria 3075
319 Ga0207678_10481685 3300026067 Bacteria 1080
320 Ga0207678_11185368 3300026067 Bacteria 676
321 Ga0207678_11958780 3300026067 Unclassified 510
322 Ga0207708_10026915 3300026075 Bacteria 4354
323 Ga0207641_10083985 3300026088 Bacteria 2771
324 Ga0207648_11375600 3300026089 Bacteria 663
325 Ga0207675_100000292 3300026118 Bacteria 48260
326 Ga0207675_100002084 3300026118 Bacteria 19874
327 Ga0207675_100052391 3300026118 Bacteria 3808
328 Ga0207675_100191951 3300026118 Bacteria 1959
329 Ga0207675_100665203 3300026118 Bacteria 1048
330 Ga0207675_100969014 3300026118 Bacteria 868
331 Ga0207675_101392656 3300026118 Bacteria 722
332 Ga0207675_102000046 3300026118 Bacteria 597
333 Ga0207683_10161334 3300026121 Bacteria 2027
334 Ga0207698_11595354 3300026142 Bacteria 668
335 Ga0209389_1000111 3300027296 Bacteria 72517
336 Ga0209489_100220 3300027361 Bacteria 95167
337 Ga0209700_100041 3300027363 Bacteria 168380
338 Ga0209179_1007728 3300027512 Bacteria 1785
339 Ga0209179_1020676 3300027512 Bacteria 1279
340 Ga0209179_1033781 3300027512 Bacteria 1059
341 Ga0209179_1143562 3300027512 Unclassified 533
342 Ga0209179_1151061 3300027512 Unclassified 519
343 Ga0209588_1001077 3300027671 Bacteria 6998
344 Ga0209588_1004743 3300027671 Bacteria 3858
345 Ga0209813_10051131 3300027866 Bacteria 1291
346 Ga0209813_10437054 3300027866 Bacteria 533
347 Ga0268266_10036157 3300028379 Bacteria 4202
348 Ga0268266_10118498 3300028379 Bacteria 2353
349 Ga0268266_10129209 3300028379 Bacteria 2258
350 Ga0268266_11304884 3300028379 Unclassified 701
351 Ga0268266_11419139 3300028379 Bacteria 670
352 Ga0268265_10007544 3300028380 Bacteria 7342
353 Ga0268265_10025786 3300028380 Bacteria 4176
354 Ga0268265_10262817 3300028380 Bacteria 1535
355 Ga0268265_10319190 3300028380 Bacteria 1406
356 Ga0268265_10454083 3300028380 Bacteria 1197
357 Ga0268265_10797024 3300028380 Bacteria 920
358 Ga0268265_11089910 3300028380 Bacteria 792
359 Ga0268265_12056355 3300028380 Bacteria 578
360 Ga0268264_10095897 3300028381 Bacteria 2568
361 Ga0268264_10151711 3300028381 Bacteria 2078
362 Ga0268264_11039525 3300028381 Bacteria 826
363 Ga0268264_11300628 3300028381 Bacteria 737
364 Ga0268264_11460622 3300028381 Bacteria 694
365 Ga0307517_10558529 3300028786 Bacteria 571
366 Ga0265314_10252709 3300031711 Bacteria 1011
367 Ga0307405_10344593 3300031731 Bacteria 1147
368 Ga0307413_10147834 3300031824 Bacteria 1633
369 Ga0326468_10075572 3300031889 Unclassified 570
370 Ga0307406_10023908 3300031901 Bacteria 3643
371 Ga0307409_100196042 3300031995 Bacteria 1802
372 Ga0307416_103629361 3300032002 Bacteria 516
373 Ga0307411_11151051 3300032005 Bacteria 701
374 Ga0307415_100093579 3300032126 Bacteria 2183
375 Ga0307415_100726357 3300032126 Bacteria 899
376 Ga0307415_101131851 3300032126 Bacteria 734
377 Ga0307510_10023418 3300033180 Bacteria 7158
378 Ga0373929_0182493 3300035085 Unclassified 579
379 Ga0373923_0495098 3300035111 Bacteria 596
380 Ga0395905_0119259 3300037471 Bacteria 2479
381 Ga0436364_0033021 3300037853 Bacteria 1217
382 Ga0436364_1464438 3300037853 Bacteria 1748
383 Ga0436360_0694609 3300039438 Bacteria 1007
384 Ga0436360_0775814 3300039438 Bacteria 914
385 Ga0436360_1002729 3300039438 Bacteria 1391
386 Ga0436360_1041418 3300039438 Bacteria 4035
387 Ga0436360_1147395 3300039438 Bacteria 1230
388 Ga0436360_1233842 3300039438 Bacteria 784
389 Ga0436361_0094480 3300039447 Bacteria 2570
390 Ga0436361_0166896 3300039447 Bacteria 643
391 Ga0436361_0207409 3300039447 Unclassified 758
392 Ga0436361_0257034 3300039447 Bacteria 729
393 Ga0436361_0348793 3300039447 Bacteria 1028
394 Ga0436361_0574455 3300039447 Bacteria 1715
395 Ga0436361_0609475 3300039447 Bacteria 2538
396 Ga0436361_0778974 3300039447 Bacteria 1846
397 Ga0436361_0836635 3300039447 Bacteria 1278
398 Ga0436361_0888936 3300039447 Bacteria 1261
399 Ga0436361_1213965 3300039447 Bacteria 607
400 Ga0436363_0344498 3300039450 Bacteria 625
401 Ga0436363_0409156 3300039450 Unclassified 840
402 Ga0436363_0847268 3300039450 Bacteria 939
403 Ga0436363_0950339 3300039450 Bacteria 775
404 Ga0436363_1050913 3300039450 Bacteria 1257
405 Ga0436362_0768814 3300039453 Bacteria 507
406 Ga0451791_0755109 3300041451 Unclassified 921
407 Ga0451797_0024858 3300041453 Bacteria 591
408 Ga0451797_0807360 3300041453 Bacteria 961
409 Ga0451802_0746896 3300041460 Bacteria 637
410 Ga0451807_0505980 3300041486 Bacteria 774
411 Ga0451807_1285822 3300041486 Bacteria 1218
412 Ga0451853_0257560 3300041512 Bacteria 876
413 Ga0451853_1919044 3300041512 Bacteria 621
414 Ga0495651_0012427 3300046462 Bacteria 6566
415 Ga0495653_0091288 3300046463 Bacteria 2227
416 Ga0495650_0062483 3300046471 Bacteria 1488
417 Ga0495664_0218164 3300046477 Bacteria 1155
418 Ga0495584_0367083 3300046491 Bacteria 731
419 Ga0495596_0327544 3300046500 Bacteria 596
420 Ga0495607_0275113 3300046501 Bacteria 801
421 Ga0495606_0029681 3300046507 Bacteria 3834
422 Ga0495606_0195694 3300046507 Bacteria 1156
423 Ga0495610_0038267 3300046512 Bacteria 2436
424 Ga0495616_0449556 3300046513 Unclassified 522
425 Ga0495631_0070858 3300046518 Bacteria 1507
426 Ga0495648_0088554 3300046524 Bacteria 1740
427 Ga0495652_0013893 3300046529 Bacteria 7242
428 Ga0495640_0179264 3300046533 Bacteria 1351
429 Ga0495587_0133640 3300046536 Bacteria 1417
430 Ga0495598_0091747 3300046537 Bacteria 992
431 Ga0495645_0777995 3300046543 Bacteria 576
432 Ga0495656_0070148 3300046615 Bacteria 1554
433 Ga0495656_0181030 3300046615 Unclassified 1036
434 Ga0495668_0067288 3300046616 Bacteria 1971
435 Ga0495634_0335451 3300046642 Bacteria 908
436 Ga0495625_0432123 3300046660 Bacteria 817
437 Ga0495625_0675713 3300046660 Unclassified 612
438 Ga0495657_0234353 3300046675 Bacteria 1109
439 Ga0495669_0254134 3300046684 Bacteria 844
440 Ga0495649_0160021 3300046694 Bacteria 1181
441 Ga0495600_0255472 3300046809 Bacteria 1114
442 Ga0495604_0183010 3300047317 Bacteria 1465
443 Ga0495672_0056059 3300047320 Bacteria 2296
444 Ga0495672_0067182 3300047320 Bacteria 2043
445 Ga0495676_0432514 3300047321 Unclassified 870
446 Ga0495680_0320216 3300047322 Bacteria 1085
447 Ga0495686_0137489 3300047472 Bacteria 1444
448 Ga0495686_0213438 3300047472 Unclassified 1101
449 Ga0495686_0331037 3300047472 Unclassified 832
450 Ga0495602_0069899 3300048088 Bacteria 3008
451 Ga0496101_1047400 3300048904 Unclassified 641
452 Ga0496101_1519113 3300048904 Unclassified 521
453 Ga0496102_0886855 3300048905 Bacteria 814
454 Ga0496103_0097147 3300048906 Bacteria 1862
455 Ga0496103_0321170 3300048906 Bacteria 996
456 Ga0496103_0458127 3300048906 Bacteria 818
457 Ga0496104_0219431 3300048907 Bacteria 1814
458 Ga0496105_0122280 3300048908 Bacteria 2146
459 Ga0496105_0279409 3300048908 Bacteria 1347
460 Ga0496106_0161795 3300048909 Bacteria 1771
461 Ga0496106_0587165 3300048909 Bacteria 893
462 Ga0496106_0803240 3300048909 Bacteria 746
463 Ga0496106_1479465 3300048909 Bacteria 523
464 Ga0496108_0039345 3300048911 Bacteria 3942
465 Ga0496108_0499287 3300048911 Bacteria 1063
466 Ga0496109_0317598 3300048912 Bacteria 1470
467 Ga0496109_1359255 3300048912 Unclassified 646
468 Ga0496110_0142988 3300048913 Bacteria 2163
469 Ga0496110_1167388 3300048913 Bacteria 679
470 Ga0496112_0138740 3300048915 Bacteria 2401
471 Ga0496114_0063402 3300048917 Bacteria 3094
472 Ga0496115_0366926 3300048918 Bacteria 1172
473 Ga0496115_0503485 3300048918 Unclassified 973
474 Ga0496116_0265603 3300048919 Bacteria 843
475 Ga0496117_0364226 3300048920 Bacteria 742
476 Ga0496118_0020399 3300048921 Bacteria 5877
477 Ga0496118_0499856 3300048921 Unclassified 605
478 Ga0496119_0096153 3300048922 Bacteria 1672
479 Ga0496119_0148123 3300048922 Bacteria 1260
480 Ga0496119_0150788 3300048922 Bacteria 1246
481 Ga0496120_0029052 3300048923 Bacteria 3379
482 Ga0496121_0007361 3300048924 Bacteria 13306
483 Ga0496121_0035562 3300048924 Bacteria 4462
484 Ga0496121_0144772 3300048924 Unclassified 1757
485 Ga0496121_0263552 3300048924 Bacteria 1188
486 Ga0496122_0612983 3300048925 Bacteria 507
487 Ga0496124_0310949 3300048927 Bacteria 1133
488 Ga0496124_0603811 3300048927 Bacteria 713
489 Ga0496125_0009470 3300048928 Bacteria 9999
490 Ga0496125_0221000 3300048928 Bacteria 1221
491 Ga0496126_0201335 3300048929 Bacteria 1681
492 Ga0496126_0476050 3300048929 Bacteria 1001
493 Ga0501036_0939414 3300049572 Bacteria 709
494 Ga0501042_0480032 3300049578 Bacteria 902
495 Ga0501071_1408914 3300049587 Unclassified 538
496 Ga0501074_0431877 3300049590 Bacteria 934
497 Ga0501075_0043594 3300049591 Bacteria 3365
498 Ga0501076_0258081 3300049592 Bacteria 1427
499 Ga0501077_0120657 3300049593 Bacteria 1661
500 Ga0501079_0216627 3300049741 Bacteria 1495
501 nmdc:mga03683_26976_c1 3300050489 Bacteria 2271
502 nmdc:mga03683_3056_c2 3300050489 Bacteria 4575
503 nmdc:mga03683_651845_c1 3300050489 Unclassified 518
504 nmdc:mga00v17_297068_c1 3300050491 Bacteria 1049
505 nmdc:mga00v17_73006_c1 3300050491 Bacteria 2130
506 nmdc:mga00v17_850805_c1 3300050491 Unclassified 579
507 nmdc:mga0yw44_11934_c1 3300050492 Bacteria 4509
508 nmdc:mga0yw44_1835_c1 3300050492 Bacteria 8713
509 nmdc:mga0yw44_39024_c1 3300050492 Bacteria 2813
510 nmdc:mga0yw44_42017_c1 3300050492 Bacteria 2724
511 nmdc:mga0k408_94169_c1 3300050493 Bacteria 1761
512 nmdc:mga06z11_12407_c1 3300050494 Bacteria 3705
513 nmdc:mga06z11_14155_c1 3300050494 Bacteria 3526
514 nmdc:mga06z11_158041_c1 3300050494 Bacteria 1294
515 nmdc:mga06z11_207153_c1 3300050494 Bacteria 1141
516 nmdc:mga06z11_37564_c1 3300050494 Bacteria 2399
517 nmdc:mga06z11_847341_c1 3300050494 Bacteria 557
518 nmdc:mga04h51_410086_c1 3300050495 Bacteria 568
519 nmdc:mga04h51_84255_c1 3300050495 Bacteria 1133
520 nmdc:mga07m45_28356_c1 3300050496 Bacteria 3090
521 nmdc:mga07m45_42484_c1 3300050496 Bacteria 2548
522 nmdc:mga07m45_679845_c1 3300050496 Bacteria 592
523 nmdc:mga07m45_76449_c1 3300050496 Bacteria 1909
524 nmdc:mga05p37_1469142_c1 3300050507 Unclassified 681
525 nmdc:mga0qj67_420814_c1 3300050509 Bacteria 1077
526 nmdc:mga0sz30_432746_c1 3300050516 Bacteria 590
527 nmdc:mga0sz30_5993_c3 3300050516 Bacteria 1408
528 nmdc:mga0sz30_670_c1 3300050516 Bacteria 12636
529 nmdc:mga0sz30_95591_c1 3300050516 Bacteria 1296
530 Ga0500610_0134709 3300053079 Bacteria 1253
531 Ga0495619_0231417 3300053085 Bacteria 1280
532 Ga0500578_0029278 3300053086 Bacteria 3537
533 Ga0500578_0076379 3300053086 Bacteria 2133
534 Ga0500643_029973 3300053087 Bacteria 1670
535 Ga0500646_0134974 3300053090 Bacteria 805
536 Ga0500651_0034756 3300053093 Bacteria 3177
537 Ga0500566_0000029 3300053094 Bacteria 75384
538 Ga0500556_0098192 3300053104 Bacteria 1125
539 Ga0500562_026548 3300053108 Bacteria 1518
540 Ga0500562_208909 3300053108 Unclassified 528
541 Ga0500608_095575 3300053122 Bacteria 1383
542 Ga0500652_005050 3300053131 Bacteria 4125
543 Ga0500577_0370203 3300053142 Bacteria 627
544 Ga0500603_048928 3300053150 Bacteria 1151
545 Ga0500604_0035034 3300053151 Bacteria 1492
546 Ga0500622_0003040 3300053156 Bacteria 11589
547 Ga0500633_0323921 3300053160 Bacteria 564
548 Ga0500638_294503 3300053162 Bacteria 629
549 Ga0500636_0324819 3300053177 Bacteria 746
550 Ga0500636_0446299 3300053177 Unclassified 586
551 Ga0500645_017379 3300053730 Bacteria 2256
552 Ga0500609_028257 3300053731 Bacteria 769
553 Ga0500599_000276 3300053736 Bacteria 4968
554 Ga0500601_000316 3300053737 Bacteria 9001
555 Ga0501084_0762194 3300054114 Bacteria 815
556 Ga0500661_035451 3300055283 Bacteria 882
557 Ga0530510_0655813 3300061734 Unclassified 799

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100185441 Ga0070668_1001854412 60
2 3300005438 Ga0070701_10584593 Ga0070701_105845931 60
3 3300005539 Ga0068853_102249747 Ga0068853_1022497471 60
4 3300005549 Ga0070704_101088818 Ga0070704_1010888182 60
5 3300005843 Ga0068860_101423814 Ga0068860_1014238142 60
6 3300007788 Ga0099795_10573441 Ga0099795_105734411 60
7 3300009553 Ga0105249_10161484 Ga0105249_101614842 60
8 3300025901 Ga0207688_11044053 Ga0207688_110440531 60
9 3300025972 Ga0207668_10157242 Ga0207668_101572422 60
10 3300026118 Ga0207675_100665203 Ga0207675_1006652032 60
11 3300028381 Ga0268264_11460622 Ga0268264_114606222 60
12 3300041512 Ga0451853_1919044 Ga0451853_1919044_11_193 60
13 iso_pu_bacteria 2508501042 2508693894 63
14 iso_pu_bacteria 2513237095 2513651969 63
15 iso_pu_bacteria 2513237102 2513702765 63
16 iso_pu_bacteria 2513237104 2513722215 63
17 iso_pu_bacteria 2513237141 2513893767 63
18 iso_pu_bacteria 2517093001 2517101004 63
19 iso_pu_bacteria 2524023205 2524442547 63
20 iso_pu_bacteria 2744054633 2745075512 63
21 iso_pu_bacteria 2816332527 2818239183 63
22 iso_pu_bacteria 2824600985 2824604839 63
23 iso_pu_bacteria 2824609381 2824611409 63
24 iso_pu_bacteria 2824617872 2824620237 63
25 iso_pu_bacteria 2824626560 2824629502 63
26 iso_pu_bacteria 2824635225 2824635822 63
27 iso_pu_bacteria 2824644064 2824646124 63
28 iso_pu_bacteria 2824653114 2824656096 63
29 iso_pu_bacteria 2824704595 2824706481 63
30 iso_pu_bacteria 2824714736 2824716678 63
31 iso_pu_bacteria 2824723954 2824726635 63
32 iso_pu_bacteria 2824753945 2824757886 63
33 iso_pu_bacteria 2824763712 2824766982 63
34 iso_pu_bacteria 2841957949 2841961227 63
35 iso_pu_bacteria 2857509624 2857512490 63
36 iso_pu_bacteria 2874612657 2874617384 63
37 iso_pu_bacteria 2874628541 2874633814 63
38 iso_pu_bacteria 2879099564 2879106871 63
39 iso_pu_bacteria 2881364244 2881368288 63
40 iso_pu_bacteria 2881665667 2881667091 63
41 iso_pu_bacteria 2885409591 2885416148 63
42 iso_pu_bacteria 2888388044 2888389478 63
43 iso_pu_bacteria 2888419890 2888421638 63
44 iso_pu_bacteria 2903748898 2903752877 63
45 iso_pu_bacteria 2904690495 2904695356 63
46 iso_pu_bacteria 2904711408 2904712510 63
47 iso_pu_bacteria 2919073203 2919077102 63
48 iso_pu_bacteria 2932801729 2932801748 63
49 iso_pu_bacteria 2935608549 2935610148 63
50 iso_pu_bacteria 2935648319 2935650322 63
51 iso_pu_bacteria 2935656913 2935658469 63
52 iso_pu_bacteria 2935777560 2935778328 63
53 iso_pu_bacteria 2935819856 2935823308 63
54 iso_pu_bacteria 2935916978 2935923724 63
55 iso_pu_bacteria 2935984226 2935986033 63
56 iso_pu_bacteria 2936011229 2936013119 63
57 iso_pu_bacteria 2936019824 2936021794 63
58 iso_pu_bacteria 2936028420 2936030412 63
59 iso_pu_bacteria 2936046547 2936047988 63
60 iso_pu_bacteria 2936055302 2936057988 63
61 iso_pu_bacteria 3005710791 3005714708 63
62 iso_pu_bacteria 8016522445 8016529836 63
63 iso_pu_bacteria 8016530956 8016535070 63
64 iso_pu_bacteria 8016539877 8016548276 63
65 iso_pu_bacteria 8016548790 8016553849 63
66 iso_pu_bacteria 8016557553 8016562224 63
67 iso_pu_bacteria 8016566248 8016573413 63
68 iso_pu_bacteria 8016575299 8016577545 63
69 iso_pu_bacteria 8016595262 8016600039 63
70 iso_pu_bacteria 8016603502 8016610723 63
71 iso_pu_bacteria 8016613128 8016614208 63
72 iso_pu_bacteria 8016622563 8016626776 63
73 iso_pu_bacteria 8019530166 8019534825 63
74 iso_pu_bacteria 8019538911 8019544648 63
75 iso_pu_bacteria 8019547302 8019553887 63
76 iso_pu_bacteria 8019648815 8019659069 63
77 3300005983 Ga0081540_1043031 Ga0081540_10430312 66
78 3300010159 Ga0099796_10235668 Ga0099796_102356681 66
79 3300021441 Ga0213871_10239272 Ga0213871_102392722 66
80 3300027512 Ga0209179_1020676 Ga0209179_10206762 66
81 3300039438 Ga0436360_0775814 Ga0436360_0775814_604_804 66
82 3300047322 Ga0495680_0320216 Ga0495680_0320216_808_1008 66
83 3300003215 JGI25153J46596_10002686 JGI25153J46596_1000268610 67
84 3300003215 JGI25153J46596_10004447 JGI25153J46596_100044473 67
85 3300003320 rootH2_10124891 rootH2_101248912 67
86 3300003320 rootH2_10150455 rootH2_101504552 67
87 3300003320 rootH2_10343363 rootH2_103433632 67
88 3300003322 rootL2_10166156 rootL2_101661562 67
89 3300003322 rootL2_10217400 rootL2_102174002 67
90 3300003323 rootH1_10029805 rootH1_100298052 67
91 3300003354 JGI25160J50197_1000413 JGI25160J50197_100041317 67
92 3300003659 JGI25404J52841_10000012 JGI25404J52841_100000129 67
93 3300003659 JGI25404J52841_10033417 JGI25404J52841_100334172 67
94 3300003659 JGI25404J52841_10071834 JGI25404J52841_100718342 67
95 3300003659 JGI25404J52841_10117062 JGI25404J52841_101170622 67
96 3300003752 Ga0055539_1030993 Ga0055539_10309931 67
97 3300003771 Ga0055526_1094944 Ga0055526_10949442 67
98 3300005262 Ga0065165_1000342 Ga0065165_100034258 67
99 3300005262 Ga0065165_1054931 Ga0065165_10549312 67
100 3300005329 Ga0070683_101925011 Ga0070683_1019250112 67
101 3300005334 Ga0068869_100019259 Ga0068869_1000192594 67
102 3300005334 Ga0068869_101941787 Ga0068869_1019417872 67
103 3300005337 Ga0070682_100071824 Ga0070682_1000718242 67
104 3300005338 Ga0068868_101850693 Ga0068868_1018506932 67
105 3300005338 Ga0068868_101878884 Ga0068868_1018788842 67
106 3300005339 Ga0070660_101061407 Ga0070660_1010614071 67
107 3300005347 Ga0070668_100011014 Ga0070668_1000110144 67
108 3300005347 Ga0070668_100185900 Ga0070668_1001859002 67
109 3300005347 Ga0070668_100242177 Ga0070668_1002421772 67
110 3300005347 Ga0070668_100667169 Ga0070668_1006671692 67
111 3300005347 Ga0070668_101113761 Ga0070668_1011137612 67
112 3300005347 Ga0070668_101266818 Ga0070668_1012668182 67
113 3300005347 Ga0070668_101772583 Ga0070668_1017725832 67
114 3300005353 Ga0070669_100031584 Ga0070669_1000315842 67
115 3300005353 Ga0070669_100257383 Ga0070669_1002573832 67
116 3300005353 Ga0070669_101441262 Ga0070669_1014412621 67
117 3300005355 Ga0070671_100580532 Ga0070671_1005805322 67
118 3300005356 Ga0070674_100224052 Ga0070674_1002240522 67
119 3300005356 Ga0070674_101064862 Ga0070674_1010648622 67
120 3300005366 Ga0070659_101239161 Ga0070659_1012391612 67
121 3300005367 Ga0070667_100022148 Ga0070667_1000221482 67
122 3300005367 Ga0070667_100052299 Ga0070667_1000522993 67
123 3300005367 Ga0070667_102192086 Ga0070667_1021920862 67
124 3300005434 Ga0070709_10036722 Ga0070709_100367223 67
125 3300005435 Ga0070714_100058653 Ga0070714_1000586532 67
126 3300005436 Ga0070713_100055738 Ga0070713_1000557382 67
127 3300005437 Ga0070710_10035295 Ga0070710_100352953 67
128 3300005437 Ga0070710_10638966 Ga0070710_106389662 67
129 3300005437 Ga0070710_10667638 Ga0070710_106676382 67
130 3300005437 Ga0070710_11044626 Ga0070710_110446262 67
131 3300005439 Ga0070711_100074374 Ga0070711_1000743742 67
132 3300005439 Ga0070711_100124860 Ga0070711_1001248602 67
133 3300005441 Ga0070700_100012251 Ga0070700_1000122512 67
134 3300005444 Ga0070694_100086152 Ga0070694_1000861522 67
135 3300005445 Ga0070708_100593417 Ga0070708_1005934172 67
136 3300005455 Ga0070663_100354774 Ga0070663_1003547741 67
137 3300005455 Ga0070663_100655294 Ga0070663_1006552942 67
138 3300005455 Ga0070663_101380041 Ga0070663_1013800411 67
139 3300005456 Ga0070678_100150372 Ga0070678_1001503722 67
140 3300005457 Ga0070662_100313181 Ga0070662_1003131812 67
141 3300005457 Ga0070662_101750124 Ga0070662_1017501242 67
142 3300005458 Ga0070681_10376649 Ga0070681_103766492 67
143 3300005467 Ga0070706_100226248 Ga0070706_1002262482 67
144 3300005467 Ga0070706_101162190 Ga0070706_1011621902 67
145 3300005468 Ga0070707_100337097 Ga0070707_1003370972 67
146 3300005468 Ga0070707_101279140 Ga0070707_1012791402 67
147 3300005471 Ga0070698_100015349 Ga0070698_10001534913 67
148 3300005471 Ga0070698_100095757 Ga0070698_1000957573 67
149 3300005471 Ga0070698_100380999 Ga0070698_1003809992 67
150 3300005471 Ga0070698_100469306 Ga0070698_1004693062 67
151 3300005471 Ga0070698_100627065 Ga0070698_1006270652 67
152 3300005518 Ga0070699_100096667 Ga0070699_1000966672 67
153 3300005518 Ga0070699_100108840 Ga0070699_1001088402 67
154 3300005518 Ga0070699_100406205 Ga0070699_1004062052 67
155 3300005518 Ga0070699_100677336 Ga0070699_1006773362 67
156 3300005536 Ga0070697_100079666 Ga0070697_1000796662 67
157 3300005536 Ga0070697_100097391 Ga0070697_1000973912 67
158 3300005536 Ga0070697_100152396 Ga0070697_1001523962 67
159 3300005536 Ga0070697_100720662 Ga0070697_1007206622 67
160 3300005539 Ga0068853_100764850 Ga0068853_1007648501 67
161 3300005545 Ga0070695_100093345 Ga0070695_1000933452 67
162 3300005546 Ga0070696_100061223 Ga0070696_1000612232 67
163 3300005548 Ga0070665_100006644 Ga0070665_10000664412 67
164 3300005548 Ga0070665_100080394 Ga0070665_1000803942 67
165 3300005548 Ga0070665_100374202 Ga0070665_1003742022 67
166 3300005548 Ga0070665_100680351 Ga0070665_1006803512 67
167 3300005548 Ga0070665_100972565 Ga0070665_1009725651 67
168 3300005549 Ga0070704_100062636 Ga0070704_1000626363 67
169 3300005614 Ga0068856_100789689 Ga0068856_1007896892 67
170 3300005616 Ga0068852_100064911 Ga0068852_1000649113 67
171 3300005616 Ga0068852_102305404 Ga0068852_1023054042 67
172 3300005618 Ga0068864_101111748 Ga0068864_1011117481 67
173 3300005718 Ga0068866_10955796 Ga0068866_109557962 67
174 3300005719 Ga0068861_100037191 Ga0068861_1000371912 67
175 3300005719 Ga0068861_100074237 Ga0068861_1000742372 67
176 3300005719 Ga0068861_100453376 Ga0068861_1004533762 67
177 3300005719 Ga0068861_101179429 Ga0068861_1011794292 67
178 3300005719 Ga0068861_101750073 Ga0068861_1017500732 67
179 3300005719 Ga0068861_102593659 Ga0068861_1025936592 67
180 3300005834 Ga0068851_10961323 Ga0068851_109613232 67
181 3300005841 Ga0068863_100150222 Ga0068863_1001502222 67
182 3300005843 Ga0068860_100019390 Ga0068860_1000193902 67
183 3300005843 Ga0068860_100389268 Ga0068860_1003892682 67
184 3300005843 Ga0068860_100448401 Ga0068860_1004484012 67
185 3300005843 Ga0068860_102717101 Ga0068860_1027171012 67
186 3300005844 Ga0068862_100012728 Ga0068862_1000127286 67
187 3300005844 Ga0068862_100190430 Ga0068862_1001904302 67
188 3300005844 Ga0068862_100266425 Ga0068862_1002664252 67
189 3300005844 Ga0068862_100287451 Ga0068862_1002874512 67
190 3300005844 Ga0068862_100532200 Ga0068862_1005322002 67
191 3300005844 Ga0068862_100542401 Ga0068862_1005424012 67
192 3300005844 Ga0068862_101077521 Ga0068862_1010775212 67
193 3300005937 Ga0081455_10001122 Ga0081455_1000112214 67
194 3300005937 Ga0081455_10018306 Ga0081455_100183065 67
195 3300005937 Ga0081455_10201674 Ga0081455_102016742 67
196 3300005937 Ga0081455_10248549 Ga0081455_102485492 67
197 3300005937 Ga0081455_10337640 Ga0081455_103376402 67
198 3300005983 Ga0081540_1000537 Ga0081540_100053739 67
199 3300005983 Ga0081540_1001429 Ga0081540_100142910 67
200 3300005983 Ga0081540_1001458 Ga0081540_100145811 67
201 3300005983 Ga0081540_1001570 Ga0081540_10015704 67
202 3300005983 Ga0081540_1003186 Ga0081540_10031868 67
203 3300005983 Ga0081540_1004038 Ga0081540_10040388 67
204 3300005983 Ga0081540_1007669 Ga0081540_10076692 67
205 3300005983 Ga0081540_1011636 Ga0081540_10116363 67
206 3300005983 Ga0081540_1013383 Ga0081540_10133835 67
207 3300005983 Ga0081540_1016608 Ga0081540_10166087 67
208 3300005983 Ga0081540_1024693 Ga0081540_10246936 67
209 3300005983 Ga0081540_1024767 Ga0081540_10247677 67
210 3300005983 Ga0081540_1034720 Ga0081540_10347202 67
211 3300005983 Ga0081540_1040616 Ga0081540_10406162 67
212 3300005983 Ga0081540_1056233 Ga0081540_10562332 67
213 3300005983 Ga0081540_1072083 Ga0081540_10720832 67
214 3300005983 Ga0081540_1129235 Ga0081540_11292351 67
215 3300006028 Ga0070717_10834129 Ga0070717_108341292 67
216 3300006028 Ga0070717_10888895 Ga0070717_108888952 67
217 3300006038 Ga0075365_10007043 Ga0075365_100070434 67
218 3300006038 Ga0075365_10083553 Ga0075365_100835532 67
219 3300006038 Ga0075365_10154786 Ga0075365_101547862 67
220 3300006038 Ga0075365_10417326 Ga0075365_104173262 67
221 3300006042 Ga0075368_10177427 Ga0075368_101774272 67
222 3300006048 Ga0075363_100753189 Ga0075363_1007531892 67
223 3300006051 Ga0075364_10202128 Ga0075364_102021282 67
224 3300006051 Ga0075364_10352485 Ga0075364_103524852 67
225 3300006163 Ga0070715_10091841 Ga0070715_100918412 67
226 3300006173 Ga0070716_100024782 Ga0070716_1000247822 67
227 3300006175 Ga0070712_100006325 Ga0070712_1000063258 67
228 3300006175 Ga0070712_101889846 Ga0070712_1018898462 67
229 3300006177 Ga0075362_10032232 Ga0075362_100322322 67
230 3300006177 Ga0075362_10608274 Ga0075362_106082742 67
231 3300006178 Ga0075367_10017835 Ga0075367_100178352 67
232 3300006178 Ga0075367_10028849 Ga0075367_100288493 67
233 3300006178 Ga0075367_10234581 Ga0075367_102345812 67
234 3300006178 Ga0075367_10629834 Ga0075367_106298342 67
235 3300006178 Ga0075367_10922883 Ga0075367_109228832 67
236 3300006186 Ga0075369_10000085 Ga0075369_1000008523 67
237 3300006186 Ga0075369_10071776 Ga0075369_100717762 67
238 3300006186 Ga0075369_10095730 Ga0075369_100957302 67
239 3300006186 Ga0075369_10420412 Ga0075369_104204122 67
240 3300006195 Ga0075366_10113247 Ga0075366_101132472 67
241 3300006195 Ga0075366_10191426 Ga0075366_101914261 67
242 3300006353 Ga0075370_10004214 Ga0075370_100042147 67
243 3300006353 Ga0075370_10018890 Ga0075370_100188905 67
244 3300006353 Ga0075370_10081880 Ga0075370_100818802 67
245 3300006353 Ga0075370_10220938 Ga0075370_102209382 67
246 3300006353 Ga0075370_10228467 Ga0075370_102284671 67
247 3300006353 Ga0075370_10648075 Ga0075370_106480752 67
248 3300006358 Ga0068871_101138848 Ga0068871_1011388482 67
249 3300006844 Ga0075428_100080479 Ga0075428_1000804793 67
250 3300006846 Ga0075430_100376194 Ga0075430_1003761942 67
251 3300006931 Ga0097620_101002471 Ga0097620_1010024712 67
252 3300006944 Ga0099823_1000409 Ga0099823_10004099 67
253 3300007265 Ga0099794_10062486 Ga0099794_100624862 67
254 3300007265 Ga0099794_10186221 Ga0099794_101862212 67
255 3300007788 Ga0099795_10009016 Ga0099795_100090163 67
256 3300007788 Ga0099795_10179758 Ga0099795_101797582 67
257 3300007788 Ga0099795_10191184 Ga0099795_101911842 67
258 3300007788 Ga0099795_10458597 Ga0099795_104585972 67
259 3300009092 Ga0105250_10291857 Ga0105250_102918572 67
260 3300009092 Ga0105250_10552083 Ga0105250_105520832 67
261 3300009093 Ga0105240_11255219 Ga0105240_112552192 67
262 3300009094 Ga0111539_10575836 Ga0111539_105758362 67
263 3300009094 Ga0111539_11527290 Ga0111539_115272902 67
264 3300009098 Ga0105245_10159390 Ga0105245_101593902 67
265 3300009098 Ga0105245_11233924 Ga0105245_112339242 67
266 3300009101 Ga0105247_10429986 Ga0105247_104299862 67
267 3300009101 Ga0105247_10448234 Ga0105247_104482342 67
268 3300009147 Ga0114129_11104439 Ga0114129_111044391 67
269 3300009148 Ga0105243_10034719 Ga0105243_100347191 67
270 3300009148 Ga0105243_10430612 Ga0105243_104306122 67
271 3300009176 Ga0105242_11139991 Ga0105242_111399912 67
272 3300009545 Ga0105237_10168679 Ga0105237_101686792 67
273 3300009545 Ga0105237_10921843 Ga0105237_109218432 67
274 3300009545 Ga0105237_12404636 Ga0105237_124046362 67
275 3300009545 Ga0105237_12579431 Ga0105237_125794312 67
276 3300009553 Ga0105249_10166676 Ga0105249_101666762 67
277 3300009553 Ga0105249_10301578 Ga0105249_103015782 67
278 3300009553 Ga0105249_10436711 Ga0105249_104367111 67
279 3300009553 Ga0105249_10598387 Ga0105249_105983872 67
280 3300009553 Ga0105249_11973536 Ga0105249_119735362 67
281 3300010159 Ga0099796_10004855 Ga0099796_100048552 67
282 3300010159 Ga0099796_10025769 Ga0099796_100257692 67
283 3300010159 Ga0099796_10127461 Ga0099796_101274612 67
284 3300010159 Ga0099796_10147545 Ga0099796_101475451 67
285 3300010159 Ga0099796_10185341 Ga0099796_101853412 67
286 3300010159 Ga0099796_10258451 Ga0099796_102584511 67
287 3300010159 Ga0099796_10436824 Ga0099796_104368241 67
288 3300010159 Ga0099796_10475763 Ga0099796_104757632 67
289 3300010375 Ga0105239_10026464 Ga0105239_100264642 67
290 3300010375 Ga0105239_10186403 Ga0105239_101864033 67
291 3300010375 Ga0105239_10902442 Ga0105239_109024422 67
292 3300010375 Ga0105239_11337665 Ga0105239_113376652 67
293 3300010375 Ga0105239_11690867 Ga0105239_116908672 67
294 3300010375 Ga0105239_12460220 Ga0105239_124602202 67
295 3300011119 Ga0105246_10068739 Ga0105246_100687392 67
296 3300011119 Ga0105246_10975396 Ga0105246_109753962 67
297 3300013104 Ga0157370_10836466 Ga0157370_108364661 67
298 3300013296 Ga0157374_10270450 Ga0157374_102704502 67
299 3300013297 Ga0157378_10876478 Ga0157378_108764782 67
300 3300013306 Ga0163162_10059268 Ga0163162_100592682 67
301 3300013306 Ga0163162_10144326 Ga0163162_101443262 67
302 3300013306 Ga0163162_10257688 Ga0163162_102576882 67
303 3300013306 Ga0163162_10838774 Ga0163162_108387742 67
304 3300013306 Ga0163162_12950766 Ga0163162_129507662 67
305 3300013308 Ga0157375_11821330 Ga0157375_118213302 67
306 3300014325 Ga0163163_10482371 Ga0163163_104823711 67
307 3300014325 Ga0163163_12805797 Ga0163163_128057971 67
308 3300014326 Ga0157380_12183870 Ga0157380_121838702 67
309 3300014968 Ga0157379_10028712 Ga0157379_100287127 67
310 3300014968 Ga0157379_10551672 Ga0157379_105516721 67
311 3300015265 Ga0182005_1141650 Ga0182005_11416502 67
312 3300017792 Ga0163161_10041846 Ga0163161_100418462 67
313 3300021361 Ga0213872_10071265 Ga0213872_100712652 67
314 3300021377 Ga0213874_10021796 Ga0213874_100217962 67
315 3300021441 Ga0213871_10170021 Ga0213871_101700212 67
316 3300024227 Ga0228598_1112391 Ga0228598_11123912 67
317 3300025230 Ga0209563_115192 Ga0209563_1151922 67
318 3300025250 Ga0209026_1056680 Ga0209026_10566802 67
319 3300025253 Ga0209677_101774 Ga0209677_10177410 67
320 3300025295 Ga0209564_1008190 Ga0209564_10081903 67
321 3300025297 Ga0209758_1002841 Ga0209758_10028419 67
322 3300025297 Ga0209758_1004616 Ga0209758_100461611 67
323 3300025297 Ga0209758_1056918 Ga0209758_10569182 67
324 3300025297 Ga0209758_1095318 Ga0209758_10953182 67
325 3300025299 Ga0209256_1024045 Ga0209256_10240452 67
326 3300025302 Ga0207426_1000237 Ga0207426_100023750 67
327 3300025303 Ga0209051_1152695 Ga0209051_11526952 67
328 3300025304 Ga0209257_1013515 Ga0209257_10135153 67
329 3300025321 Ga0207656_10348033 Ga0207656_103480332 67
330 3300025899 Ga0207642_10854068 Ga0207642_108540682 67
331 3300025904 Ga0207647_10033140 Ga0207647_100331403 67
332 3300025906 Ga0207699_10001088 Ga0207699_100010885 67
333 3300025908 Ga0207643_10396210 Ga0207643_103962102 67
334 3300025909 Ga0207705_10098200 Ga0207705_100982002 67
335 3300025910 Ga0207684_10286502 Ga0207684_102865022 67
336 3300025914 Ga0207671_10056430 Ga0207671_100564302 67
337 3300025914 Ga0207671_10194019 Ga0207671_101940192 67
338 3300025915 Ga0207693_10001127 Ga0207693_1000112717 67
339 3300025915 Ga0207693_10602203 Ga0207693_106022032 67
340 3300025922 Ga0207646_10388994 Ga0207646_103889942 67
341 3300025922 Ga0207646_10647662 Ga0207646_106476622 67
342 3300025923 Ga0207681_10029964 Ga0207681_100299642 67
343 3300025923 Ga0207681_10169720 Ga0207681_101697202 67
344 3300025927 Ga0207687_10593099 Ga0207687_105930992 67
345 3300025928 Ga0207700_10072031 Ga0207700_100720313 67
346 3300025929 Ga0207664_10020925 Ga0207664_100209252 67
347 3300025931 Ga0207644_10312599 Ga0207644_103125992 67
348 3300025932 Ga0207690_11233648 Ga0207690_112336481 67
349 3300025932 Ga0207690_11675192 Ga0207690_116751922 67
350 3300025933 Ga0207706_10119635 Ga0207706_101196352 67
351 3300025933 Ga0207706_10224369 Ga0207706_102243692 67
352 3300025933 Ga0207706_11312242 Ga0207706_113122422 67
353 3300025935 Ga0207709_11152907 Ga0207709_111529072 67
354 3300025937 Ga0207669_10256259 Ga0207669_102562592 67
355 3300025939 Ga0207665_10034187 Ga0207665_100341872 67
356 3300025940 Ga0207691_11077091 Ga0207691_110770911 67
357 3300025942 Ga0207689_10002319 Ga0207689_100023192 67
358 3300025942 Ga0207689_10058508 Ga0207689_100585082 67
359 3300025942 Ga0207689_10238726 Ga0207689_102387262 67
360 3300025942 Ga0207689_11411156 Ga0207689_114111562 67
361 3300025944 Ga0207661_11726829 Ga0207661_117268292 67
362 3300025945 Ga0207679_11843514 Ga0207679_118435142 67
363 3300025961 Ga0207712_10127097 Ga0207712_101270972 67
364 3300025961 Ga0207712_10145202 Ga0207712_101452022 67
365 3300025961 Ga0207712_10263986 Ga0207712_102639862 67
366 3300025961 Ga0207712_11679952 Ga0207712_116799522 67
367 3300025961 Ga0207712_12005621 Ga0207712_120056212 67
368 3300025972 Ga0207668_10000974 Ga0207668_1000097416 67
369 3300025972 Ga0207668_10135925 Ga0207668_101359252 67
370 3300025972 Ga0207668_10151191 Ga0207668_101511912 67
371 3300025972 Ga0207668_10201984 Ga0207668_102019842 67
372 3300025972 Ga0207668_10445048 Ga0207668_104450482 67
373 3300025972 Ga0207668_10748181 Ga0207668_107481812 67
374 3300025972 Ga0207668_10763803 Ga0207668_107638032 67
375 3300025972 Ga0207668_11109179 Ga0207668_111091791 67
376 3300025972 Ga0207668_11233224 Ga0207668_112332242 67
377 3300025972 Ga0207668_11349799 Ga0207668_113497991 67
378 3300025986 Ga0207658_10187590 Ga0207658_101875902 67
379 3300025986 Ga0207658_10319177 Ga0207658_103191772 67
380 3300025986 Ga0207658_12149429 Ga0207658_121494292 67
381 3300026023 Ga0207677_10361369 Ga0207677_103613692 67
382 3300026023 Ga0207677_10455391 Ga0207677_104553912 67
383 3300026023 Ga0207677_11221932 Ga0207677_112219322 67
384 3300026023 Ga0207677_11779249 Ga0207677_117792492 67
385 3300026041 Ga0207639_10549351 Ga0207639_105493512 67
386 3300026041 Ga0207639_10576505 Ga0207639_105765051 67
387 3300026067 Ga0207678_10035523 Ga0207678_100355232 67
388 3300026067 Ga0207678_10067264 Ga0207678_100672642 67
389 3300026067 Ga0207678_10481685 Ga0207678_104816852 67
390 3300026067 Ga0207678_11185368 Ga0207678_111853682 67
391 3300026067 Ga0207678_11958780 Ga0207678_119587802 67
392 3300026075 Ga0207708_10026915 Ga0207708_100269152 67
393 3300026088 Ga0207641_10083985 Ga0207641_100839852 67
394 3300026089 Ga0207648_11375600 Ga0207648_113756001 67
395 3300026118 Ga0207675_100000292 Ga0207675_10000029226 67
396 3300026118 Ga0207675_100002084 Ga0207675_1000020842 67
397 3300026118 Ga0207675_100052391 Ga0207675_1000523914 67
398 3300026118 Ga0207675_100191951 Ga0207675_1001919512 67
399 3300026118 Ga0207675_100969014 Ga0207675_1009690142 67
400 3300026118 Ga0207675_101392656 Ga0207675_1013926562 67
401 3300026118 Ga0207675_102000046 Ga0207675_1020000462 67
402 3300026121 Ga0207683_10161334 Ga0207683_101613342 67
403 3300026142 Ga0207698_11595354 Ga0207698_115953541 67
404 3300027296 Ga0209389_1000111 Ga0209389_100011127 67
405 3300027361 Ga0209489_100220 Ga0209489_10022069 67
406 3300027363 Ga0209700_100041 Ga0209700_100041147 67
407 3300027512 Ga0209179_1007728 Ga0209179_10077281 67
408 3300027512 Ga0209179_1033781 Ga0209179_10337811 67
409 3300027512 Ga0209179_1143562 Ga0209179_11435622 67
410 3300027512 Ga0209179_1151061 Ga0209179_11510611 67
411 3300027671 Ga0209588_1001077 Ga0209588_10010776 67
412 3300027671 Ga0209588_1004743 Ga0209588_10047432 67
413 3300027866 Ga0209813_10051131 Ga0209813_100511312 67
414 3300027866 Ga0209813_10437054 Ga0209813_104370542 67
415 3300028379 Ga0268266_10036157 Ga0268266_100361572 67
416 3300028379 Ga0268266_10118498 Ga0268266_101184982 67
417 3300028379 Ga0268266_10129209 Ga0268266_101292092 67
418 3300028379 Ga0268266_11304884 Ga0268266_113048842 67
419 3300028379 Ga0268266_11419139 Ga0268266_114191392 67
420 3300028380 Ga0268265_10007544 Ga0268265_100075445 67
421 3300028380 Ga0268265_10025786 Ga0268265_100257862 67
422 3300028380 Ga0268265_10262817 Ga0268265_102628172 67
423 3300028380 Ga0268265_10319190 Ga0268265_103191902 67
424 3300028380 Ga0268265_10454083 Ga0268265_104540831 67
425 3300028380 Ga0268265_10797024 Ga0268265_107970242 67
426 3300028380 Ga0268265_11089910 Ga0268265_110899102 67
427 3300028380 Ga0268265_12056355 Ga0268265_120563552 67
428 3300028381 Ga0268264_10095897 Ga0268264_100958972 67
429 3300028381 Ga0268264_10151711 Ga0268264_101517112 67
430 3300028381 Ga0268264_11039525 Ga0268264_110395252 67
431 3300028381 Ga0268264_11300628 Ga0268264_113006282 67
432 3300028786 Ga0307517_10558529 Ga0307517_105585292 67
433 3300031711 Ga0265314_10252709 Ga0265314_102527092 67
434 3300031731 Ga0307405_10344593 Ga0307405_103445932 67
435 3300031824 Ga0307413_10147834 Ga0307413_101478342 67
436 3300031889 Ga0326468_10075572 Ga0326468_100755722 67
437 3300031901 Ga0307406_10023908 Ga0307406_100239082 67
438 3300031995 Ga0307409_100196042 Ga0307409_1001960421 67
439 3300032002 Ga0307416_103629361 Ga0307416_1036293612 67
440 3300032005 Ga0307411_11151051 Ga0307411_111510512 67
441 3300032126 Ga0307415_100093579 Ga0307415_1000935792 67
442 3300032126 Ga0307415_100726357 Ga0307415_1007263572 67
443 3300032126 Ga0307415_101131851 Ga0307415_1011318512 67
444 3300033180 Ga0307510_10023418 Ga0307510_100234186 67
445 3300035085 Ga0373929_0182493 Ga0373929_0182493_169_372 67
446 3300035111 Ga0373923_0495098 Ga0373923_0495098_278_481 67
447 3300037471 Ga0395905_0119259 Ga0395905_0119259_556_759 67
448 3300037853 Ga0436364_0033021 Ga0436364_0033021_583_786 67
449 3300037853 Ga0436364_1464438 Ga0436364_1464438_704_907 67
450 3300039438 Ga0436360_0694609 Ga0436360_0694609_199_402 67
451 3300039438 Ga0436360_1002729 Ga0436360_1002729_258_461 67
452 3300039438 Ga0436360_1041418 Ga0436360_1041418_2198_2401 67
453 3300039438 Ga0436360_1147395 Ga0436360_1147395_185_388 67
454 3300039438 Ga0436360_1233842 Ga0436360_1233842_500_703 67
455 3300039447 Ga0436361_0094480 Ga0436361_0094480_870_1073 67
456 3300039447 Ga0436361_0166896 Ga0436361_0166896_34_237 67
457 3300039447 Ga0436361_0207409 Ga0436361_0207409_473_676 67
458 3300039447 Ga0436361_0257034 Ga0436361_0257034_261_464 67
459 3300039447 Ga0436361_0348793 Ga0436361_0348793_604_807 67
460 3300039447 Ga0436361_0574455 Ga0436361_0574455_733_936 67
461 3300039447 Ga0436361_0609475 Ga0436361_0609475_2161_2364 67
462 3300039447 Ga0436361_0778974 Ga0436361_0778974_249_452 67
463 3300039447 Ga0436361_0836635 Ga0436361_0836635_88_291 67
464 3300039447 Ga0436361_0888936 Ga0436361_0888936_422_625 67
465 3300039447 Ga0436361_1213965 Ga0436361_1213965_239_442 67
466 3300039450 Ga0436363_0344498 Ga0436363_0344498_120_323 67
467 3300039450 Ga0436363_0409156 Ga0436363_0409156_82_285 67
468 3300039450 Ga0436363_0847268 Ga0436363_0847268_487_690 67
469 3300039450 Ga0436363_0950339 Ga0436363_0950339_213_416 67
470 3300039450 Ga0436363_1050913 Ga0436363_1050913_954_1160 67
471 3300039453 Ga0436362_0768814 Ga0436362_0768814_51_254 67
472 3300041451 Ga0451791_0755109 Ga0451791_0755109_659_862 67
473 3300041453 Ga0451797_0024858 Ga0451797_0024858_198_401 67
474 3300041453 Ga0451797_0807360 Ga0451797_0807360_28_231 67
475 3300041460 Ga0451802_0746896 Ga0451802_0746896_122_325 67
476 3300041486 Ga0451807_0505980 Ga0451807_0505980_215_418 67
477 3300041486 Ga0451807_1285822 Ga0451807_1285822_363_566 67
478 3300041512 Ga0451853_0257560 Ga0451853_0257560_507_710 67
479 3300046462 Ga0495651_0012427 Ga0495651_0012427_4604_4807 67
480 3300046463 Ga0495653_0091288 Ga0495653_0091288_89_292 67
481 3300046471 Ga0495650_0062483 Ga0495650_0062483_601_804 67
482 3300046477 Ga0495664_0218164 Ga0495664_0218164_377_580 67
483 3300046491 Ga0495584_0367083 Ga0495584_0367083_386_589 67
484 3300046500 Ga0495596_0327544 Ga0495596_0327544_106_309 67
485 3300046501 Ga0495607_0275113 Ga0495607_0275113_12_215 67
486 3300046507 Ga0495606_0029681 Ga0495606_0029681_2262_2465 67
487 3300046507 Ga0495606_0195694 Ga0495606_0195694_929_1132 67
488 3300046512 Ga0495610_0038267 Ga0495610_0038267_2048_2251 67
489 3300046513 Ga0495616_0449556 Ga0495616_0449556_187_390 67
490 3300046518 Ga0495631_0070858 Ga0495631_0070858_732_935 67
491 3300046524 Ga0495648_0088554 Ga0495648_0088554_138_341 67
492 3300046529 Ga0495652_0013893 Ga0495652_0013893_4905_5108 67
493 3300046533 Ga0495640_0179264 Ga0495640_0179264_874_1077 67
494 3300046536 Ga0495587_0133640 Ga0495587_0133640_908_1111 67
495 3300046537 Ga0495598_0091747 Ga0495598_0091747_662_865 67
496 3300046543 Ga0495645_0777995 Ga0495645_0777995_77_280 67
497 3300046615 Ga0495656_0070148 Ga0495656_0070148_399_602 67
498 3300046615 Ga0495656_0181030 Ga0495656_0181030_50_253 67
499 3300046616 Ga0495668_0067288 Ga0495668_0067288_1104_1307 67
500 3300046642 Ga0495634_0335451 Ga0495634_0335451_604_807 67
501 3300046660 Ga0495625_0432123 Ga0495625_0432123_138_341 67
502 3300046660 Ga0495625_0675713 Ga0495625_0675713_24_227 67
503 3300046675 Ga0495657_0234353 Ga0495657_0234353_470_673 67
504 3300046684 Ga0495669_0254134 Ga0495669_0254134_242_445 67
505 3300046694 Ga0495649_0160021 Ga0495649_0160021_675_878 67
506 3300046809 Ga0495600_0255472 Ga0495600_0255472_342_545 67
507 3300047317 Ga0495604_0183010 Ga0495604_0183010_181_384 67
508 3300047320 Ga0495672_0056059 Ga0495672_0056059_168_371 67
509 3300047320 Ga0495672_0067182 Ga0495672_0067182_1238_1441 67
510 3300047321 Ga0495676_0432514 Ga0495676_0432514_260_463 67
511 3300047472 Ga0495686_0137489 Ga0495686_0137489_686_889 67
512 3300047472 Ga0495686_0213438 Ga0495686_0213438_733_936 67
513 3300047472 Ga0495686_0331037 Ga0495686_0331037_193_396 67
514 3300048088 Ga0495602_0069899 Ga0495602_0069899_2295_2498 67
515 3300048904 Ga0496101_1047400 Ga0496101_1047400_67_270 67
516 3300048904 Ga0496101_1519113 Ga0496101_1519113_218_421 67
517 3300048905 Ga0496102_0886855 Ga0496102_0886855_42_245 67
518 3300048906 Ga0496103_0097147 Ga0496103_0097147_702_905 67
519 3300048906 Ga0496103_0321170 Ga0496103_0321170_167_370 67
520 3300048906 Ga0496103_0458127 Ga0496103_0458127_428_631 67
521 3300048907 Ga0496104_0219431 Ga0496104_0219431_1007_1210 67
522 3300048908 Ga0496105_0122280 Ga0496105_0122280_392_595 67
523 3300048908 Ga0496105_0279409 Ga0496105_0279409_176_379 67
524 3300048909 Ga0496106_0161795 Ga0496106_0161795_1127_1330 67
525 3300048909 Ga0496106_0587165 Ga0496106_0587165_609_812 67
526 3300048909 Ga0496106_0803240 Ga0496106_0803240_20_223 67
527 3300048909 Ga0496106_1479465 Ga0496106_1479465_278_481 67
528 3300048911 Ga0496108_0039345 Ga0496108_0039345_2738_2941 67
529 3300048911 Ga0496108_0499287 Ga0496108_0499287_607_810 67
530 3300048912 Ga0496109_0317598 Ga0496109_0317598_978_1181 67
531 3300048912 Ga0496109_1359255 Ga0496109_1359255_99_302 67
532 3300048913 Ga0496110_0142988 Ga0496110_0142988_554_757 67
533 3300048913 Ga0496110_1167388 Ga0496110_1167388_257_460 67
534 3300048915 Ga0496112_0138740 Ga0496112_0138740_756_959 67
535 3300048917 Ga0496114_0063402 Ga0496114_0063402_1044_1247 67
536 3300048918 Ga0496115_0366926 Ga0496115_0366926_474_677 67
537 3300048918 Ga0496115_0503485 Ga0496115_0503485_529_732 67
538 3300048919 Ga0496116_0265603 Ga0496116_0265603_599_802 67
539 3300048920 Ga0496117_0364226 Ga0496117_0364226_279_482 67
540 3300048921 Ga0496118_0020399 Ga0496118_0020399_4801_5004 67
541 3300048921 Ga0496118_0499856 Ga0496118_0499856_360_563 67
542 3300048922 Ga0496119_0096153 Ga0496119_0096153_1313_1516 67
543 3300048922 Ga0496119_0148123 Ga0496119_0148123_180_383 67
544 3300048922 Ga0496119_0150788 Ga0496119_0150788_13_216 67
545 3300048923 Ga0496120_0029052 Ga0496120_0029052_848_1051 67
546 3300048924 Ga0496121_0007361 Ga0496121_0007361_3010_3213 67
547 3300048924 Ga0496121_0035562 Ga0496121_0035562_618_821 67
548 3300048924 Ga0496121_0144772 Ga0496121_0144772_12_230 67
549 3300048924 Ga0496121_0263552 Ga0496121_0263552_467_670 67
550 3300048925 Ga0496122_0612983 Ga0496122_0612983_278_481 67
551 3300048927 Ga0496124_0310949 Ga0496124_0310949_592_795 67
552 3300048927 Ga0496124_0603811 Ga0496124_0603811_351_554 67
553 3300048928 Ga0496125_0009470 Ga0496125_0009470_5425_5628 67
554 3300048928 Ga0496125_0221000 Ga0496125_0221000_767_970 67
555 3300048929 Ga0496126_0201335 Ga0496126_0201335_855_1058 67
556 3300048929 Ga0496126_0476050 Ga0496126_0476050_423_626 67
557 3300049572 Ga0501036_0939414 Ga0501036_0939414_160_363 67
558 3300049578 Ga0501042_0480032 Ga0501042_0480032_596_799 67
559 3300049587 Ga0501071_1408914 Ga0501071_1408914_253_456 67
560 3300049590 Ga0501074_0431877 Ga0501074_0431877_29_232 67
561 3300049591 Ga0501075_0043594 Ga0501075_0043594_2755_2958 67
562 3300049592 Ga0501076_0258081 Ga0501076_0258081_199_402 67
563 3300049593 Ga0501077_0120657 Ga0501077_0120657_739_942 67
564 3300049741 Ga0501079_0216627 Ga0501079_0216627_1035_1238 67
565 3300050489 nmdc:mga03683_26976_c1 nmdc:mga03683_26976_c1_1899_2102 67
566 3300050489 nmdc:mga03683_3056_c2 nmdc:mga03683_3056_c2_3809_4012 67
567 3300050489 nmdc:mga03683_651845_c1 nmdc:mga03683_651845_c1_91_294 67
568 3300050491 nmdc:mga00v17_297068_c1 nmdc:mga00v17_297068_c1_158_361 67
569 3300050491 nmdc:mga00v17_73006_c1 nmdc:mga00v17_73006_c1_185_388 67
570 3300050491 nmdc:mga00v17_850805_c1 nmdc:mga00v17_850805_c1_213_416 67
571 3300050492 nmdc:mga0yw44_11934_c1 nmdc:mga0yw44_11934_c1_834_1037 67
572 3300050492 nmdc:mga0yw44_1835_c1 nmdc:mga0yw44_1835_c1_1147_1350 67
573 3300050492 nmdc:mga0yw44_39024_c1 nmdc:mga0yw44_39024_c1_840_1043 67
574 3300050492 nmdc:mga0yw44_42017_c1 nmdc:mga0yw44_42017_c1_283_486 67
575 3300050493 nmdc:mga0k408_94169_c1 nmdc:mga0k408_94169_c1_924_1127 67
576 3300050494 nmdc:mga06z11_12407_c1 nmdc:mga06z11_12407_c1_2664_2867 67
577 3300050494 nmdc:mga06z11_14155_c1 nmdc:mga06z11_14155_c1_227_430 67
578 3300050494 nmdc:mga06z11_158041_c1 nmdc:mga06z11_158041_c1_1019_1222 67
579 3300050494 nmdc:mga06z11_207153_c1 nmdc:mga06z11_207153_c1_321_524 67
580 3300050494 nmdc:mga06z11_37564_c1 nmdc:mga06z11_37564_c1_556_759 67
581 3300050494 nmdc:mga06z11_847341_c1 nmdc:mga06z11_847341_c1_127_330 67
582 3300050495 nmdc:mga04h51_410086_c1 nmdc:mga04h51_410086_c1_31_234 67
583 3300050495 nmdc:mga04h51_84255_c1 nmdc:mga04h51_84255_c1_805_1008 67
584 3300050496 nmdc:mga07m45_28356_c1 nmdc:mga07m45_28356_c1_2670_2873 67
585 3300050496 nmdc:mga07m45_42484_c1 nmdc:mga07m45_42484_c1_1650_1853 67
586 3300050496 nmdc:mga07m45_679845_c1 nmdc:mga07m45_679845_c1_200_403 67
587 3300050496 nmdc:mga07m45_76449_c1 nmdc:mga07m45_76449_c1_827_1030 67
588 3300050507 nmdc:mga05p37_1469142_c1 nmdc:mga05p37_1469142_c1_283_486 67
589 3300050509 nmdc:mga0qj67_420814_c1 nmdc:mga0qj67_420814_c1_709_912 67
590 3300050516 nmdc:mga0sz30_432746_c1 nmdc:mga0sz30_432746_c1_174_377 67
591 3300050516 nmdc:mga0sz30_5993_c3 nmdc:mga0sz30_5993_c3_128_331 67
592 3300050516 nmdc:mga0sz30_670_c1 nmdc:mga0sz30_670_c1_2842_3045 67
593 3300050516 nmdc:mga0sz30_95591_c1 nmdc:mga0sz30_95591_c1_158_361 67
594 3300053079 Ga0500610_0134709 Ga0500610_0134709_262_465 67
595 3300053085 Ga0495619_0231417 Ga0495619_0231417_106_309 67
596 3300053086 Ga0500578_0029278 Ga0500578_0029278_1379_1582 67
597 3300053086 Ga0500578_0076379 Ga0500578_0076379_1505_1708 67
598 3300053087 Ga0500643_029973 Ga0500643_029973_538_750 67
599 3300053090 Ga0500646_0134974 Ga0500646_0134974_104_307 67
600 3300053093 Ga0500651_0034756 Ga0500651_0034756_1382_1585 67
601 3300053094 Ga0500566_0000029 Ga0500566_0000029_59195_59398 67
602 3300053104 Ga0500556_0098192 Ga0500556_0098192_228_431 67
603 3300053108 Ga0500562_026548 Ga0500562_026548_890_1093 67
604 3300053108 Ga0500562_208909 Ga0500562_208909_289_492 67
605 3300053122 Ga0500608_095575 Ga0500608_095575_614_817 67
606 3300053131 Ga0500652_005050 Ga0500652_005050_742_945 67
607 3300053142 Ga0500577_0370203 Ga0500577_0370203_83_286 67
608 3300053150 Ga0500603_048928 Ga0500603_048928_281_484 67
609 3300053151 Ga0500604_0035034 Ga0500604_0035034_1108_1311 67
610 3300053156 Ga0500622_0003040 Ga0500622_0003040_4396_4599 67
611 3300053160 Ga0500633_0323921 Ga0500633_0323921_107_310 67
612 3300053162 Ga0500638_294503 Ga0500638_294503_358_561 67
613 3300053177 Ga0500636_0324819 Ga0500636_0324819_294_497 67
614 3300053177 Ga0500636_0446299 Ga0500636_0446299_367_570 67
615 3300053730 Ga0500645_017379 Ga0500645_017379_1726_1929 67
616 3300053731 Ga0500609_028257 Ga0500609_028257_427_630 67
617 3300053736 Ga0500599_000276 Ga0500599_000276_1217_1420 67
618 3300053737 Ga0500601_000316 Ga0500601_000316_6105_6308 67
619 3300054114 Ga0501084_0762194 Ga0501084_0762194_384_587 67
620 3300055283 Ga0500661_035451 Ga0500661_035451_528_731 67
621 3300061734 Ga0530510_0655813 Ga0530510_0655813_254_457 67
622 iso_pu_bacteria 2824661429 2824663938 67

Feature Viewer

pLDDT pTM Quality
77.94 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map