F470076
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 622 | 341 | 557 | 66 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_100185441|Ga0070668_1001854412 |
| Length | 60 |
| Sequence | MMHTYRELVIGGVLVAPIVSYAAIARPLMHFVGFPRLFSNPPIAELSLYVSIFGLLTLLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 3 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 4 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 5 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 6 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 7 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 8 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 9 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 10 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 11 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 12 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 13 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 14 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 15 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 16 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 17 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 18 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 19 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 20 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 21 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 22 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 23 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 24 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 25 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 26 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 27 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 28 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 29 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 30 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 31 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 32 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 33 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 34 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 35 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 36 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 37 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 38 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 39 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 40 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 41 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 42 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 43 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 44 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 45 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 46 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 47 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 48 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 49 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 50 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 51 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 52 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 53 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 54 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 55 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 56 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 60 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 62 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 64 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 125 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 149 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 150 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 151 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 152 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 224 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 225 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 226 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 275 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 276 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 277 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 278 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 281 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 282 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 294 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 295 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 296 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 305 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 306 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 307 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 308 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 310 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 311 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 312 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 313 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 315 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 316 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 317 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 318 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 319 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 322 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 323 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 326 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 327 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 328 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 329 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 330 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 331 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 332 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 333 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 334 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 335 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 336 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 337 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 338 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 339 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 340 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 341 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.55 |
| Metatranscriptomes | 0 |
| Isolates | 10.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.92 |
| Nodule | 7.23 |
| Rhizoplane | 4.66 |
| Rhizosphere | 62.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10002686 | 3300003215 | Bacteria | 10147 |
| 2 | JGI25153J46596_10004447 | 3300003215 | Bacteria | 7558 |
| 3 | rootH2_10124891 | 3300003320 | Bacteria | 3733 |
| 4 | rootH2_10150455 | 3300003320 | Bacteria | 2974 |
| 5 | rootH2_10343363 | 3300003320 | Bacteria | 1117 |
| 6 | rootL2_10166156 | 3300003322 | Bacteria | 4292 |
| 7 | rootL2_10217400 | 3300003322 | Bacteria | 1006 |
| 8 | rootH1_10029805 | 3300003323 | Bacteria | 3879 |
| 9 | JGI25160J50197_1000413 | 3300003354 | Bacteria | 27195 |
| 10 | JGI25404J52841_10000012 | 3300003659 | Bacteria | 14692 |
| 11 | JGI25404J52841_10033417 | 3300003659 | Bacteria | 1096 |
| 12 | JGI25404J52841_10071834 | 3300003659 | Bacteria | 723 |
| 13 | JGI25404J52841_10117062 | 3300003659 | Bacteria | 561 |
| 14 | Ga0055539_1030993 | 3300003752 | Bacteria | 605 |
| 15 | Ga0055526_1094944 | 3300003771 | Bacteria | 556 |
| 16 | Ga0065165_1000342 | 3300005262 | Bacteria | 76302 |
| 17 | Ga0065165_1054931 | 3300005262 | Bacteria | 1114 |
| 18 | Ga0070683_101925011 | 3300005329 | Bacteria | 568 |
| 19 | Ga0068869_100019259 | 3300005334 | Bacteria | 4658 |
| 20 | Ga0068869_101941787 | 3300005334 | Bacteria | 528 |
| 21 | Ga0070682_100071824 | 3300005337 | Bacteria | 2216 |
| 22 | Ga0068868_101850693 | 3300005338 | Bacteria | 571 |
| 23 | Ga0068868_101878884 | 3300005338 | Bacteria | 567 |
| 24 | Ga0070660_101061407 | 3300005339 | Bacteria | 685 |
| 25 | Ga0070668_100011014 | 3300005347 | Bacteria | 6731 |
| 26 | Ga0070668_100185441 | 3300005347 | Unclassified | 1702 |
| 27 | Ga0070668_100185900 | 3300005347 | Bacteria | 1699 |
| 28 | Ga0070668_100242177 | 3300005347 | Bacteria | 1494 |
| 29 | Ga0070668_100667169 | 3300005347 | Bacteria | 915 |
| 30 | Ga0070668_101113761 | 3300005347 | Bacteria | 713 |
| 31 | Ga0070668_101266818 | 3300005347 | Bacteria | 669 |
| 32 | Ga0070668_101772583 | 3300005347 | Bacteria | 567 |
| 33 | Ga0070669_100031584 | 3300005353 | Bacteria | 3826 |
| 34 | Ga0070669_100257383 | 3300005353 | Bacteria | 1391 |
| 35 | Ga0070669_101441262 | 3300005353 | Bacteria | 598 |
| 36 | Ga0070671_100580532 | 3300005355 | Bacteria | 968 |
| 37 | Ga0070674_100224052 | 3300005356 | Bacteria | 1464 |
| 38 | Ga0070674_101064862 | 3300005356 | Bacteria | 712 |
| 39 | Ga0070659_101239161 | 3300005366 | Bacteria | 660 |
| 40 | Ga0070667_100022148 | 3300005367 | Bacteria | 5272 |
| 41 | Ga0070667_100052299 | 3300005367 | Bacteria | 3446 |
| 42 | Ga0070667_102192086 | 3300005367 | Unclassified | 520 |
| 43 | Ga0070709_10036722 | 3300005434 | Bacteria | 2987 |
| 44 | Ga0070714_100058653 | 3300005435 | Bacteria | 3299 |
| 45 | Ga0070713_100055738 | 3300005436 | Bacteria | 3286 |
| 46 | Ga0070710_10035295 | 3300005437 | Bacteria | 2726 |
| 47 | Ga0070710_10638966 | 3300005437 | Bacteria | 745 |
| 48 | Ga0070710_10667638 | 3300005437 | Bacteria | 730 |
| 49 | Ga0070710_11044626 | 3300005437 | Bacteria | 597 |
| 50 | Ga0070701_10584593 | 3300005438 | Bacteria | 737 |
| 51 | Ga0070711_100074374 | 3300005439 | Bacteria | 2403 |
| 52 | Ga0070711_100124860 | 3300005439 | Bacteria | 1909 |
| 53 | Ga0070700_100012251 | 3300005441 | Bacteria | 4779 |
| 54 | Ga0070694_100086152 | 3300005444 | Bacteria | 2195 |
| 55 | Ga0070708_100593417 | 3300005445 | Unclassified | 1044 |
| 56 | Ga0070663_100354774 | 3300005455 | Bacteria | 1188 |
| 57 | Ga0070663_100655294 | 3300005455 | Bacteria | 888 |
| 58 | Ga0070663_101380041 | 3300005455 | Bacteria | 623 |
| 59 | Ga0070678_100150372 | 3300005456 | Bacteria | 1875 |
| 60 | Ga0070662_100313181 | 3300005457 | Bacteria | 1278 |
| 61 | Ga0070662_101750124 | 3300005457 | Bacteria | 537 |
| 62 | Ga0070681_10376649 | 3300005458 | Bacteria | 1330 |
| 63 | Ga0070706_100226248 | 3300005467 | Bacteria | 1746 |
| 64 | Ga0070706_101162190 | 3300005467 | Bacteria | 710 |
| 65 | Ga0070707_100337097 | 3300005468 | Unclassified | 1465 |
| 66 | Ga0070707_101279140 | 3300005468 | Unclassified | 700 |
| 67 | Ga0070698_100015349 | 3300005471 | Bacteria | 8095 |
| 68 | Ga0070698_100095757 | 3300005471 | Bacteria | 2946 |
| 69 | Ga0070698_100380999 | 3300005471 | Bacteria | 1343 |
| 70 | Ga0070698_100469306 | 3300005471 | Bacteria | 1195 |
| 71 | Ga0070698_100627065 | 3300005471 | Bacteria | 1016 |
| 72 | Ga0070699_100096667 | 3300005518 | Bacteria | 2587 |
| 73 | Ga0070699_100108840 | 3300005518 | Bacteria | 2432 |
| 74 | Ga0070699_100406205 | 3300005518 | Bacteria | 1232 |
| 75 | Ga0070699_100677336 | 3300005518 | Bacteria | 942 |
| 76 | Ga0070697_100079666 | 3300005536 | Bacteria | 2697 |
| 77 | Ga0070697_100097391 | 3300005536 | Bacteria | 2441 |
| 78 | Ga0070697_100152396 | 3300005536 | Bacteria | 1949 |
| 79 | Ga0070697_100720662 | 3300005536 | Bacteria | 881 |
| 80 | Ga0068853_100764850 | 3300005539 | Bacteria | 924 |
| 81 | Ga0068853_102249747 | 3300005539 | Bacteria | 528 |
| 82 | Ga0070695_100093345 | 3300005545 | Bacteria | 2014 |
| 83 | Ga0070696_100061223 | 3300005546 | Bacteria | 2633 |
| 84 | Ga0070665_100006644 | 3300005548 | Bacteria | 11758 |
| 85 | Ga0070665_100080394 | 3300005548 | Bacteria | 3265 |
| 86 | Ga0070665_100374202 | 3300005548 | Bacteria | 1431 |
| 87 | Ga0070665_100680351 | 3300005548 | Bacteria | 1042 |
| 88 | Ga0070665_100972565 | 3300005548 | Unclassified | 861 |
| 89 | Ga0070704_100062636 | 3300005549 | Bacteria | 2667 |
| 90 | Ga0070704_101088818 | 3300005549 | Unclassified | 725 |
| 91 | Ga0068856_100789689 | 3300005614 | Bacteria | 969 |
| 92 | Ga0068852_100064911 | 3300005616 | Bacteria | 3184 |
| 93 | Ga0068852_102305404 | 3300005616 | Bacteria | 559 |
| 94 | Ga0068864_101111748 | 3300005618 | Bacteria | 787 |
| 95 | Ga0068866_10955796 | 3300005718 | Bacteria | 606 |
| 96 | Ga0068861_100037191 | 3300005719 | Bacteria | 3618 |
| 97 | Ga0068861_100074237 | 3300005719 | Bacteria | 2644 |
| 98 | Ga0068861_100453376 | 3300005719 | Bacteria | 1150 |
| 99 | Ga0068861_101179429 | 3300005719 | Bacteria | 739 |
| 100 | Ga0068861_101750073 | 3300005719 | Bacteria | 616 |
| 101 | Ga0068861_102593659 | 3300005719 | Bacteria | 511 |
| 102 | Ga0068851_10961323 | 3300005834 | Bacteria | 537 |
| 103 | Ga0068863_100150222 | 3300005841 | Bacteria | 2229 |
| 104 | Ga0068860_100019390 | 3300005843 | Bacteria | 6596 |
| 105 | Ga0068860_100389268 | 3300005843 | Bacteria | 1377 |
| 106 | Ga0068860_100448401 | 3300005843 | Bacteria | 1283 |
| 107 | Ga0068860_101423814 | 3300005843 | Bacteria | 714 |
| 108 | Ga0068860_102717101 | 3300005843 | Bacteria | 513 |
| 109 | Ga0068862_100012728 | 3300005844 | Bacteria | 6963 |
| 110 | Ga0068862_100190430 | 3300005844 | Bacteria | 1845 |
| 111 | Ga0068862_100266425 | 3300005844 | Bacteria | 1565 |
| 112 | Ga0068862_100287451 | 3300005844 | Bacteria | 1509 |
| 113 | Ga0068862_100532200 | 3300005844 | Bacteria | 1120 |
| 114 | Ga0068862_100542401 | 3300005844 | Bacteria | 1109 |
| 115 | Ga0068862_101077521 | 3300005844 | Bacteria | 798 |
| 116 | Ga0081455_10001122 | 3300005937 | Bacteria | 33467 |
| 117 | Ga0081455_10018306 | 3300005937 | Bacteria | 6678 |
| 118 | Ga0081455_10201674 | 3300005937 | Bacteria | 1489 |
| 119 | Ga0081455_10248549 | 3300005937 | Bacteria | 1302 |
| 120 | Ga0081455_10337640 | 3300005937 | Bacteria | 1067 |
| 121 | Ga0081540_1000537 | 3300005983 | Bacteria | 36699 |
| 122 | Ga0081540_1001429 | 3300005983 | Bacteria | 20644 |
| 123 | Ga0081540_1001458 | 3300005983 | Bacteria | 20433 |
| 124 | Ga0081540_1001570 | 3300005983 | Bacteria | 19515 |
| 125 | Ga0081540_1003186 | 3300005983 | Bacteria | 13060 |
| 126 | Ga0081540_1004038 | 3300005983 | Bacteria | 11365 |
| 127 | Ga0081540_1007669 | 3300005983 | Bacteria | 7652 |
| 128 | Ga0081540_1011636 | 3300005983 | Bacteria | 5867 |
| 129 | Ga0081540_1013383 | 3300005983 | Bacteria | 5335 |
| 130 | Ga0081540_1016608 | 3300005983 | Bacteria | 4596 |
| 131 | Ga0081540_1024693 | 3300005983 | Bacteria | 3481 |
| 132 | Ga0081540_1024767 | 3300005983 | Bacteria | 3474 |
| 133 | Ga0081540_1034720 | 3300005983 | Bacteria | 2714 |
| 134 | Ga0081540_1040616 | 3300005983 | Bacteria | 2422 |
| 135 | Ga0081540_1043031 | 3300005983 | Bacteria | 2322 |
| 136 | Ga0081540_1056233 | 3300005983 | Bacteria | 1911 |
| 137 | Ga0081540_1072083 | 3300005983 | Bacteria | 1593 |
| 138 | Ga0081540_1129235 | 3300005983 | Bacteria | 1034 |
| 139 | Ga0070717_10834129 | 3300006028 | Bacteria | 839 |
| 140 | Ga0070717_10888895 | 3300006028 | Bacteria | 811 |
| 141 | Ga0075365_10007043 | 3300006038 | Bacteria | 6261 |
| 142 | Ga0075365_10083553 | 3300006038 | Bacteria | 2166 |
| 143 | Ga0075365_10154786 | 3300006038 | Bacteria | 1595 |
| 144 | Ga0075365_10417326 | 3300006038 | Bacteria | 947 |
| 145 | Ga0075368_10177427 | 3300006042 | Bacteria | 897 |
| 146 | Ga0075363_100753189 | 3300006048 | Bacteria | 590 |
| 147 | Ga0075364_10202128 | 3300006051 | Bacteria | 1347 |
| 148 | Ga0075364_10352485 | 3300006051 | Bacteria | 1003 |
| 149 | Ga0070715_10091841 | 3300006163 | Unclassified | 1399 |
| 150 | Ga0070716_100024782 | 3300006173 | Bacteria | 3196 |
| 151 | Ga0070712_100006325 | 3300006175 | Bacteria | 7342 |
| 152 | Ga0070712_101889846 | 3300006175 | Unclassified | 523 |
| 153 | Ga0075362_10032232 | 3300006177 | Bacteria | 2273 |
| 154 | Ga0075362_10608274 | 3300006177 | Bacteria | 565 |
| 155 | Ga0075367_10017835 | 3300006178 | Bacteria | 3904 |
| 156 | Ga0075367_10028849 | 3300006178 | Bacteria | 3169 |
| 157 | Ga0075367_10234581 | 3300006178 | Bacteria | 1149 |
| 158 | Ga0075367_10629834 | 3300006178 | Bacteria | 682 |
| 159 | Ga0075367_10922883 | 3300006178 | Bacteria | 557 |
| 160 | Ga0075369_10000085 | 3300006186 | Bacteria | 24796 |
| 161 | Ga0075369_10071776 | 3300006186 | Bacteria | 1524 |
| 162 | Ga0075369_10095730 | 3300006186 | Bacteria | 1328 |
| 163 | Ga0075369_10420412 | 3300006186 | Bacteria | 631 |
| 164 | Ga0075366_10113247 | 3300006195 | Bacteria | 1633 |
| 165 | Ga0075366_10191426 | 3300006195 | Bacteria | 1243 |
| 166 | Ga0075370_10004214 | 3300006353 | Bacteria | 6946 |
| 167 | Ga0075370_10018890 | 3300006353 | Bacteria | 3744 |
| 168 | Ga0075370_10081880 | 3300006353 | Bacteria | 1856 |
| 169 | Ga0075370_10220938 | 3300006353 | Bacteria | 1120 |
| 170 | Ga0075370_10228467 | 3300006353 | Bacteria | 1101 |
| 171 | Ga0075370_10648075 | 3300006353 | Bacteria | 641 |
| 172 | Ga0068871_101138848 | 3300006358 | Bacteria | 730 |
| 173 | Ga0075428_100080479 | 3300006844 | Bacteria | 3555 |
| 174 | Ga0075430_100376194 | 3300006846 | Bacteria | 1172 |
| 175 | Ga0097620_101002471 | 3300006931 | Unclassified | 917 |
| 176 | Ga0099823_1000409 | 3300006944 | Bacteria | 27729 |
| 177 | Ga0099794_10062486 | 3300007265 | Bacteria | 1811 |
| 178 | Ga0099794_10186221 | 3300007265 | Unclassified | 1061 |
| 179 | Ga0099795_10009016 | 3300007788 | Plasmid | 2877 |
| 180 | Ga0099795_10179758 | 3300007788 | Bacteria | 883 |
| 181 | Ga0099795_10191184 | 3300007788 | Unclassified | 859 |
| 182 | Ga0099795_10458597 | 3300007788 | Unclassified | 588 |
| 183 | Ga0099795_10573441 | 3300007788 | Unclassified | 534 |
| 184 | Ga0105250_10291857 | 3300009092 | Bacteria | 704 |
| 185 | Ga0105250_10552083 | 3300009092 | Bacteria | 529 |
| 186 | Ga0105240_11255219 | 3300009093 | Bacteria | 783 |
| 187 | Ga0111539_10575836 | 3300009094 | Bacteria | 1311 |
| 188 | Ga0111539_11527290 | 3300009094 | Bacteria | 774 |
| 189 | Ga0105245_10159390 | 3300009098 | Bacteria | 2140 |
| 190 | Ga0105245_11233924 | 3300009098 | Bacteria | 796 |
| 191 | Ga0105247_10429986 | 3300009101 | Bacteria | 947 |
| 192 | Ga0105247_10448234 | 3300009101 | Bacteria | 930 |
| 193 | Ga0114129_11104439 | 3300009147 | Bacteria | 993 |
| 194 | Ga0105243_10034719 | 3300009148 | Bacteria | 3907 |
| 195 | Ga0105243_10430612 | 3300009148 | Bacteria | 1233 |
| 196 | Ga0105242_11139991 | 3300009176 | Bacteria | 796 |
| 197 | Ga0105237_10168679 | 3300009545 | Bacteria | 2188 |
| 198 | Ga0105237_10921843 | 3300009545 | Bacteria | 881 |
| 199 | Ga0105237_12404636 | 3300009545 | Bacteria | 537 |
| 200 | Ga0105237_12579431 | 3300009545 | Bacteria | 519 |
| 201 | Ga0105249_10161484 | 3300009553 | Bacteria | 2166 |
| 202 | Ga0105249_10166676 | 3300009553 | Bacteria | 2133 |
| 203 | Ga0105249_10301578 | 3300009553 | Bacteria | 1607 |
| 204 | Ga0105249_10436711 | 3300009553 | Bacteria | 1346 |
| 205 | Ga0105249_10598387 | 3300009553 | Bacteria | 1157 |
| 206 | Ga0105249_11973536 | 3300009553 | Bacteria | 656 |
| 207 | Ga0099796_10004855 | 3300010159 | Bacteria | 3298 |
| 208 | Ga0099796_10025769 | 3300010159 | Bacteria | 1861 |
| 209 | Ga0099796_10127461 | 3300010159 | Bacteria | 984 |
| 210 | Ga0099796_10147545 | 3300010159 | Bacteria | 924 |
| 211 | Ga0099796_10185341 | 3300010159 | Bacteria | 837 |
| 212 | Ga0099796_10235668 | 3300010159 | Bacteria | 755 |
| 213 | Ga0099796_10258451 | 3300010159 | Unclassified | 726 |
| 214 | Ga0099796_10436824 | 3300010159 | Bacteria | 580 |
| 215 | Ga0099796_10475763 | 3300010159 | Bacteria | 558 |
| 216 | Ga0105239_10026464 | 3300010375 | Bacteria | 6383 |
| 217 | Ga0105239_10186403 | 3300010375 | Bacteria | 2322 |
| 218 | Ga0105239_10902442 | 3300010375 | Bacteria | 1014 |
| 219 | Ga0105239_11337665 | 3300010375 | Bacteria | 827 |
| 220 | Ga0105239_11690867 | 3300010375 | Bacteria | 732 |
| 221 | Ga0105239_12460220 | 3300010375 | Bacteria | 607 |
| 222 | Ga0105246_10068739 | 3300011119 | Bacteria | 2485 |
| 223 | Ga0105246_10975396 | 3300011119 | Unclassified | 765 |
| 224 | Ga0157370_10836466 | 3300013104 | Bacteria | 837 |
| 225 | Ga0157374_10270450 | 3300013296 | Bacteria | 1675 |
| 226 | Ga0157378_10876478 | 3300013297 | Bacteria | 927 |
| 227 | Ga0163162_10059268 | 3300013306 | Bacteria | 3859 |
| 228 | Ga0163162_10144326 | 3300013306 | Bacteria | 2495 |
| 229 | Ga0163162_10257688 | 3300013306 | Bacteria | 1876 |
| 230 | Ga0163162_10838774 | 3300013306 | Bacteria | 1035 |
| 231 | Ga0163162_12950766 | 3300013306 | Bacteria | 547 |
| 232 | Ga0157375_11821330 | 3300013308 | Bacteria | 722 |
| 233 | Ga0163163_10482371 | 3300014325 | Bacteria | 1301 |
| 234 | Ga0163163_12805797 | 3300014325 | Unclassified | 544 |
| 235 | Ga0157380_12183870 | 3300014326 | Bacteria | 617 |
| 236 | Ga0157379_10028712 | 3300014968 | Bacteria | 4947 |
| 237 | Ga0157379_10551672 | 3300014968 | Bacteria | 1072 |
| 238 | Ga0182005_1141650 | 3300015265 | Unclassified | 695 |
| 239 | Ga0163161_10041846 | 3300017792 | Bacteria | 3293 |
| 240 | Ga0213872_10071265 | 3300021361 | Bacteria | 1567 |
| 241 | Ga0213874_10021796 | 3300021377 | Bacteria | 1771 |
| 242 | Ga0213871_10170021 | 3300021441 | Bacteria | 670 |
| 243 | Ga0213871_10239272 | 3300021441 | Bacteria | 574 |
| 244 | Ga0228598_1112391 | 3300024227 | Unclassified | 551 |
| 245 | Ga0209563_115192 | 3300025230 | Bacteria | 970 |
| 246 | Ga0209026_1056680 | 3300025250 | Bacteria | 553 |
| 247 | Ga0209677_101774 | 3300025253 | Bacteria | 8921 |
| 248 | Ga0209564_1008190 | 3300025295 | Bacteria | 5219 |
| 249 | Ga0209758_1002841 | 3300025297 | Bacteria | 16832 |
| 250 | Ga0209758_1004616 | 3300025297 | Bacteria | 11306 |
| 251 | Ga0209758_1056918 | 3300025297 | Bacteria | 1317 |
| 252 | Ga0209758_1095318 | 3300025297 | Bacteria | 860 |
| 253 | Ga0209256_1024045 | 3300025299 | Bacteria | 1802 |
| 254 | Ga0207426_1000237 | 3300025302 | Bacteria | 124707 |
| 255 | Ga0209051_1152695 | 3300025303 | Bacteria | 539 |
| 256 | Ga0209257_1013515 | 3300025304 | Bacteria | 3620 |
| 257 | Ga0207656_10348033 | 3300025321 | Bacteria | 739 |
| 258 | Ga0207642_10854068 | 3300025899 | Bacteria | 581 |
| 259 | Ga0207688_11044053 | 3300025901 | Unclassified | 516 |
| 260 | Ga0207647_10033140 | 3300025904 | Bacteria | 3311 |
| 261 | Ga0207699_10001088 | 3300025906 | Bacteria | 12830 |
| 262 | Ga0207643_10396210 | 3300025908 | Bacteria | 872 |
| 263 | Ga0207705_10098200 | 3300025909 | Bacteria | 2151 |
| 264 | Ga0207684_10286502 | 3300025910 | Unclassified | 1420 |
| 265 | Ga0207671_10056430 | 3300025914 | Bacteria | 2910 |
| 266 | Ga0207671_10194019 | 3300025914 | Bacteria | 1584 |
| 267 | Ga0207693_10001127 | 3300025915 | Bacteria | 23971 |
| 268 | Ga0207693_10602203 | 3300025915 | Bacteria | 855 |
| 269 | Ga0207646_10388994 | 3300025922 | Bacteria | 1260 |
| 270 | Ga0207646_10647662 | 3300025922 | Bacteria | 947 |
| 271 | Ga0207681_10029964 | 3300025923 | Bacteria | 3543 |
| 272 | Ga0207681_10169720 | 3300025923 | Bacteria | 1653 |
| 273 | Ga0207687_10593099 | 3300025927 | Bacteria | 933 |
| 274 | Ga0207700_10072031 | 3300025928 | Bacteria | 2663 |
| 275 | Ga0207664_10020925 | 3300025929 | Bacteria | 4855 |
| 276 | Ga0207644_10312599 | 3300025931 | Bacteria | 1269 |
| 277 | Ga0207690_11233648 | 3300025932 | Bacteria | 624 |
| 278 | Ga0207690_11675192 | 3300025932 | Bacteria | 531 |
| 279 | Ga0207706_10119635 | 3300025933 | Bacteria | 2316 |
| 280 | Ga0207706_10224369 | 3300025933 | Bacteria | 1645 |
| 281 | Ga0207706_11312242 | 3300025933 | Bacteria | 598 |
| 282 | Ga0207709_11152907 | 3300025935 | Bacteria | 638 |
| 283 | Ga0207669_10256259 | 3300025937 | Bacteria | 1306 |
| 284 | Ga0207665_10034187 | 3300025939 | Bacteria | 3373 |
| 285 | Ga0207691_11077091 | 3300025940 | Unclassified | 669 |
| 286 | Ga0207689_10002319 | 3300025942 | Bacteria | 17836 |
| 287 | Ga0207689_10058508 | 3300025942 | Bacteria | 3170 |
| 288 | Ga0207689_10238726 | 3300025942 | Bacteria | 1502 |
| 289 | Ga0207689_11411156 | 3300025942 | Bacteria | 583 |
| 290 | Ga0207661_11726829 | 3300025944 | Bacteria | 571 |
| 291 | Ga0207679_11843514 | 3300025945 | Unclassified | 552 |
| 292 | Ga0207712_10127097 | 3300025961 | Bacteria | 1937 |
| 293 | Ga0207712_10145202 | 3300025961 | Bacteria | 1826 |
| 294 | Ga0207712_10263986 | 3300025961 | Bacteria | 1398 |
| 295 | Ga0207712_11679952 | 3300025961 | Unclassified | 569 |
| 296 | Ga0207712_12005621 | 3300025961 | Bacteria | 518 |
| 297 | Ga0207668_10000974 | 3300025972 | Bacteria | 17209 |
| 298 | Ga0207668_10135925 | 3300025972 | Bacteria | 1884 |
| 299 | Ga0207668_10151191 | 3300025972 | Bacteria | 1797 |
| 300 | Ga0207668_10157242 | 3300025972 | Unclassified | 1767 |
| 301 | Ga0207668_10201984 | 3300025972 | Bacteria | 1583 |
| 302 | Ga0207668_10445048 | 3300025972 | Bacteria | 1104 |
| 303 | Ga0207668_10748181 | 3300025972 | Bacteria | 862 |
| 304 | Ga0207668_10763803 | 3300025972 | Bacteria | 853 |
| 305 | Ga0207668_11109179 | 3300025972 | Bacteria | 709 |
| 306 | Ga0207668_11233224 | 3300025972 | Bacteria | 672 |
| 307 | Ga0207668_11349799 | 3300025972 | Bacteria | 642 |
| 308 | Ga0207658_10187590 | 3300025986 | Bacteria | 1716 |
| 309 | Ga0207658_10319177 | 3300025986 | Bacteria | 1344 |
| 310 | Ga0207658_12149429 | 3300025986 | Bacteria | 507 |
| 311 | Ga0207677_10361369 | 3300026023 | Bacteria | 1220 |
| 312 | Ga0207677_10455391 | 3300026023 | Bacteria | 1097 |
| 313 | Ga0207677_11221932 | 3300026023 | Unclassified | 688 |
| 314 | Ga0207677_11779249 | 3300026023 | Bacteria | 572 |
| 315 | Ga0207639_10549351 | 3300026041 | Bacteria | 1060 |
| 316 | Ga0207639_10576505 | 3300026041 | Bacteria | 1035 |
| 317 | Ga0207678_10035523 | 3300026067 | Bacteria | 4339 |
| 318 | Ga0207678_10067264 | 3300026067 | Bacteria | 3075 |
| 319 | Ga0207678_10481685 | 3300026067 | Bacteria | 1080 |
| 320 | Ga0207678_11185368 | 3300026067 | Bacteria | 676 |
| 321 | Ga0207678_11958780 | 3300026067 | Unclassified | 510 |
| 322 | Ga0207708_10026915 | 3300026075 | Bacteria | 4354 |
| 323 | Ga0207641_10083985 | 3300026088 | Bacteria | 2771 |
| 324 | Ga0207648_11375600 | 3300026089 | Bacteria | 663 |
| 325 | Ga0207675_100000292 | 3300026118 | Bacteria | 48260 |
| 326 | Ga0207675_100002084 | 3300026118 | Bacteria | 19874 |
| 327 | Ga0207675_100052391 | 3300026118 | Bacteria | 3808 |
| 328 | Ga0207675_100191951 | 3300026118 | Bacteria | 1959 |
| 329 | Ga0207675_100665203 | 3300026118 | Bacteria | 1048 |
| 330 | Ga0207675_100969014 | 3300026118 | Bacteria | 868 |
| 331 | Ga0207675_101392656 | 3300026118 | Bacteria | 722 |
| 332 | Ga0207675_102000046 | 3300026118 | Bacteria | 597 |
| 333 | Ga0207683_10161334 | 3300026121 | Bacteria | 2027 |
| 334 | Ga0207698_11595354 | 3300026142 | Bacteria | 668 |
| 335 | Ga0209389_1000111 | 3300027296 | Bacteria | 72517 |
| 336 | Ga0209489_100220 | 3300027361 | Bacteria | 95167 |
| 337 | Ga0209700_100041 | 3300027363 | Bacteria | 168380 |
| 338 | Ga0209179_1007728 | 3300027512 | Bacteria | 1785 |
| 339 | Ga0209179_1020676 | 3300027512 | Bacteria | 1279 |
| 340 | Ga0209179_1033781 | 3300027512 | Bacteria | 1059 |
| 341 | Ga0209179_1143562 | 3300027512 | Unclassified | 533 |
| 342 | Ga0209179_1151061 | 3300027512 | Unclassified | 519 |
| 343 | Ga0209588_1001077 | 3300027671 | Bacteria | 6998 |
| 344 | Ga0209588_1004743 | 3300027671 | Bacteria | 3858 |
| 345 | Ga0209813_10051131 | 3300027866 | Bacteria | 1291 |
| 346 | Ga0209813_10437054 | 3300027866 | Bacteria | 533 |
| 347 | Ga0268266_10036157 | 3300028379 | Bacteria | 4202 |
| 348 | Ga0268266_10118498 | 3300028379 | Bacteria | 2353 |
| 349 | Ga0268266_10129209 | 3300028379 | Bacteria | 2258 |
| 350 | Ga0268266_11304884 | 3300028379 | Unclassified | 701 |
| 351 | Ga0268266_11419139 | 3300028379 | Bacteria | 670 |
| 352 | Ga0268265_10007544 | 3300028380 | Bacteria | 7342 |
| 353 | Ga0268265_10025786 | 3300028380 | Bacteria | 4176 |
| 354 | Ga0268265_10262817 | 3300028380 | Bacteria | 1535 |
| 355 | Ga0268265_10319190 | 3300028380 | Bacteria | 1406 |
| 356 | Ga0268265_10454083 | 3300028380 | Bacteria | 1197 |
| 357 | Ga0268265_10797024 | 3300028380 | Bacteria | 920 |
| 358 | Ga0268265_11089910 | 3300028380 | Bacteria | 792 |
| 359 | Ga0268265_12056355 | 3300028380 | Bacteria | 578 |
| 360 | Ga0268264_10095897 | 3300028381 | Bacteria | 2568 |
| 361 | Ga0268264_10151711 | 3300028381 | Bacteria | 2078 |
| 362 | Ga0268264_11039525 | 3300028381 | Bacteria | 826 |
| 363 | Ga0268264_11300628 | 3300028381 | Bacteria | 737 |
| 364 | Ga0268264_11460622 | 3300028381 | Bacteria | 694 |
| 365 | Ga0307517_10558529 | 3300028786 | Bacteria | 571 |
| 366 | Ga0265314_10252709 | 3300031711 | Bacteria | 1011 |
| 367 | Ga0307405_10344593 | 3300031731 | Bacteria | 1147 |
| 368 | Ga0307413_10147834 | 3300031824 | Bacteria | 1633 |
| 369 | Ga0326468_10075572 | 3300031889 | Unclassified | 570 |
| 370 | Ga0307406_10023908 | 3300031901 | Bacteria | 3643 |
| 371 | Ga0307409_100196042 | 3300031995 | Bacteria | 1802 |
| 372 | Ga0307416_103629361 | 3300032002 | Bacteria | 516 |
| 373 | Ga0307411_11151051 | 3300032005 | Bacteria | 701 |
| 374 | Ga0307415_100093579 | 3300032126 | Bacteria | 2183 |
| 375 | Ga0307415_100726357 | 3300032126 | Bacteria | 899 |
| 376 | Ga0307415_101131851 | 3300032126 | Bacteria | 734 |
| 377 | Ga0307510_10023418 | 3300033180 | Bacteria | 7158 |
| 378 | Ga0373929_0182493 | 3300035085 | Unclassified | 579 |
| 379 | Ga0373923_0495098 | 3300035111 | Bacteria | 596 |
| 380 | Ga0395905_0119259 | 3300037471 | Bacteria | 2479 |
| 381 | Ga0436364_0033021 | 3300037853 | Bacteria | 1217 |
| 382 | Ga0436364_1464438 | 3300037853 | Bacteria | 1748 |
| 383 | Ga0436360_0694609 | 3300039438 | Bacteria | 1007 |
| 384 | Ga0436360_0775814 | 3300039438 | Bacteria | 914 |
| 385 | Ga0436360_1002729 | 3300039438 | Bacteria | 1391 |
| 386 | Ga0436360_1041418 | 3300039438 | Bacteria | 4035 |
| 387 | Ga0436360_1147395 | 3300039438 | Bacteria | 1230 |
| 388 | Ga0436360_1233842 | 3300039438 | Bacteria | 784 |
| 389 | Ga0436361_0094480 | 3300039447 | Bacteria | 2570 |
| 390 | Ga0436361_0166896 | 3300039447 | Bacteria | 643 |
| 391 | Ga0436361_0207409 | 3300039447 | Unclassified | 758 |
| 392 | Ga0436361_0257034 | 3300039447 | Bacteria | 729 |
| 393 | Ga0436361_0348793 | 3300039447 | Bacteria | 1028 |
| 394 | Ga0436361_0574455 | 3300039447 | Bacteria | 1715 |
| 395 | Ga0436361_0609475 | 3300039447 | Bacteria | 2538 |
| 396 | Ga0436361_0778974 | 3300039447 | Bacteria | 1846 |
| 397 | Ga0436361_0836635 | 3300039447 | Bacteria | 1278 |
| 398 | Ga0436361_0888936 | 3300039447 | Bacteria | 1261 |
| 399 | Ga0436361_1213965 | 3300039447 | Bacteria | 607 |
| 400 | Ga0436363_0344498 | 3300039450 | Bacteria | 625 |
| 401 | Ga0436363_0409156 | 3300039450 | Unclassified | 840 |
| 402 | Ga0436363_0847268 | 3300039450 | Bacteria | 939 |
| 403 | Ga0436363_0950339 | 3300039450 | Bacteria | 775 |
| 404 | Ga0436363_1050913 | 3300039450 | Bacteria | 1257 |
| 405 | Ga0436362_0768814 | 3300039453 | Bacteria | 507 |
| 406 | Ga0451791_0755109 | 3300041451 | Unclassified | 921 |
| 407 | Ga0451797_0024858 | 3300041453 | Bacteria | 591 |
| 408 | Ga0451797_0807360 | 3300041453 | Bacteria | 961 |
| 409 | Ga0451802_0746896 | 3300041460 | Bacteria | 637 |
| 410 | Ga0451807_0505980 | 3300041486 | Bacteria | 774 |
| 411 | Ga0451807_1285822 | 3300041486 | Bacteria | 1218 |
| 412 | Ga0451853_0257560 | 3300041512 | Bacteria | 876 |
| 413 | Ga0451853_1919044 | 3300041512 | Bacteria | 621 |
| 414 | Ga0495651_0012427 | 3300046462 | Bacteria | 6566 |
| 415 | Ga0495653_0091288 | 3300046463 | Bacteria | 2227 |
| 416 | Ga0495650_0062483 | 3300046471 | Bacteria | 1488 |
| 417 | Ga0495664_0218164 | 3300046477 | Bacteria | 1155 |
| 418 | Ga0495584_0367083 | 3300046491 | Bacteria | 731 |
| 419 | Ga0495596_0327544 | 3300046500 | Bacteria | 596 |
| 420 | Ga0495607_0275113 | 3300046501 | Bacteria | 801 |
| 421 | Ga0495606_0029681 | 3300046507 | Bacteria | 3834 |
| 422 | Ga0495606_0195694 | 3300046507 | Bacteria | 1156 |
| 423 | Ga0495610_0038267 | 3300046512 | Bacteria | 2436 |
| 424 | Ga0495616_0449556 | 3300046513 | Unclassified | 522 |
| 425 | Ga0495631_0070858 | 3300046518 | Bacteria | 1507 |
| 426 | Ga0495648_0088554 | 3300046524 | Bacteria | 1740 |
| 427 | Ga0495652_0013893 | 3300046529 | Bacteria | 7242 |
| 428 | Ga0495640_0179264 | 3300046533 | Bacteria | 1351 |
| 429 | Ga0495587_0133640 | 3300046536 | Bacteria | 1417 |
| 430 | Ga0495598_0091747 | 3300046537 | Bacteria | 992 |
| 431 | Ga0495645_0777995 | 3300046543 | Bacteria | 576 |
| 432 | Ga0495656_0070148 | 3300046615 | Bacteria | 1554 |
| 433 | Ga0495656_0181030 | 3300046615 | Unclassified | 1036 |
| 434 | Ga0495668_0067288 | 3300046616 | Bacteria | 1971 |
| 435 | Ga0495634_0335451 | 3300046642 | Bacteria | 908 |
| 436 | Ga0495625_0432123 | 3300046660 | Bacteria | 817 |
| 437 | Ga0495625_0675713 | 3300046660 | Unclassified | 612 |
| 438 | Ga0495657_0234353 | 3300046675 | Bacteria | 1109 |
| 439 | Ga0495669_0254134 | 3300046684 | Bacteria | 844 |
| 440 | Ga0495649_0160021 | 3300046694 | Bacteria | 1181 |
| 441 | Ga0495600_0255472 | 3300046809 | Bacteria | 1114 |
| 442 | Ga0495604_0183010 | 3300047317 | Bacteria | 1465 |
| 443 | Ga0495672_0056059 | 3300047320 | Bacteria | 2296 |
| 444 | Ga0495672_0067182 | 3300047320 | Bacteria | 2043 |
| 445 | Ga0495676_0432514 | 3300047321 | Unclassified | 870 |
| 446 | Ga0495680_0320216 | 3300047322 | Bacteria | 1085 |
| 447 | Ga0495686_0137489 | 3300047472 | Bacteria | 1444 |
| 448 | Ga0495686_0213438 | 3300047472 | Unclassified | 1101 |
| 449 | Ga0495686_0331037 | 3300047472 | Unclassified | 832 |
| 450 | Ga0495602_0069899 | 3300048088 | Bacteria | 3008 |
| 451 | Ga0496101_1047400 | 3300048904 | Unclassified | 641 |
| 452 | Ga0496101_1519113 | 3300048904 | Unclassified | 521 |
| 453 | Ga0496102_0886855 | 3300048905 | Bacteria | 814 |
| 454 | Ga0496103_0097147 | 3300048906 | Bacteria | 1862 |
| 455 | Ga0496103_0321170 | 3300048906 | Bacteria | 996 |
| 456 | Ga0496103_0458127 | 3300048906 | Bacteria | 818 |
| 457 | Ga0496104_0219431 | 3300048907 | Bacteria | 1814 |
| 458 | Ga0496105_0122280 | 3300048908 | Bacteria | 2146 |
| 459 | Ga0496105_0279409 | 3300048908 | Bacteria | 1347 |
| 460 | Ga0496106_0161795 | 3300048909 | Bacteria | 1771 |
| 461 | Ga0496106_0587165 | 3300048909 | Bacteria | 893 |
| 462 | Ga0496106_0803240 | 3300048909 | Bacteria | 746 |
| 463 | Ga0496106_1479465 | 3300048909 | Bacteria | 523 |
| 464 | Ga0496108_0039345 | 3300048911 | Bacteria | 3942 |
| 465 | Ga0496108_0499287 | 3300048911 | Bacteria | 1063 |
| 466 | Ga0496109_0317598 | 3300048912 | Bacteria | 1470 |
| 467 | Ga0496109_1359255 | 3300048912 | Unclassified | 646 |
| 468 | Ga0496110_0142988 | 3300048913 | Bacteria | 2163 |
| 469 | Ga0496110_1167388 | 3300048913 | Bacteria | 679 |
| 470 | Ga0496112_0138740 | 3300048915 | Bacteria | 2401 |
| 471 | Ga0496114_0063402 | 3300048917 | Bacteria | 3094 |
| 472 | Ga0496115_0366926 | 3300048918 | Bacteria | 1172 |
| 473 | Ga0496115_0503485 | 3300048918 | Unclassified | 973 |
| 474 | Ga0496116_0265603 | 3300048919 | Bacteria | 843 |
| 475 | Ga0496117_0364226 | 3300048920 | Bacteria | 742 |
| 476 | Ga0496118_0020399 | 3300048921 | Bacteria | 5877 |
| 477 | Ga0496118_0499856 | 3300048921 | Unclassified | 605 |
| 478 | Ga0496119_0096153 | 3300048922 | Bacteria | 1672 |
| 479 | Ga0496119_0148123 | 3300048922 | Bacteria | 1260 |
| 480 | Ga0496119_0150788 | 3300048922 | Bacteria | 1246 |
| 481 | Ga0496120_0029052 | 3300048923 | Bacteria | 3379 |
| 482 | Ga0496121_0007361 | 3300048924 | Bacteria | 13306 |
| 483 | Ga0496121_0035562 | 3300048924 | Bacteria | 4462 |
| 484 | Ga0496121_0144772 | 3300048924 | Unclassified | 1757 |
| 485 | Ga0496121_0263552 | 3300048924 | Bacteria | 1188 |
| 486 | Ga0496122_0612983 | 3300048925 | Bacteria | 507 |
| 487 | Ga0496124_0310949 | 3300048927 | Bacteria | 1133 |
| 488 | Ga0496124_0603811 | 3300048927 | Bacteria | 713 |
| 489 | Ga0496125_0009470 | 3300048928 | Bacteria | 9999 |
| 490 | Ga0496125_0221000 | 3300048928 | Bacteria | 1221 |
| 491 | Ga0496126_0201335 | 3300048929 | Bacteria | 1681 |
| 492 | Ga0496126_0476050 | 3300048929 | Bacteria | 1001 |
| 493 | Ga0501036_0939414 | 3300049572 | Bacteria | 709 |
| 494 | Ga0501042_0480032 | 3300049578 | Bacteria | 902 |
| 495 | Ga0501071_1408914 | 3300049587 | Unclassified | 538 |
| 496 | Ga0501074_0431877 | 3300049590 | Bacteria | 934 |
| 497 | Ga0501075_0043594 | 3300049591 | Bacteria | 3365 |
| 498 | Ga0501076_0258081 | 3300049592 | Bacteria | 1427 |
| 499 | Ga0501077_0120657 | 3300049593 | Bacteria | 1661 |
| 500 | Ga0501079_0216627 | 3300049741 | Bacteria | 1495 |
| 501 | nmdc:mga03683_26976_c1 | 3300050489 | Bacteria | 2271 |
| 502 | nmdc:mga03683_3056_c2 | 3300050489 | Bacteria | 4575 |
| 503 | nmdc:mga03683_651845_c1 | 3300050489 | Unclassified | 518 |
| 504 | nmdc:mga00v17_297068_c1 | 3300050491 | Bacteria | 1049 |
| 505 | nmdc:mga00v17_73006_c1 | 3300050491 | Bacteria | 2130 |
| 506 | nmdc:mga00v17_850805_c1 | 3300050491 | Unclassified | 579 |
| 507 | nmdc:mga0yw44_11934_c1 | 3300050492 | Bacteria | 4509 |
| 508 | nmdc:mga0yw44_1835_c1 | 3300050492 | Bacteria | 8713 |
| 509 | nmdc:mga0yw44_39024_c1 | 3300050492 | Bacteria | 2813 |
| 510 | nmdc:mga0yw44_42017_c1 | 3300050492 | Bacteria | 2724 |
| 511 | nmdc:mga0k408_94169_c1 | 3300050493 | Bacteria | 1761 |
| 512 | nmdc:mga06z11_12407_c1 | 3300050494 | Bacteria | 3705 |
| 513 | nmdc:mga06z11_14155_c1 | 3300050494 | Bacteria | 3526 |
| 514 | nmdc:mga06z11_158041_c1 | 3300050494 | Bacteria | 1294 |
| 515 | nmdc:mga06z11_207153_c1 | 3300050494 | Bacteria | 1141 |
| 516 | nmdc:mga06z11_37564_c1 | 3300050494 | Bacteria | 2399 |
| 517 | nmdc:mga06z11_847341_c1 | 3300050494 | Bacteria | 557 |
| 518 | nmdc:mga04h51_410086_c1 | 3300050495 | Bacteria | 568 |
| 519 | nmdc:mga04h51_84255_c1 | 3300050495 | Bacteria | 1133 |
| 520 | nmdc:mga07m45_28356_c1 | 3300050496 | Bacteria | 3090 |
| 521 | nmdc:mga07m45_42484_c1 | 3300050496 | Bacteria | 2548 |
| 522 | nmdc:mga07m45_679845_c1 | 3300050496 | Bacteria | 592 |
| 523 | nmdc:mga07m45_76449_c1 | 3300050496 | Bacteria | 1909 |
| 524 | nmdc:mga05p37_1469142_c1 | 3300050507 | Unclassified | 681 |
| 525 | nmdc:mga0qj67_420814_c1 | 3300050509 | Bacteria | 1077 |
| 526 | nmdc:mga0sz30_432746_c1 | 3300050516 | Bacteria | 590 |
| 527 | nmdc:mga0sz30_5993_c3 | 3300050516 | Bacteria | 1408 |
| 528 | nmdc:mga0sz30_670_c1 | 3300050516 | Bacteria | 12636 |
| 529 | nmdc:mga0sz30_95591_c1 | 3300050516 | Bacteria | 1296 |
| 530 | Ga0500610_0134709 | 3300053079 | Bacteria | 1253 |
| 531 | Ga0495619_0231417 | 3300053085 | Bacteria | 1280 |
| 532 | Ga0500578_0029278 | 3300053086 | Bacteria | 3537 |
| 533 | Ga0500578_0076379 | 3300053086 | Bacteria | 2133 |
| 534 | Ga0500643_029973 | 3300053087 | Bacteria | 1670 |
| 535 | Ga0500646_0134974 | 3300053090 | Bacteria | 805 |
| 536 | Ga0500651_0034756 | 3300053093 | Bacteria | 3177 |
| 537 | Ga0500566_0000029 | 3300053094 | Bacteria | 75384 |
| 538 | Ga0500556_0098192 | 3300053104 | Bacteria | 1125 |
| 539 | Ga0500562_026548 | 3300053108 | Bacteria | 1518 |
| 540 | Ga0500562_208909 | 3300053108 | Unclassified | 528 |
| 541 | Ga0500608_095575 | 3300053122 | Bacteria | 1383 |
| 542 | Ga0500652_005050 | 3300053131 | Bacteria | 4125 |
| 543 | Ga0500577_0370203 | 3300053142 | Bacteria | 627 |
| 544 | Ga0500603_048928 | 3300053150 | Bacteria | 1151 |
| 545 | Ga0500604_0035034 | 3300053151 | Bacteria | 1492 |
| 546 | Ga0500622_0003040 | 3300053156 | Bacteria | 11589 |
| 547 | Ga0500633_0323921 | 3300053160 | Bacteria | 564 |
| 548 | Ga0500638_294503 | 3300053162 | Bacteria | 629 |
| 549 | Ga0500636_0324819 | 3300053177 | Bacteria | 746 |
| 550 | Ga0500636_0446299 | 3300053177 | Unclassified | 586 |
| 551 | Ga0500645_017379 | 3300053730 | Bacteria | 2256 |
| 552 | Ga0500609_028257 | 3300053731 | Bacteria | 769 |
| 553 | Ga0500599_000276 | 3300053736 | Bacteria | 4968 |
| 554 | Ga0500601_000316 | 3300053737 | Bacteria | 9001 |
| 555 | Ga0501084_0762194 | 3300054114 | Bacteria | 815 |
| 556 | Ga0500661_035451 | 3300055283 | Bacteria | 882 |
| 557 | Ga0530510_0655813 | 3300061734 | Unclassified | 799 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005347 | Ga0070668_100185441 | Ga0070668_1001854412 | 60 |
| 2 | 3300005438 | Ga0070701_10584593 | Ga0070701_105845931 | 60 |
| 3 | 3300005539 | Ga0068853_102249747 | Ga0068853_1022497471 | 60 |
| 4 | 3300005549 | Ga0070704_101088818 | Ga0070704_1010888182 | 60 |
| 5 | 3300005843 | Ga0068860_101423814 | Ga0068860_1014238142 | 60 |
| 6 | 3300007788 | Ga0099795_10573441 | Ga0099795_105734411 | 60 |
| 7 | 3300009553 | Ga0105249_10161484 | Ga0105249_101614842 | 60 |
| 8 | 3300025901 | Ga0207688_11044053 | Ga0207688_110440531 | 60 |
| 9 | 3300025972 | Ga0207668_10157242 | Ga0207668_101572422 | 60 |
| 10 | 3300026118 | Ga0207675_100665203 | Ga0207675_1006652032 | 60 |
| 11 | 3300028381 | Ga0268264_11460622 | Ga0268264_114606222 | 60 |
| 12 | 3300041512 | Ga0451853_1919044 | Ga0451853_1919044_11_193 | 60 |
| 13 | iso_pu_bacteria | 2508501042 | 2508693894 | 63 |
| 14 | iso_pu_bacteria | 2513237095 | 2513651969 | 63 |
| 15 | iso_pu_bacteria | 2513237102 | 2513702765 | 63 |
| 16 | iso_pu_bacteria | 2513237104 | 2513722215 | 63 |
| 17 | iso_pu_bacteria | 2513237141 | 2513893767 | 63 |
| 18 | iso_pu_bacteria | 2517093001 | 2517101004 | 63 |
| 19 | iso_pu_bacteria | 2524023205 | 2524442547 | 63 |
| 20 | iso_pu_bacteria | 2744054633 | 2745075512 | 63 |
| 21 | iso_pu_bacteria | 2816332527 | 2818239183 | 63 |
| 22 | iso_pu_bacteria | 2824600985 | 2824604839 | 63 |
| 23 | iso_pu_bacteria | 2824609381 | 2824611409 | 63 |
| 24 | iso_pu_bacteria | 2824617872 | 2824620237 | 63 |
| 25 | iso_pu_bacteria | 2824626560 | 2824629502 | 63 |
| 26 | iso_pu_bacteria | 2824635225 | 2824635822 | 63 |
| 27 | iso_pu_bacteria | 2824644064 | 2824646124 | 63 |
| 28 | iso_pu_bacteria | 2824653114 | 2824656096 | 63 |
| 29 | iso_pu_bacteria | 2824704595 | 2824706481 | 63 |
| 30 | iso_pu_bacteria | 2824714736 | 2824716678 | 63 |
| 31 | iso_pu_bacteria | 2824723954 | 2824726635 | 63 |
| 32 | iso_pu_bacteria | 2824753945 | 2824757886 | 63 |
| 33 | iso_pu_bacteria | 2824763712 | 2824766982 | 63 |
| 34 | iso_pu_bacteria | 2841957949 | 2841961227 | 63 |
| 35 | iso_pu_bacteria | 2857509624 | 2857512490 | 63 |
| 36 | iso_pu_bacteria | 2874612657 | 2874617384 | 63 |
| 37 | iso_pu_bacteria | 2874628541 | 2874633814 | 63 |
| 38 | iso_pu_bacteria | 2879099564 | 2879106871 | 63 |
| 39 | iso_pu_bacteria | 2881364244 | 2881368288 | 63 |
| 40 | iso_pu_bacteria | 2881665667 | 2881667091 | 63 |
| 41 | iso_pu_bacteria | 2885409591 | 2885416148 | 63 |
| 42 | iso_pu_bacteria | 2888388044 | 2888389478 | 63 |
| 43 | iso_pu_bacteria | 2888419890 | 2888421638 | 63 |
| 44 | iso_pu_bacteria | 2903748898 | 2903752877 | 63 |
| 45 | iso_pu_bacteria | 2904690495 | 2904695356 | 63 |
| 46 | iso_pu_bacteria | 2904711408 | 2904712510 | 63 |
| 47 | iso_pu_bacteria | 2919073203 | 2919077102 | 63 |
| 48 | iso_pu_bacteria | 2932801729 | 2932801748 | 63 |
| 49 | iso_pu_bacteria | 2935608549 | 2935610148 | 63 |
| 50 | iso_pu_bacteria | 2935648319 | 2935650322 | 63 |
| 51 | iso_pu_bacteria | 2935656913 | 2935658469 | 63 |
| 52 | iso_pu_bacteria | 2935777560 | 2935778328 | 63 |
| 53 | iso_pu_bacteria | 2935819856 | 2935823308 | 63 |
| 54 | iso_pu_bacteria | 2935916978 | 2935923724 | 63 |
| 55 | iso_pu_bacteria | 2935984226 | 2935986033 | 63 |
| 56 | iso_pu_bacteria | 2936011229 | 2936013119 | 63 |
| 57 | iso_pu_bacteria | 2936019824 | 2936021794 | 63 |
| 58 | iso_pu_bacteria | 2936028420 | 2936030412 | 63 |
| 59 | iso_pu_bacteria | 2936046547 | 2936047988 | 63 |
| 60 | iso_pu_bacteria | 2936055302 | 2936057988 | 63 |
| 61 | iso_pu_bacteria | 3005710791 | 3005714708 | 63 |
| 62 | iso_pu_bacteria | 8016522445 | 8016529836 | 63 |
| 63 | iso_pu_bacteria | 8016530956 | 8016535070 | 63 |
| 64 | iso_pu_bacteria | 8016539877 | 8016548276 | 63 |
| 65 | iso_pu_bacteria | 8016548790 | 8016553849 | 63 |
| 66 | iso_pu_bacteria | 8016557553 | 8016562224 | 63 |
| 67 | iso_pu_bacteria | 8016566248 | 8016573413 | 63 |
| 68 | iso_pu_bacteria | 8016575299 | 8016577545 | 63 |
| 69 | iso_pu_bacteria | 8016595262 | 8016600039 | 63 |
| 70 | iso_pu_bacteria | 8016603502 | 8016610723 | 63 |
| 71 | iso_pu_bacteria | 8016613128 | 8016614208 | 63 |
| 72 | iso_pu_bacteria | 8016622563 | 8016626776 | 63 |
| 73 | iso_pu_bacteria | 8019530166 | 8019534825 | 63 |
| 74 | iso_pu_bacteria | 8019538911 | 8019544648 | 63 |
| 75 | iso_pu_bacteria | 8019547302 | 8019553887 | 63 |
| 76 | iso_pu_bacteria | 8019648815 | 8019659069 | 63 |
| 77 | 3300005983 | Ga0081540_1043031 | Ga0081540_10430312 | 66 |
| 78 | 3300010159 | Ga0099796_10235668 | Ga0099796_102356681 | 66 |
| 79 | 3300021441 | Ga0213871_10239272 | Ga0213871_102392722 | 66 |
| 80 | 3300027512 | Ga0209179_1020676 | Ga0209179_10206762 | 66 |
| 81 | 3300039438 | Ga0436360_0775814 | Ga0436360_0775814_604_804 | 66 |
| 82 | 3300047322 | Ga0495680_0320216 | Ga0495680_0320216_808_1008 | 66 |
| 83 | 3300003215 | JGI25153J46596_10002686 | JGI25153J46596_1000268610 | 67 |
| 84 | 3300003215 | JGI25153J46596_10004447 | JGI25153J46596_100044473 | 67 |
| 85 | 3300003320 | rootH2_10124891 | rootH2_101248912 | 67 |
| 86 | 3300003320 | rootH2_10150455 | rootH2_101504552 | 67 |
| 87 | 3300003320 | rootH2_10343363 | rootH2_103433632 | 67 |
| 88 | 3300003322 | rootL2_10166156 | rootL2_101661562 | 67 |
| 89 | 3300003322 | rootL2_10217400 | rootL2_102174002 | 67 |
| 90 | 3300003323 | rootH1_10029805 | rootH1_100298052 | 67 |
| 91 | 3300003354 | JGI25160J50197_1000413 | JGI25160J50197_100041317 | 67 |
| 92 | 3300003659 | JGI25404J52841_10000012 | JGI25404J52841_100000129 | 67 |
| 93 | 3300003659 | JGI25404J52841_10033417 | JGI25404J52841_100334172 | 67 |
| 94 | 3300003659 | JGI25404J52841_10071834 | JGI25404J52841_100718342 | 67 |
| 95 | 3300003659 | JGI25404J52841_10117062 | JGI25404J52841_101170622 | 67 |
| 96 | 3300003752 | Ga0055539_1030993 | Ga0055539_10309931 | 67 |
| 97 | 3300003771 | Ga0055526_1094944 | Ga0055526_10949442 | 67 |
| 98 | 3300005262 | Ga0065165_1000342 | Ga0065165_100034258 | 67 |
| 99 | 3300005262 | Ga0065165_1054931 | Ga0065165_10549312 | 67 |
| 100 | 3300005329 | Ga0070683_101925011 | Ga0070683_1019250112 | 67 |
| 101 | 3300005334 | Ga0068869_100019259 | Ga0068869_1000192594 | 67 |
| 102 | 3300005334 | Ga0068869_101941787 | Ga0068869_1019417872 | 67 |
| 103 | 3300005337 | Ga0070682_100071824 | Ga0070682_1000718242 | 67 |
| 104 | 3300005338 | Ga0068868_101850693 | Ga0068868_1018506932 | 67 |
| 105 | 3300005338 | Ga0068868_101878884 | Ga0068868_1018788842 | 67 |
| 106 | 3300005339 | Ga0070660_101061407 | Ga0070660_1010614071 | 67 |
| 107 | 3300005347 | Ga0070668_100011014 | Ga0070668_1000110144 | 67 |
| 108 | 3300005347 | Ga0070668_100185900 | Ga0070668_1001859002 | 67 |
| 109 | 3300005347 | Ga0070668_100242177 | Ga0070668_1002421772 | 67 |
| 110 | 3300005347 | Ga0070668_100667169 | Ga0070668_1006671692 | 67 |
| 111 | 3300005347 | Ga0070668_101113761 | Ga0070668_1011137612 | 67 |
| 112 | 3300005347 | Ga0070668_101266818 | Ga0070668_1012668182 | 67 |
| 113 | 3300005347 | Ga0070668_101772583 | Ga0070668_1017725832 | 67 |
| 114 | 3300005353 | Ga0070669_100031584 | Ga0070669_1000315842 | 67 |
| 115 | 3300005353 | Ga0070669_100257383 | Ga0070669_1002573832 | 67 |
| 116 | 3300005353 | Ga0070669_101441262 | Ga0070669_1014412621 | 67 |
| 117 | 3300005355 | Ga0070671_100580532 | Ga0070671_1005805322 | 67 |
| 118 | 3300005356 | Ga0070674_100224052 | Ga0070674_1002240522 | 67 |
| 119 | 3300005356 | Ga0070674_101064862 | Ga0070674_1010648622 | 67 |
| 120 | 3300005366 | Ga0070659_101239161 | Ga0070659_1012391612 | 67 |
| 121 | 3300005367 | Ga0070667_100022148 | Ga0070667_1000221482 | 67 |
| 122 | 3300005367 | Ga0070667_100052299 | Ga0070667_1000522993 | 67 |
| 123 | 3300005367 | Ga0070667_102192086 | Ga0070667_1021920862 | 67 |
| 124 | 3300005434 | Ga0070709_10036722 | Ga0070709_100367223 | 67 |
| 125 | 3300005435 | Ga0070714_100058653 | Ga0070714_1000586532 | 67 |
| 126 | 3300005436 | Ga0070713_100055738 | Ga0070713_1000557382 | 67 |
| 127 | 3300005437 | Ga0070710_10035295 | Ga0070710_100352953 | 67 |
| 128 | 3300005437 | Ga0070710_10638966 | Ga0070710_106389662 | 67 |
| 129 | 3300005437 | Ga0070710_10667638 | Ga0070710_106676382 | 67 |
| 130 | 3300005437 | Ga0070710_11044626 | Ga0070710_110446262 | 67 |
| 131 | 3300005439 | Ga0070711_100074374 | Ga0070711_1000743742 | 67 |
| 132 | 3300005439 | Ga0070711_100124860 | Ga0070711_1001248602 | 67 |
| 133 | 3300005441 | Ga0070700_100012251 | Ga0070700_1000122512 | 67 |
| 134 | 3300005444 | Ga0070694_100086152 | Ga0070694_1000861522 | 67 |
| 135 | 3300005445 | Ga0070708_100593417 | Ga0070708_1005934172 | 67 |
| 136 | 3300005455 | Ga0070663_100354774 | Ga0070663_1003547741 | 67 |
| 137 | 3300005455 | Ga0070663_100655294 | Ga0070663_1006552942 | 67 |
| 138 | 3300005455 | Ga0070663_101380041 | Ga0070663_1013800411 | 67 |
| 139 | 3300005456 | Ga0070678_100150372 | Ga0070678_1001503722 | 67 |
| 140 | 3300005457 | Ga0070662_100313181 | Ga0070662_1003131812 | 67 |
| 141 | 3300005457 | Ga0070662_101750124 | Ga0070662_1017501242 | 67 |
| 142 | 3300005458 | Ga0070681_10376649 | Ga0070681_103766492 | 67 |
| 143 | 3300005467 | Ga0070706_100226248 | Ga0070706_1002262482 | 67 |
| 144 | 3300005467 | Ga0070706_101162190 | Ga0070706_1011621902 | 67 |
| 145 | 3300005468 | Ga0070707_100337097 | Ga0070707_1003370972 | 67 |
| 146 | 3300005468 | Ga0070707_101279140 | Ga0070707_1012791402 | 67 |
| 147 | 3300005471 | Ga0070698_100015349 | Ga0070698_10001534913 | 67 |
| 148 | 3300005471 | Ga0070698_100095757 | Ga0070698_1000957573 | 67 |
| 149 | 3300005471 | Ga0070698_100380999 | Ga0070698_1003809992 | 67 |
| 150 | 3300005471 | Ga0070698_100469306 | Ga0070698_1004693062 | 67 |
| 151 | 3300005471 | Ga0070698_100627065 | Ga0070698_1006270652 | 67 |
| 152 | 3300005518 | Ga0070699_100096667 | Ga0070699_1000966672 | 67 |
| 153 | 3300005518 | Ga0070699_100108840 | Ga0070699_1001088402 | 67 |
| 154 | 3300005518 | Ga0070699_100406205 | Ga0070699_1004062052 | 67 |
| 155 | 3300005518 | Ga0070699_100677336 | Ga0070699_1006773362 | 67 |
| 156 | 3300005536 | Ga0070697_100079666 | Ga0070697_1000796662 | 67 |
| 157 | 3300005536 | Ga0070697_100097391 | Ga0070697_1000973912 | 67 |
| 158 | 3300005536 | Ga0070697_100152396 | Ga0070697_1001523962 | 67 |
| 159 | 3300005536 | Ga0070697_100720662 | Ga0070697_1007206622 | 67 |
| 160 | 3300005539 | Ga0068853_100764850 | Ga0068853_1007648501 | 67 |
| 161 | 3300005545 | Ga0070695_100093345 | Ga0070695_1000933452 | 67 |
| 162 | 3300005546 | Ga0070696_100061223 | Ga0070696_1000612232 | 67 |
| 163 | 3300005548 | Ga0070665_100006644 | Ga0070665_10000664412 | 67 |
| 164 | 3300005548 | Ga0070665_100080394 | Ga0070665_1000803942 | 67 |
| 165 | 3300005548 | Ga0070665_100374202 | Ga0070665_1003742022 | 67 |
| 166 | 3300005548 | Ga0070665_100680351 | Ga0070665_1006803512 | 67 |
| 167 | 3300005548 | Ga0070665_100972565 | Ga0070665_1009725651 | 67 |
| 168 | 3300005549 | Ga0070704_100062636 | Ga0070704_1000626363 | 67 |
| 169 | 3300005614 | Ga0068856_100789689 | Ga0068856_1007896892 | 67 |
| 170 | 3300005616 | Ga0068852_100064911 | Ga0068852_1000649113 | 67 |
| 171 | 3300005616 | Ga0068852_102305404 | Ga0068852_1023054042 | 67 |
| 172 | 3300005618 | Ga0068864_101111748 | Ga0068864_1011117481 | 67 |
| 173 | 3300005718 | Ga0068866_10955796 | Ga0068866_109557962 | 67 |
| 174 | 3300005719 | Ga0068861_100037191 | Ga0068861_1000371912 | 67 |
| 175 | 3300005719 | Ga0068861_100074237 | Ga0068861_1000742372 | 67 |
| 176 | 3300005719 | Ga0068861_100453376 | Ga0068861_1004533762 | 67 |
| 177 | 3300005719 | Ga0068861_101179429 | Ga0068861_1011794292 | 67 |
| 178 | 3300005719 | Ga0068861_101750073 | Ga0068861_1017500732 | 67 |
| 179 | 3300005719 | Ga0068861_102593659 | Ga0068861_1025936592 | 67 |
| 180 | 3300005834 | Ga0068851_10961323 | Ga0068851_109613232 | 67 |
| 181 | 3300005841 | Ga0068863_100150222 | Ga0068863_1001502222 | 67 |
| 182 | 3300005843 | Ga0068860_100019390 | Ga0068860_1000193902 | 67 |
| 183 | 3300005843 | Ga0068860_100389268 | Ga0068860_1003892682 | 67 |
| 184 | 3300005843 | Ga0068860_100448401 | Ga0068860_1004484012 | 67 |
| 185 | 3300005843 | Ga0068860_102717101 | Ga0068860_1027171012 | 67 |
| 186 | 3300005844 | Ga0068862_100012728 | Ga0068862_1000127286 | 67 |
| 187 | 3300005844 | Ga0068862_100190430 | Ga0068862_1001904302 | 67 |
| 188 | 3300005844 | Ga0068862_100266425 | Ga0068862_1002664252 | 67 |
| 189 | 3300005844 | Ga0068862_100287451 | Ga0068862_1002874512 | 67 |
| 190 | 3300005844 | Ga0068862_100532200 | Ga0068862_1005322002 | 67 |
| 191 | 3300005844 | Ga0068862_100542401 | Ga0068862_1005424012 | 67 |
| 192 | 3300005844 | Ga0068862_101077521 | Ga0068862_1010775212 | 67 |
| 193 | 3300005937 | Ga0081455_10001122 | Ga0081455_1000112214 | 67 |
| 194 | 3300005937 | Ga0081455_10018306 | Ga0081455_100183065 | 67 |
| 195 | 3300005937 | Ga0081455_10201674 | Ga0081455_102016742 | 67 |
| 196 | 3300005937 | Ga0081455_10248549 | Ga0081455_102485492 | 67 |
| 197 | 3300005937 | Ga0081455_10337640 | Ga0081455_103376402 | 67 |
| 198 | 3300005983 | Ga0081540_1000537 | Ga0081540_100053739 | 67 |
| 199 | 3300005983 | Ga0081540_1001429 | Ga0081540_100142910 | 67 |
| 200 | 3300005983 | Ga0081540_1001458 | Ga0081540_100145811 | 67 |
| 201 | 3300005983 | Ga0081540_1001570 | Ga0081540_10015704 | 67 |
| 202 | 3300005983 | Ga0081540_1003186 | Ga0081540_10031868 | 67 |
| 203 | 3300005983 | Ga0081540_1004038 | Ga0081540_10040388 | 67 |
| 204 | 3300005983 | Ga0081540_1007669 | Ga0081540_10076692 | 67 |
| 205 | 3300005983 | Ga0081540_1011636 | Ga0081540_10116363 | 67 |
| 206 | 3300005983 | Ga0081540_1013383 | Ga0081540_10133835 | 67 |
| 207 | 3300005983 | Ga0081540_1016608 | Ga0081540_10166087 | 67 |
| 208 | 3300005983 | Ga0081540_1024693 | Ga0081540_10246936 | 67 |
| 209 | 3300005983 | Ga0081540_1024767 | Ga0081540_10247677 | 67 |
| 210 | 3300005983 | Ga0081540_1034720 | Ga0081540_10347202 | 67 |
| 211 | 3300005983 | Ga0081540_1040616 | Ga0081540_10406162 | 67 |
| 212 | 3300005983 | Ga0081540_1056233 | Ga0081540_10562332 | 67 |
| 213 | 3300005983 | Ga0081540_1072083 | Ga0081540_10720832 | 67 |
| 214 | 3300005983 | Ga0081540_1129235 | Ga0081540_11292351 | 67 |
| 215 | 3300006028 | Ga0070717_10834129 | Ga0070717_108341292 | 67 |
| 216 | 3300006028 | Ga0070717_10888895 | Ga0070717_108888952 | 67 |
| 217 | 3300006038 | Ga0075365_10007043 | Ga0075365_100070434 | 67 |
| 218 | 3300006038 | Ga0075365_10083553 | Ga0075365_100835532 | 67 |
| 219 | 3300006038 | Ga0075365_10154786 | Ga0075365_101547862 | 67 |
| 220 | 3300006038 | Ga0075365_10417326 | Ga0075365_104173262 | 67 |
| 221 | 3300006042 | Ga0075368_10177427 | Ga0075368_101774272 | 67 |
| 222 | 3300006048 | Ga0075363_100753189 | Ga0075363_1007531892 | 67 |
| 223 | 3300006051 | Ga0075364_10202128 | Ga0075364_102021282 | 67 |
| 224 | 3300006051 | Ga0075364_10352485 | Ga0075364_103524852 | 67 |
| 225 | 3300006163 | Ga0070715_10091841 | Ga0070715_100918412 | 67 |
| 226 | 3300006173 | Ga0070716_100024782 | Ga0070716_1000247822 | 67 |
| 227 | 3300006175 | Ga0070712_100006325 | Ga0070712_1000063258 | 67 |
| 228 | 3300006175 | Ga0070712_101889846 | Ga0070712_1018898462 | 67 |
| 229 | 3300006177 | Ga0075362_10032232 | Ga0075362_100322322 | 67 |
| 230 | 3300006177 | Ga0075362_10608274 | Ga0075362_106082742 | 67 |
| 231 | 3300006178 | Ga0075367_10017835 | Ga0075367_100178352 | 67 |
| 232 | 3300006178 | Ga0075367_10028849 | Ga0075367_100288493 | 67 |
| 233 | 3300006178 | Ga0075367_10234581 | Ga0075367_102345812 | 67 |
| 234 | 3300006178 | Ga0075367_10629834 | Ga0075367_106298342 | 67 |
| 235 | 3300006178 | Ga0075367_10922883 | Ga0075367_109228832 | 67 |
| 236 | 3300006186 | Ga0075369_10000085 | Ga0075369_1000008523 | 67 |
| 237 | 3300006186 | Ga0075369_10071776 | Ga0075369_100717762 | 67 |
| 238 | 3300006186 | Ga0075369_10095730 | Ga0075369_100957302 | 67 |
| 239 | 3300006186 | Ga0075369_10420412 | Ga0075369_104204122 | 67 |
| 240 | 3300006195 | Ga0075366_10113247 | Ga0075366_101132472 | 67 |
| 241 | 3300006195 | Ga0075366_10191426 | Ga0075366_101914261 | 67 |
| 242 | 3300006353 | Ga0075370_10004214 | Ga0075370_100042147 | 67 |
| 243 | 3300006353 | Ga0075370_10018890 | Ga0075370_100188905 | 67 |
| 244 | 3300006353 | Ga0075370_10081880 | Ga0075370_100818802 | 67 |
| 245 | 3300006353 | Ga0075370_10220938 | Ga0075370_102209382 | 67 |
| 246 | 3300006353 | Ga0075370_10228467 | Ga0075370_102284671 | 67 |
| 247 | 3300006353 | Ga0075370_10648075 | Ga0075370_106480752 | 67 |
| 248 | 3300006358 | Ga0068871_101138848 | Ga0068871_1011388482 | 67 |
| 249 | 3300006844 | Ga0075428_100080479 | Ga0075428_1000804793 | 67 |
| 250 | 3300006846 | Ga0075430_100376194 | Ga0075430_1003761942 | 67 |
| 251 | 3300006931 | Ga0097620_101002471 | Ga0097620_1010024712 | 67 |
| 252 | 3300006944 | Ga0099823_1000409 | Ga0099823_10004099 | 67 |
| 253 | 3300007265 | Ga0099794_10062486 | Ga0099794_100624862 | 67 |
| 254 | 3300007265 | Ga0099794_10186221 | Ga0099794_101862212 | 67 |
| 255 | 3300007788 | Ga0099795_10009016 | Ga0099795_100090163 | 67 |
| 256 | 3300007788 | Ga0099795_10179758 | Ga0099795_101797582 | 67 |
| 257 | 3300007788 | Ga0099795_10191184 | Ga0099795_101911842 | 67 |
| 258 | 3300007788 | Ga0099795_10458597 | Ga0099795_104585972 | 67 |
| 259 | 3300009092 | Ga0105250_10291857 | Ga0105250_102918572 | 67 |
| 260 | 3300009092 | Ga0105250_10552083 | Ga0105250_105520832 | 67 |
| 261 | 3300009093 | Ga0105240_11255219 | Ga0105240_112552192 | 67 |
| 262 | 3300009094 | Ga0111539_10575836 | Ga0111539_105758362 | 67 |
| 263 | 3300009094 | Ga0111539_11527290 | Ga0111539_115272902 | 67 |
| 264 | 3300009098 | Ga0105245_10159390 | Ga0105245_101593902 | 67 |
| 265 | 3300009098 | Ga0105245_11233924 | Ga0105245_112339242 | 67 |
| 266 | 3300009101 | Ga0105247_10429986 | Ga0105247_104299862 | 67 |
| 267 | 3300009101 | Ga0105247_10448234 | Ga0105247_104482342 | 67 |
| 268 | 3300009147 | Ga0114129_11104439 | Ga0114129_111044391 | 67 |
| 269 | 3300009148 | Ga0105243_10034719 | Ga0105243_100347191 | 67 |
| 270 | 3300009148 | Ga0105243_10430612 | Ga0105243_104306122 | 67 |
| 271 | 3300009176 | Ga0105242_11139991 | Ga0105242_111399912 | 67 |
| 272 | 3300009545 | Ga0105237_10168679 | Ga0105237_101686792 | 67 |
| 273 | 3300009545 | Ga0105237_10921843 | Ga0105237_109218432 | 67 |
| 274 | 3300009545 | Ga0105237_12404636 | Ga0105237_124046362 | 67 |
| 275 | 3300009545 | Ga0105237_12579431 | Ga0105237_125794312 | 67 |
| 276 | 3300009553 | Ga0105249_10166676 | Ga0105249_101666762 | 67 |
| 277 | 3300009553 | Ga0105249_10301578 | Ga0105249_103015782 | 67 |
| 278 | 3300009553 | Ga0105249_10436711 | Ga0105249_104367111 | 67 |
| 279 | 3300009553 | Ga0105249_10598387 | Ga0105249_105983872 | 67 |
| 280 | 3300009553 | Ga0105249_11973536 | Ga0105249_119735362 | 67 |
| 281 | 3300010159 | Ga0099796_10004855 | Ga0099796_100048552 | 67 |
| 282 | 3300010159 | Ga0099796_10025769 | Ga0099796_100257692 | 67 |
| 283 | 3300010159 | Ga0099796_10127461 | Ga0099796_101274612 | 67 |
| 284 | 3300010159 | Ga0099796_10147545 | Ga0099796_101475451 | 67 |
| 285 | 3300010159 | Ga0099796_10185341 | Ga0099796_101853412 | 67 |
| 286 | 3300010159 | Ga0099796_10258451 | Ga0099796_102584511 | 67 |
| 287 | 3300010159 | Ga0099796_10436824 | Ga0099796_104368241 | 67 |
| 288 | 3300010159 | Ga0099796_10475763 | Ga0099796_104757632 | 67 |
| 289 | 3300010375 | Ga0105239_10026464 | Ga0105239_100264642 | 67 |
| 290 | 3300010375 | Ga0105239_10186403 | Ga0105239_101864033 | 67 |
| 291 | 3300010375 | Ga0105239_10902442 | Ga0105239_109024422 | 67 |
| 292 | 3300010375 | Ga0105239_11337665 | Ga0105239_113376652 | 67 |
| 293 | 3300010375 | Ga0105239_11690867 | Ga0105239_116908672 | 67 |
| 294 | 3300010375 | Ga0105239_12460220 | Ga0105239_124602202 | 67 |
| 295 | 3300011119 | Ga0105246_10068739 | Ga0105246_100687392 | 67 |
| 296 | 3300011119 | Ga0105246_10975396 | Ga0105246_109753962 | 67 |
| 297 | 3300013104 | Ga0157370_10836466 | Ga0157370_108364661 | 67 |
| 298 | 3300013296 | Ga0157374_10270450 | Ga0157374_102704502 | 67 |
| 299 | 3300013297 | Ga0157378_10876478 | Ga0157378_108764782 | 67 |
| 300 | 3300013306 | Ga0163162_10059268 | Ga0163162_100592682 | 67 |
| 301 | 3300013306 | Ga0163162_10144326 | Ga0163162_101443262 | 67 |
| 302 | 3300013306 | Ga0163162_10257688 | Ga0163162_102576882 | 67 |
| 303 | 3300013306 | Ga0163162_10838774 | Ga0163162_108387742 | 67 |
| 304 | 3300013306 | Ga0163162_12950766 | Ga0163162_129507662 | 67 |
| 305 | 3300013308 | Ga0157375_11821330 | Ga0157375_118213302 | 67 |
| 306 | 3300014325 | Ga0163163_10482371 | Ga0163163_104823711 | 67 |
| 307 | 3300014325 | Ga0163163_12805797 | Ga0163163_128057971 | 67 |
| 308 | 3300014326 | Ga0157380_12183870 | Ga0157380_121838702 | 67 |
| 309 | 3300014968 | Ga0157379_10028712 | Ga0157379_100287127 | 67 |
| 310 | 3300014968 | Ga0157379_10551672 | Ga0157379_105516721 | 67 |
| 311 | 3300015265 | Ga0182005_1141650 | Ga0182005_11416502 | 67 |
| 312 | 3300017792 | Ga0163161_10041846 | Ga0163161_100418462 | 67 |
| 313 | 3300021361 | Ga0213872_10071265 | Ga0213872_100712652 | 67 |
| 314 | 3300021377 | Ga0213874_10021796 | Ga0213874_100217962 | 67 |
| 315 | 3300021441 | Ga0213871_10170021 | Ga0213871_101700212 | 67 |
| 316 | 3300024227 | Ga0228598_1112391 | Ga0228598_11123912 | 67 |
| 317 | 3300025230 | Ga0209563_115192 | Ga0209563_1151922 | 67 |
| 318 | 3300025250 | Ga0209026_1056680 | Ga0209026_10566802 | 67 |
| 319 | 3300025253 | Ga0209677_101774 | Ga0209677_10177410 | 67 |
| 320 | 3300025295 | Ga0209564_1008190 | Ga0209564_10081903 | 67 |
| 321 | 3300025297 | Ga0209758_1002841 | Ga0209758_10028419 | 67 |
| 322 | 3300025297 | Ga0209758_1004616 | Ga0209758_100461611 | 67 |
| 323 | 3300025297 | Ga0209758_1056918 | Ga0209758_10569182 | 67 |
| 324 | 3300025297 | Ga0209758_1095318 | Ga0209758_10953182 | 67 |
| 325 | 3300025299 | Ga0209256_1024045 | Ga0209256_10240452 | 67 |
| 326 | 3300025302 | Ga0207426_1000237 | Ga0207426_100023750 | 67 |
| 327 | 3300025303 | Ga0209051_1152695 | Ga0209051_11526952 | 67 |
| 328 | 3300025304 | Ga0209257_1013515 | Ga0209257_10135153 | 67 |
| 329 | 3300025321 | Ga0207656_10348033 | Ga0207656_103480332 | 67 |
| 330 | 3300025899 | Ga0207642_10854068 | Ga0207642_108540682 | 67 |
| 331 | 3300025904 | Ga0207647_10033140 | Ga0207647_100331403 | 67 |
| 332 | 3300025906 | Ga0207699_10001088 | Ga0207699_100010885 | 67 |
| 333 | 3300025908 | Ga0207643_10396210 | Ga0207643_103962102 | 67 |
| 334 | 3300025909 | Ga0207705_10098200 | Ga0207705_100982002 | 67 |
| 335 | 3300025910 | Ga0207684_10286502 | Ga0207684_102865022 | 67 |
| 336 | 3300025914 | Ga0207671_10056430 | Ga0207671_100564302 | 67 |
| 337 | 3300025914 | Ga0207671_10194019 | Ga0207671_101940192 | 67 |
| 338 | 3300025915 | Ga0207693_10001127 | Ga0207693_1000112717 | 67 |
| 339 | 3300025915 | Ga0207693_10602203 | Ga0207693_106022032 | 67 |
| 340 | 3300025922 | Ga0207646_10388994 | Ga0207646_103889942 | 67 |
| 341 | 3300025922 | Ga0207646_10647662 | Ga0207646_106476622 | 67 |
| 342 | 3300025923 | Ga0207681_10029964 | Ga0207681_100299642 | 67 |
| 343 | 3300025923 | Ga0207681_10169720 | Ga0207681_101697202 | 67 |
| 344 | 3300025927 | Ga0207687_10593099 | Ga0207687_105930992 | 67 |
| 345 | 3300025928 | Ga0207700_10072031 | Ga0207700_100720313 | 67 |
| 346 | 3300025929 | Ga0207664_10020925 | Ga0207664_100209252 | 67 |
| 347 | 3300025931 | Ga0207644_10312599 | Ga0207644_103125992 | 67 |
| 348 | 3300025932 | Ga0207690_11233648 | Ga0207690_112336481 | 67 |
| 349 | 3300025932 | Ga0207690_11675192 | Ga0207690_116751922 | 67 |
| 350 | 3300025933 | Ga0207706_10119635 | Ga0207706_101196352 | 67 |
| 351 | 3300025933 | Ga0207706_10224369 | Ga0207706_102243692 | 67 |
| 352 | 3300025933 | Ga0207706_11312242 | Ga0207706_113122422 | 67 |
| 353 | 3300025935 | Ga0207709_11152907 | Ga0207709_111529072 | 67 |
| 354 | 3300025937 | Ga0207669_10256259 | Ga0207669_102562592 | 67 |
| 355 | 3300025939 | Ga0207665_10034187 | Ga0207665_100341872 | 67 |
| 356 | 3300025940 | Ga0207691_11077091 | Ga0207691_110770911 | 67 |
| 357 | 3300025942 | Ga0207689_10002319 | Ga0207689_100023192 | 67 |
| 358 | 3300025942 | Ga0207689_10058508 | Ga0207689_100585082 | 67 |
| 359 | 3300025942 | Ga0207689_10238726 | Ga0207689_102387262 | 67 |
| 360 | 3300025942 | Ga0207689_11411156 | Ga0207689_114111562 | 67 |
| 361 | 3300025944 | Ga0207661_11726829 | Ga0207661_117268292 | 67 |
| 362 | 3300025945 | Ga0207679_11843514 | Ga0207679_118435142 | 67 |
| 363 | 3300025961 | Ga0207712_10127097 | Ga0207712_101270972 | 67 |
| 364 | 3300025961 | Ga0207712_10145202 | Ga0207712_101452022 | 67 |
| 365 | 3300025961 | Ga0207712_10263986 | Ga0207712_102639862 | 67 |
| 366 | 3300025961 | Ga0207712_11679952 | Ga0207712_116799522 | 67 |
| 367 | 3300025961 | Ga0207712_12005621 | Ga0207712_120056212 | 67 |
| 368 | 3300025972 | Ga0207668_10000974 | Ga0207668_1000097416 | 67 |
| 369 | 3300025972 | Ga0207668_10135925 | Ga0207668_101359252 | 67 |
| 370 | 3300025972 | Ga0207668_10151191 | Ga0207668_101511912 | 67 |
| 371 | 3300025972 | Ga0207668_10201984 | Ga0207668_102019842 | 67 |
| 372 | 3300025972 | Ga0207668_10445048 | Ga0207668_104450482 | 67 |
| 373 | 3300025972 | Ga0207668_10748181 | Ga0207668_107481812 | 67 |
| 374 | 3300025972 | Ga0207668_10763803 | Ga0207668_107638032 | 67 |
| 375 | 3300025972 | Ga0207668_11109179 | Ga0207668_111091791 | 67 |
| 376 | 3300025972 | Ga0207668_11233224 | Ga0207668_112332242 | 67 |
| 377 | 3300025972 | Ga0207668_11349799 | Ga0207668_113497991 | 67 |
| 378 | 3300025986 | Ga0207658_10187590 | Ga0207658_101875902 | 67 |
| 379 | 3300025986 | Ga0207658_10319177 | Ga0207658_103191772 | 67 |
| 380 | 3300025986 | Ga0207658_12149429 | Ga0207658_121494292 | 67 |
| 381 | 3300026023 | Ga0207677_10361369 | Ga0207677_103613692 | 67 |
| 382 | 3300026023 | Ga0207677_10455391 | Ga0207677_104553912 | 67 |
| 383 | 3300026023 | Ga0207677_11221932 | Ga0207677_112219322 | 67 |
| 384 | 3300026023 | Ga0207677_11779249 | Ga0207677_117792492 | 67 |
| 385 | 3300026041 | Ga0207639_10549351 | Ga0207639_105493512 | 67 |
| 386 | 3300026041 | Ga0207639_10576505 | Ga0207639_105765051 | 67 |
| 387 | 3300026067 | Ga0207678_10035523 | Ga0207678_100355232 | 67 |
| 388 | 3300026067 | Ga0207678_10067264 | Ga0207678_100672642 | 67 |
| 389 | 3300026067 | Ga0207678_10481685 | Ga0207678_104816852 | 67 |
| 390 | 3300026067 | Ga0207678_11185368 | Ga0207678_111853682 | 67 |
| 391 | 3300026067 | Ga0207678_11958780 | Ga0207678_119587802 | 67 |
| 392 | 3300026075 | Ga0207708_10026915 | Ga0207708_100269152 | 67 |
| 393 | 3300026088 | Ga0207641_10083985 | Ga0207641_100839852 | 67 |
| 394 | 3300026089 | Ga0207648_11375600 | Ga0207648_113756001 | 67 |
| 395 | 3300026118 | Ga0207675_100000292 | Ga0207675_10000029226 | 67 |
| 396 | 3300026118 | Ga0207675_100002084 | Ga0207675_1000020842 | 67 |
| 397 | 3300026118 | Ga0207675_100052391 | Ga0207675_1000523914 | 67 |
| 398 | 3300026118 | Ga0207675_100191951 | Ga0207675_1001919512 | 67 |
| 399 | 3300026118 | Ga0207675_100969014 | Ga0207675_1009690142 | 67 |
| 400 | 3300026118 | Ga0207675_101392656 | Ga0207675_1013926562 | 67 |
| 401 | 3300026118 | Ga0207675_102000046 | Ga0207675_1020000462 | 67 |
| 402 | 3300026121 | Ga0207683_10161334 | Ga0207683_101613342 | 67 |
| 403 | 3300026142 | Ga0207698_11595354 | Ga0207698_115953541 | 67 |
| 404 | 3300027296 | Ga0209389_1000111 | Ga0209389_100011127 | 67 |
| 405 | 3300027361 | Ga0209489_100220 | Ga0209489_10022069 | 67 |
| 406 | 3300027363 | Ga0209700_100041 | Ga0209700_100041147 | 67 |
| 407 | 3300027512 | Ga0209179_1007728 | Ga0209179_10077281 | 67 |
| 408 | 3300027512 | Ga0209179_1033781 | Ga0209179_10337811 | 67 |
| 409 | 3300027512 | Ga0209179_1143562 | Ga0209179_11435622 | 67 |
| 410 | 3300027512 | Ga0209179_1151061 | Ga0209179_11510611 | 67 |
| 411 | 3300027671 | Ga0209588_1001077 | Ga0209588_10010776 | 67 |
| 412 | 3300027671 | Ga0209588_1004743 | Ga0209588_10047432 | 67 |
| 413 | 3300027866 | Ga0209813_10051131 | Ga0209813_100511312 | 67 |
| 414 | 3300027866 | Ga0209813_10437054 | Ga0209813_104370542 | 67 |
| 415 | 3300028379 | Ga0268266_10036157 | Ga0268266_100361572 | 67 |
| 416 | 3300028379 | Ga0268266_10118498 | Ga0268266_101184982 | 67 |
| 417 | 3300028379 | Ga0268266_10129209 | Ga0268266_101292092 | 67 |
| 418 | 3300028379 | Ga0268266_11304884 | Ga0268266_113048842 | 67 |
| 419 | 3300028379 | Ga0268266_11419139 | Ga0268266_114191392 | 67 |
| 420 | 3300028380 | Ga0268265_10007544 | Ga0268265_100075445 | 67 |
| 421 | 3300028380 | Ga0268265_10025786 | Ga0268265_100257862 | 67 |
| 422 | 3300028380 | Ga0268265_10262817 | Ga0268265_102628172 | 67 |
| 423 | 3300028380 | Ga0268265_10319190 | Ga0268265_103191902 | 67 |
| 424 | 3300028380 | Ga0268265_10454083 | Ga0268265_104540831 | 67 |
| 425 | 3300028380 | Ga0268265_10797024 | Ga0268265_107970242 | 67 |
| 426 | 3300028380 | Ga0268265_11089910 | Ga0268265_110899102 | 67 |
| 427 | 3300028380 | Ga0268265_12056355 | Ga0268265_120563552 | 67 |
| 428 | 3300028381 | Ga0268264_10095897 | Ga0268264_100958972 | 67 |
| 429 | 3300028381 | Ga0268264_10151711 | Ga0268264_101517112 | 67 |
| 430 | 3300028381 | Ga0268264_11039525 | Ga0268264_110395252 | 67 |
| 431 | 3300028381 | Ga0268264_11300628 | Ga0268264_113006282 | 67 |
| 432 | 3300028786 | Ga0307517_10558529 | Ga0307517_105585292 | 67 |
| 433 | 3300031711 | Ga0265314_10252709 | Ga0265314_102527092 | 67 |
| 434 | 3300031731 | Ga0307405_10344593 | Ga0307405_103445932 | 67 |
| 435 | 3300031824 | Ga0307413_10147834 | Ga0307413_101478342 | 67 |
| 436 | 3300031889 | Ga0326468_10075572 | Ga0326468_100755722 | 67 |
| 437 | 3300031901 | Ga0307406_10023908 | Ga0307406_100239082 | 67 |
| 438 | 3300031995 | Ga0307409_100196042 | Ga0307409_1001960421 | 67 |
| 439 | 3300032002 | Ga0307416_103629361 | Ga0307416_1036293612 | 67 |
| 440 | 3300032005 | Ga0307411_11151051 | Ga0307411_111510512 | 67 |
| 441 | 3300032126 | Ga0307415_100093579 | Ga0307415_1000935792 | 67 |
| 442 | 3300032126 | Ga0307415_100726357 | Ga0307415_1007263572 | 67 |
| 443 | 3300032126 | Ga0307415_101131851 | Ga0307415_1011318512 | 67 |
| 444 | 3300033180 | Ga0307510_10023418 | Ga0307510_100234186 | 67 |
| 445 | 3300035085 | Ga0373929_0182493 | Ga0373929_0182493_169_372 | 67 |
| 446 | 3300035111 | Ga0373923_0495098 | Ga0373923_0495098_278_481 | 67 |
| 447 | 3300037471 | Ga0395905_0119259 | Ga0395905_0119259_556_759 | 67 |
| 448 | 3300037853 | Ga0436364_0033021 | Ga0436364_0033021_583_786 | 67 |
| 449 | 3300037853 | Ga0436364_1464438 | Ga0436364_1464438_704_907 | 67 |
| 450 | 3300039438 | Ga0436360_0694609 | Ga0436360_0694609_199_402 | 67 |
| 451 | 3300039438 | Ga0436360_1002729 | Ga0436360_1002729_258_461 | 67 |
| 452 | 3300039438 | Ga0436360_1041418 | Ga0436360_1041418_2198_2401 | 67 |
| 453 | 3300039438 | Ga0436360_1147395 | Ga0436360_1147395_185_388 | 67 |
| 454 | 3300039438 | Ga0436360_1233842 | Ga0436360_1233842_500_703 | 67 |
| 455 | 3300039447 | Ga0436361_0094480 | Ga0436361_0094480_870_1073 | 67 |
| 456 | 3300039447 | Ga0436361_0166896 | Ga0436361_0166896_34_237 | 67 |
| 457 | 3300039447 | Ga0436361_0207409 | Ga0436361_0207409_473_676 | 67 |
| 458 | 3300039447 | Ga0436361_0257034 | Ga0436361_0257034_261_464 | 67 |
| 459 | 3300039447 | Ga0436361_0348793 | Ga0436361_0348793_604_807 | 67 |
| 460 | 3300039447 | Ga0436361_0574455 | Ga0436361_0574455_733_936 | 67 |
| 461 | 3300039447 | Ga0436361_0609475 | Ga0436361_0609475_2161_2364 | 67 |
| 462 | 3300039447 | Ga0436361_0778974 | Ga0436361_0778974_249_452 | 67 |
| 463 | 3300039447 | Ga0436361_0836635 | Ga0436361_0836635_88_291 | 67 |
| 464 | 3300039447 | Ga0436361_0888936 | Ga0436361_0888936_422_625 | 67 |
| 465 | 3300039447 | Ga0436361_1213965 | Ga0436361_1213965_239_442 | 67 |
| 466 | 3300039450 | Ga0436363_0344498 | Ga0436363_0344498_120_323 | 67 |
| 467 | 3300039450 | Ga0436363_0409156 | Ga0436363_0409156_82_285 | 67 |
| 468 | 3300039450 | Ga0436363_0847268 | Ga0436363_0847268_487_690 | 67 |
| 469 | 3300039450 | Ga0436363_0950339 | Ga0436363_0950339_213_416 | 67 |
| 470 | 3300039450 | Ga0436363_1050913 | Ga0436363_1050913_954_1160 | 67 |
| 471 | 3300039453 | Ga0436362_0768814 | Ga0436362_0768814_51_254 | 67 |
| 472 | 3300041451 | Ga0451791_0755109 | Ga0451791_0755109_659_862 | 67 |
| 473 | 3300041453 | Ga0451797_0024858 | Ga0451797_0024858_198_401 | 67 |
| 474 | 3300041453 | Ga0451797_0807360 | Ga0451797_0807360_28_231 | 67 |
| 475 | 3300041460 | Ga0451802_0746896 | Ga0451802_0746896_122_325 | 67 |
| 476 | 3300041486 | Ga0451807_0505980 | Ga0451807_0505980_215_418 | 67 |
| 477 | 3300041486 | Ga0451807_1285822 | Ga0451807_1285822_363_566 | 67 |
| 478 | 3300041512 | Ga0451853_0257560 | Ga0451853_0257560_507_710 | 67 |
| 479 | 3300046462 | Ga0495651_0012427 | Ga0495651_0012427_4604_4807 | 67 |
| 480 | 3300046463 | Ga0495653_0091288 | Ga0495653_0091288_89_292 | 67 |
| 481 | 3300046471 | Ga0495650_0062483 | Ga0495650_0062483_601_804 | 67 |
| 482 | 3300046477 | Ga0495664_0218164 | Ga0495664_0218164_377_580 | 67 |
| 483 | 3300046491 | Ga0495584_0367083 | Ga0495584_0367083_386_589 | 67 |
| 484 | 3300046500 | Ga0495596_0327544 | Ga0495596_0327544_106_309 | 67 |
| 485 | 3300046501 | Ga0495607_0275113 | Ga0495607_0275113_12_215 | 67 |
| 486 | 3300046507 | Ga0495606_0029681 | Ga0495606_0029681_2262_2465 | 67 |
| 487 | 3300046507 | Ga0495606_0195694 | Ga0495606_0195694_929_1132 | 67 |
| 488 | 3300046512 | Ga0495610_0038267 | Ga0495610_0038267_2048_2251 | 67 |
| 489 | 3300046513 | Ga0495616_0449556 | Ga0495616_0449556_187_390 | 67 |
| 490 | 3300046518 | Ga0495631_0070858 | Ga0495631_0070858_732_935 | 67 |
| 491 | 3300046524 | Ga0495648_0088554 | Ga0495648_0088554_138_341 | 67 |
| 492 | 3300046529 | Ga0495652_0013893 | Ga0495652_0013893_4905_5108 | 67 |
| 493 | 3300046533 | Ga0495640_0179264 | Ga0495640_0179264_874_1077 | 67 |
| 494 | 3300046536 | Ga0495587_0133640 | Ga0495587_0133640_908_1111 | 67 |
| 495 | 3300046537 | Ga0495598_0091747 | Ga0495598_0091747_662_865 | 67 |
| 496 | 3300046543 | Ga0495645_0777995 | Ga0495645_0777995_77_280 | 67 |
| 497 | 3300046615 | Ga0495656_0070148 | Ga0495656_0070148_399_602 | 67 |
| 498 | 3300046615 | Ga0495656_0181030 | Ga0495656_0181030_50_253 | 67 |
| 499 | 3300046616 | Ga0495668_0067288 | Ga0495668_0067288_1104_1307 | 67 |
| 500 | 3300046642 | Ga0495634_0335451 | Ga0495634_0335451_604_807 | 67 |
| 501 | 3300046660 | Ga0495625_0432123 | Ga0495625_0432123_138_341 | 67 |
| 502 | 3300046660 | Ga0495625_0675713 | Ga0495625_0675713_24_227 | 67 |
| 503 | 3300046675 | Ga0495657_0234353 | Ga0495657_0234353_470_673 | 67 |
| 504 | 3300046684 | Ga0495669_0254134 | Ga0495669_0254134_242_445 | 67 |
| 505 | 3300046694 | Ga0495649_0160021 | Ga0495649_0160021_675_878 | 67 |
| 506 | 3300046809 | Ga0495600_0255472 | Ga0495600_0255472_342_545 | 67 |
| 507 | 3300047317 | Ga0495604_0183010 | Ga0495604_0183010_181_384 | 67 |
| 508 | 3300047320 | Ga0495672_0056059 | Ga0495672_0056059_168_371 | 67 |
| 509 | 3300047320 | Ga0495672_0067182 | Ga0495672_0067182_1238_1441 | 67 |
| 510 | 3300047321 | Ga0495676_0432514 | Ga0495676_0432514_260_463 | 67 |
| 511 | 3300047472 | Ga0495686_0137489 | Ga0495686_0137489_686_889 | 67 |
| 512 | 3300047472 | Ga0495686_0213438 | Ga0495686_0213438_733_936 | 67 |
| 513 | 3300047472 | Ga0495686_0331037 | Ga0495686_0331037_193_396 | 67 |
| 514 | 3300048088 | Ga0495602_0069899 | Ga0495602_0069899_2295_2498 | 67 |
| 515 | 3300048904 | Ga0496101_1047400 | Ga0496101_1047400_67_270 | 67 |
| 516 | 3300048904 | Ga0496101_1519113 | Ga0496101_1519113_218_421 | 67 |
| 517 | 3300048905 | Ga0496102_0886855 | Ga0496102_0886855_42_245 | 67 |
| 518 | 3300048906 | Ga0496103_0097147 | Ga0496103_0097147_702_905 | 67 |
| 519 | 3300048906 | Ga0496103_0321170 | Ga0496103_0321170_167_370 | 67 |
| 520 | 3300048906 | Ga0496103_0458127 | Ga0496103_0458127_428_631 | 67 |
| 521 | 3300048907 | Ga0496104_0219431 | Ga0496104_0219431_1007_1210 | 67 |
| 522 | 3300048908 | Ga0496105_0122280 | Ga0496105_0122280_392_595 | 67 |
| 523 | 3300048908 | Ga0496105_0279409 | Ga0496105_0279409_176_379 | 67 |
| 524 | 3300048909 | Ga0496106_0161795 | Ga0496106_0161795_1127_1330 | 67 |
| 525 | 3300048909 | Ga0496106_0587165 | Ga0496106_0587165_609_812 | 67 |
| 526 | 3300048909 | Ga0496106_0803240 | Ga0496106_0803240_20_223 | 67 |
| 527 | 3300048909 | Ga0496106_1479465 | Ga0496106_1479465_278_481 | 67 |
| 528 | 3300048911 | Ga0496108_0039345 | Ga0496108_0039345_2738_2941 | 67 |
| 529 | 3300048911 | Ga0496108_0499287 | Ga0496108_0499287_607_810 | 67 |
| 530 | 3300048912 | Ga0496109_0317598 | Ga0496109_0317598_978_1181 | 67 |
| 531 | 3300048912 | Ga0496109_1359255 | Ga0496109_1359255_99_302 | 67 |
| 532 | 3300048913 | Ga0496110_0142988 | Ga0496110_0142988_554_757 | 67 |
| 533 | 3300048913 | Ga0496110_1167388 | Ga0496110_1167388_257_460 | 67 |
| 534 | 3300048915 | Ga0496112_0138740 | Ga0496112_0138740_756_959 | 67 |
| 535 | 3300048917 | Ga0496114_0063402 | Ga0496114_0063402_1044_1247 | 67 |
| 536 | 3300048918 | Ga0496115_0366926 | Ga0496115_0366926_474_677 | 67 |
| 537 | 3300048918 | Ga0496115_0503485 | Ga0496115_0503485_529_732 | 67 |
| 538 | 3300048919 | Ga0496116_0265603 | Ga0496116_0265603_599_802 | 67 |
| 539 | 3300048920 | Ga0496117_0364226 | Ga0496117_0364226_279_482 | 67 |
| 540 | 3300048921 | Ga0496118_0020399 | Ga0496118_0020399_4801_5004 | 67 |
| 541 | 3300048921 | Ga0496118_0499856 | Ga0496118_0499856_360_563 | 67 |
| 542 | 3300048922 | Ga0496119_0096153 | Ga0496119_0096153_1313_1516 | 67 |
| 543 | 3300048922 | Ga0496119_0148123 | Ga0496119_0148123_180_383 | 67 |
| 544 | 3300048922 | Ga0496119_0150788 | Ga0496119_0150788_13_216 | 67 |
| 545 | 3300048923 | Ga0496120_0029052 | Ga0496120_0029052_848_1051 | 67 |
| 546 | 3300048924 | Ga0496121_0007361 | Ga0496121_0007361_3010_3213 | 67 |
| 547 | 3300048924 | Ga0496121_0035562 | Ga0496121_0035562_618_821 | 67 |
| 548 | 3300048924 | Ga0496121_0144772 | Ga0496121_0144772_12_230 | 67 |
| 549 | 3300048924 | Ga0496121_0263552 | Ga0496121_0263552_467_670 | 67 |
| 550 | 3300048925 | Ga0496122_0612983 | Ga0496122_0612983_278_481 | 67 |
| 551 | 3300048927 | Ga0496124_0310949 | Ga0496124_0310949_592_795 | 67 |
| 552 | 3300048927 | Ga0496124_0603811 | Ga0496124_0603811_351_554 | 67 |
| 553 | 3300048928 | Ga0496125_0009470 | Ga0496125_0009470_5425_5628 | 67 |
| 554 | 3300048928 | Ga0496125_0221000 | Ga0496125_0221000_767_970 | 67 |
| 555 | 3300048929 | Ga0496126_0201335 | Ga0496126_0201335_855_1058 | 67 |
| 556 | 3300048929 | Ga0496126_0476050 | Ga0496126_0476050_423_626 | 67 |
| 557 | 3300049572 | Ga0501036_0939414 | Ga0501036_0939414_160_363 | 67 |
| 558 | 3300049578 | Ga0501042_0480032 | Ga0501042_0480032_596_799 | 67 |
| 559 | 3300049587 | Ga0501071_1408914 | Ga0501071_1408914_253_456 | 67 |
| 560 | 3300049590 | Ga0501074_0431877 | Ga0501074_0431877_29_232 | 67 |
| 561 | 3300049591 | Ga0501075_0043594 | Ga0501075_0043594_2755_2958 | 67 |
| 562 | 3300049592 | Ga0501076_0258081 | Ga0501076_0258081_199_402 | 67 |
| 563 | 3300049593 | Ga0501077_0120657 | Ga0501077_0120657_739_942 | 67 |
| 564 | 3300049741 | Ga0501079_0216627 | Ga0501079_0216627_1035_1238 | 67 |
| 565 | 3300050489 | nmdc:mga03683_26976_c1 | nmdc:mga03683_26976_c1_1899_2102 | 67 |
| 566 | 3300050489 | nmdc:mga03683_3056_c2 | nmdc:mga03683_3056_c2_3809_4012 | 67 |
| 567 | 3300050489 | nmdc:mga03683_651845_c1 | nmdc:mga03683_651845_c1_91_294 | 67 |
| 568 | 3300050491 | nmdc:mga00v17_297068_c1 | nmdc:mga00v17_297068_c1_158_361 | 67 |
| 569 | 3300050491 | nmdc:mga00v17_73006_c1 | nmdc:mga00v17_73006_c1_185_388 | 67 |
| 570 | 3300050491 | nmdc:mga00v17_850805_c1 | nmdc:mga00v17_850805_c1_213_416 | 67 |
| 571 | 3300050492 | nmdc:mga0yw44_11934_c1 | nmdc:mga0yw44_11934_c1_834_1037 | 67 |
| 572 | 3300050492 | nmdc:mga0yw44_1835_c1 | nmdc:mga0yw44_1835_c1_1147_1350 | 67 |
| 573 | 3300050492 | nmdc:mga0yw44_39024_c1 | nmdc:mga0yw44_39024_c1_840_1043 | 67 |
| 574 | 3300050492 | nmdc:mga0yw44_42017_c1 | nmdc:mga0yw44_42017_c1_283_486 | 67 |
| 575 | 3300050493 | nmdc:mga0k408_94169_c1 | nmdc:mga0k408_94169_c1_924_1127 | 67 |
| 576 | 3300050494 | nmdc:mga06z11_12407_c1 | nmdc:mga06z11_12407_c1_2664_2867 | 67 |
| 577 | 3300050494 | nmdc:mga06z11_14155_c1 | nmdc:mga06z11_14155_c1_227_430 | 67 |
| 578 | 3300050494 | nmdc:mga06z11_158041_c1 | nmdc:mga06z11_158041_c1_1019_1222 | 67 |
| 579 | 3300050494 | nmdc:mga06z11_207153_c1 | nmdc:mga06z11_207153_c1_321_524 | 67 |
| 580 | 3300050494 | nmdc:mga06z11_37564_c1 | nmdc:mga06z11_37564_c1_556_759 | 67 |
| 581 | 3300050494 | nmdc:mga06z11_847341_c1 | nmdc:mga06z11_847341_c1_127_330 | 67 |
| 582 | 3300050495 | nmdc:mga04h51_410086_c1 | nmdc:mga04h51_410086_c1_31_234 | 67 |
| 583 | 3300050495 | nmdc:mga04h51_84255_c1 | nmdc:mga04h51_84255_c1_805_1008 | 67 |
| 584 | 3300050496 | nmdc:mga07m45_28356_c1 | nmdc:mga07m45_28356_c1_2670_2873 | 67 |
| 585 | 3300050496 | nmdc:mga07m45_42484_c1 | nmdc:mga07m45_42484_c1_1650_1853 | 67 |
| 586 | 3300050496 | nmdc:mga07m45_679845_c1 | nmdc:mga07m45_679845_c1_200_403 | 67 |
| 587 | 3300050496 | nmdc:mga07m45_76449_c1 | nmdc:mga07m45_76449_c1_827_1030 | 67 |
| 588 | 3300050507 | nmdc:mga05p37_1469142_c1 | nmdc:mga05p37_1469142_c1_283_486 | 67 |
| 589 | 3300050509 | nmdc:mga0qj67_420814_c1 | nmdc:mga0qj67_420814_c1_709_912 | 67 |
| 590 | 3300050516 | nmdc:mga0sz30_432746_c1 | nmdc:mga0sz30_432746_c1_174_377 | 67 |
| 591 | 3300050516 | nmdc:mga0sz30_5993_c3 | nmdc:mga0sz30_5993_c3_128_331 | 67 |
| 592 | 3300050516 | nmdc:mga0sz30_670_c1 | nmdc:mga0sz30_670_c1_2842_3045 | 67 |
| 593 | 3300050516 | nmdc:mga0sz30_95591_c1 | nmdc:mga0sz30_95591_c1_158_361 | 67 |
| 594 | 3300053079 | Ga0500610_0134709 | Ga0500610_0134709_262_465 | 67 |
| 595 | 3300053085 | Ga0495619_0231417 | Ga0495619_0231417_106_309 | 67 |
| 596 | 3300053086 | Ga0500578_0029278 | Ga0500578_0029278_1379_1582 | 67 |
| 597 | 3300053086 | Ga0500578_0076379 | Ga0500578_0076379_1505_1708 | 67 |
| 598 | 3300053087 | Ga0500643_029973 | Ga0500643_029973_538_750 | 67 |
| 599 | 3300053090 | Ga0500646_0134974 | Ga0500646_0134974_104_307 | 67 |
| 600 | 3300053093 | Ga0500651_0034756 | Ga0500651_0034756_1382_1585 | 67 |
| 601 | 3300053094 | Ga0500566_0000029 | Ga0500566_0000029_59195_59398 | 67 |
| 602 | 3300053104 | Ga0500556_0098192 | Ga0500556_0098192_228_431 | 67 |
| 603 | 3300053108 | Ga0500562_026548 | Ga0500562_026548_890_1093 | 67 |
| 604 | 3300053108 | Ga0500562_208909 | Ga0500562_208909_289_492 | 67 |
| 605 | 3300053122 | Ga0500608_095575 | Ga0500608_095575_614_817 | 67 |
| 606 | 3300053131 | Ga0500652_005050 | Ga0500652_005050_742_945 | 67 |
| 607 | 3300053142 | Ga0500577_0370203 | Ga0500577_0370203_83_286 | 67 |
| 608 | 3300053150 | Ga0500603_048928 | Ga0500603_048928_281_484 | 67 |
| 609 | 3300053151 | Ga0500604_0035034 | Ga0500604_0035034_1108_1311 | 67 |
| 610 | 3300053156 | Ga0500622_0003040 | Ga0500622_0003040_4396_4599 | 67 |
| 611 | 3300053160 | Ga0500633_0323921 | Ga0500633_0323921_107_310 | 67 |
| 612 | 3300053162 | Ga0500638_294503 | Ga0500638_294503_358_561 | 67 |
| 613 | 3300053177 | Ga0500636_0324819 | Ga0500636_0324819_294_497 | 67 |
| 614 | 3300053177 | Ga0500636_0446299 | Ga0500636_0446299_367_570 | 67 |
| 615 | 3300053730 | Ga0500645_017379 | Ga0500645_017379_1726_1929 | 67 |
| 616 | 3300053731 | Ga0500609_028257 | Ga0500609_028257_427_630 | 67 |
| 617 | 3300053736 | Ga0500599_000276 | Ga0500599_000276_1217_1420 | 67 |
| 618 | 3300053737 | Ga0500601_000316 | Ga0500601_000316_6105_6308 | 67 |
| 619 | 3300054114 | Ga0501084_0762194 | Ga0501084_0762194_384_587 | 67 |
| 620 | 3300055283 | Ga0500661_035451 | Ga0500661_035451_528_731 | 67 |
| 621 | 3300061734 | Ga0530510_0655813 | Ga0530510_0655813_254_457 | 67 |
| 622 | iso_pu_bacteria | 2824661429 | 2824663938 | 67 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar