F470058

General Info

Members Datasets Scaffolds Average Seq Length
621 327 1242 101

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0061140|Ga0501084_0061140_464_838
Length 124
Sequence MRRGEIWFAATPGGNRPVLVLTRDPVAERIDRLVVAGLTRTVRGLVSELELTPEADGVPTRCVVNFDNIHTLSRRALRRRVAALSPARMAQAWRAPEEWRRGDRTPPPTRRAQACRALNDALGC

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
193 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
206 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
306 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
307 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 3.54
Rhizosphere 91.47
Stem 0
Stem Tuber 0
Unclassified 18.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0061140 3300054114 Bacteria 3153
2 JGI24738J21930_10029105 3300002075 Bacteria 1130
3 JGI24744J21845_10000294 3300002077 Bacteria 8350
4 JGI24742J22300_10000694 3300002244 Bacteria 5094
5 JGI25406J46586_10011304 3300003203 Bacteria 3922
6 JGI25406J46586_10041296 3300003203 Bacteria 1625
7 Ga0070676_10009710 3300005328 Bacteria 5204
8 Ga0070690_100002355 3300005330 Bacteria 10162
9 Ga0070670_100175029 3300005331 Unclassified 1862
10 Ga0070677_10330937 3300005333 Bacteria 783
11 Ga0068869_100011426 3300005334 Bacteria 5823
12 Ga0070666_10108425 3300005335 Bacteria 1919
13 Ga0070680_100768587 3300005336 Unclassified 830
14 Ga0070680_100864023 3300005336 Bacteria 780
15 Ga0070682_100015499 3300005337 Bacteria 4417
16 Ga0070682_100504691 3300005337 Unclassified 938
17 Ga0070682_101384826 3300005337 Bacteria 601
18 Ga0068868_100051215 3300005338 Bacteria 3246
19 Ga0070660_100061161 3300005339 Bacteria 2924
20 Ga0070689_100027320 3300005340 Bacteria 4303
21 Ga0070661_100653444 3300005344 Unclassified 854
22 Ga0070692_10045087 3300005345 Bacteria 2273
23 Ga0070668_100011731 3300005347 Bacteria 6524
24 Ga0070668_100669836 3300005347 Unclassified 913
25 Ga0070669_100007792 3300005353 Bacteria 7650
26 Ga0070671_100033873 3300005355 Bacteria 4226
27 Ga0070671_100096887 3300005355 Unclassified 2474
28 Ga0070674_100007150 3300005356 Bacteria 6564
29 Ga0070673_100370671 3300005364 Bacteria 1275
30 Ga0070688_100009822 3300005365 Bacteria 5260
31 Ga0070659_100029807 3300005366 Bacteria 4218
32 Ga0070667_100008563 3300005367 Bacteria 8478
33 Ga0070703_10112961 3300005406 Bacteria 974
34 Ga0070709_10169558 3300005434 Bacteria 1524
35 Ga0070714_100001383 3300005435 Bacteria 17559
36 Ga0070714_100528579 3300005435 Bacteria 1127
37 Ga0070713_100988562 3300005436 Unclassified 811
38 Ga0070710_10032360 3300005437 Bacteria 2832
39 Ga0070701_10003078 3300005438 Bacteria 6539
40 Ga0070711_100015531 3300005439 Bacteria 4819
41 Ga0070711_100055055 3300005439 Bacteria 2747
42 Ga0070705_100007542 3300005440 Bacteria 5357
43 Ga0070700_100004880 3300005441 Bacteria 7050
44 Ga0070694_100019150 3300005444 Bacteria 4353
45 Ga0070708_100012480 3300005445 Bacteria 6935
46 Ga0070708_100048668 3300005445 Bacteria 3748
47 Ga0070708_102096435 3300005445 Unclassified 523
48 Ga0070663_100014211 3300005455 Bacteria 5104
49 Ga0070678_100002940 3300005456 Bacteria 9442
50 Ga0070662_100012042 3300005457 Bacteria 5726
51 Ga0070681_10010901 3300005458 Bacteria 8987
52 Ga0070681_11107917 3300005458 Unclassified 713
53 Ga0068867_100018205 3300005459 Bacteria 4991
54 Ga0070685_10027688 3300005466 Bacteria 3135
55 Ga0070706_101231578 3300005467 Bacteria 687
56 Ga0070707_100464197 3300005468 Bacteria 1227
57 Ga0070707_100828246 3300005468 Bacteria 889
58 Ga0070707_101503388 3300005468 Bacteria 640
59 Ga0070707_101810355 3300005468 Unclassified 578
60 Ga0070698_100565108 3300005471 Bacteria 1077
61 Ga0070679_100000258 3300005530 Bacteria 44384
62 Ga0070679_100588093 3300005530 Bacteria 1056
63 Ga0070679_100988601 3300005530 Bacteria 785
64 Ga0070684_100275634 3300005535 Bacteria 1540
65 Ga0070697_100389461 3300005536 Bacteria 1208
66 Ga0070697_101782554 3300005536 Bacteria 551
67 Ga0068853_100013440 3300005539 Bacteria 6683
68 Ga0070686_100110334 3300005544 Bacteria 1873
69 Ga0070695_100051652 3300005545 Bacteria 2639
70 Ga0070696_100004524 3300005546 Bacteria 9280
71 Ga0070693_100006056 3300005547 Bacteria 5854
72 Ga0070693_100254522 3300005547 Bacteria 1165
73 Ga0070693_101581311 3300005547 Unclassified 514
74 Ga0070665_100604587 3300005548 Bacteria 1109
75 Ga0070665_100675498 3300005548 Bacteria 1046
76 Ga0070704_101744367 3300005549 Bacteria 575
77 Ga0068855_100685959 3300005563 Bacteria 1097
78 Ga0068855_102533588 3300005563 Bacteria 510
79 Ga0070664_101358774 3300005564 Unclassified 671
80 Ga0068854_100004011 3300005578 Bacteria 9242
81 Ga0068856_100035480 3300005614 Bacteria 4887
82 Ga0068856_100291990 3300005614 Unclassified 1647
83 Ga0070702_100014152 3300005615 Bacteria 4043
84 Ga0068852_100052639 3300005616 Bacteria 3500
85 Ga0068852_100328817 3300005616 Bacteria 1487
86 Ga0068859_100021190 3300005617 Bacteria 6522
87 Ga0068859_100636291 3300005617 Bacteria 1159
88 Ga0068864_101573873 3300005618 Unclassified 661
89 Ga0068866_10021097 3300005718 Bacteria 2995
90 Ga0068861_100006904 3300005719 Bacteria 7756
91 Ga0068870_10188837 3300005840 Unclassified 1242
92 Ga0068863_102639616 3300005841 Unclassified 511
93 Ga0068858_100015510 3300005842 Bacteria 7165
94 Ga0068858_100035445 3300005842 Bacteria 4628
95 Ga0068858_101359444 3300005842 Bacteria 699
96 Ga0068860_100015238 3300005843 Bacteria 7509
97 Ga0068860_100053932 3300005843 Bacteria 3822
98 Ga0068862_100027467 3300005844 Bacteria 4790
99 Ga0081539_10000200 3300005985 Bacteria 139291
100 Ga0081539_10000440 3300005985 Bacteria 88238
101 Ga0075365_10311271 3300006038 Bacteria 1109
102 Ga0070715_10002511 3300006163 Bacteria 5650
103 Ga0070716_100006794 3300006173 Bacteria 5607
104 Ga0070712_100034899 3300006175 Bacteria 3411
105 Ga0070712_100367531 3300006175 Unclassified 1181
106 Ga0070712_100475936 3300006175 Bacteria 1043
107 Ga0097621_100183468 3300006237 Bacteria 1809
108 Ga0075428_100018695 3300006844 Bacteria 7661
109 Ga0075430_100000151 3300006846 Bacteria 44886
110 Ga0075430_100449231 3300006846 Bacteria 1064
111 Ga0075431_100000040 3300006847 Bacteria 67199
112 Ga0075434_101731826 3300006871 Unclassified 632
113 Ga0075429_100000328 3300006880 Bacteria 34278
114 Ga0075429_100503142 3300006880 Unclassified 1062
115 Ga0068865_100011170 3300006881 Bacteria 5612
116 Ga0097620_100021190 3300006931 Bacteria 6522
117 Ga0097620_100636208 3300006931 Bacteria 1159
118 Ga0105240_10176008 3300009093 Bacteria 2529
119 Ga0105245_10000455 3300009098 Bacteria 37524
120 Ga0105245_10003007 3300009098 Bacteria 15117
121 Ga0105245_10895185 3300009098 Bacteria 929
122 Ga0105247_10017418 3300009101 Bacteria 4313
123 Ga0114129_10000157 3300009147 Bacteria 72630
124 Ga0105243_10016144 3300009148 Bacteria 5648
125 Ga0105242_10011655 3300009176 Bacteria 6764
126 Ga0105242_10776053 3300009176 Unclassified 946
127 Ga0105248_10012653 3300009177 Bacteria 9312
128 Ga0105248_11557184 3300009177 Bacteria 748
129 Ga0105237_10032039 3300009545 Bacteria 5323
130 Ga0105237_10153204 3300009545 Unclassified 2302
131 Ga0105249_10056819 3300009553 Bacteria 3583
132 Ga0105239_10028722 3300010375 Bacteria 6115
133 Ga0105239_10496041 3300010375 Bacteria 1388
134 Ga0105239_11046507 3300010375 Unclassified 939
135 Ga0105246_10384539 3300011119 Unclassified 1161
136 Ga0157373_10657778 3300013100 Bacteria 766
137 Ga0157370_10003677 3300013104 Bacteria 17915
138 Ga0157370_11065843 3300013104 Bacteria 731
139 Ga0157374_10005364 3300013296 Bacteria 10771
140 Ga0157374_10023974 3300013296 Bacteria 5465
141 Ga0157372_10061806 3300013307 Bacteria 4195
142 Ga0157372_10474887 3300013307 Bacteria 1458
143 Ga0157375_10016668 3300013308 Bacteria 6609
144 Ga0157375_13356165 3300013308 Bacteria 533
145 Ga0157380_10012892 3300014326 Bacteria 6076
146 Ga0157380_10227135 3300014326 Bacteria 1674
147 Ga0157376_10016548 3300014969 Bacteria 5602
148 Ga0163161_10008323 3300017792 Bacteria 7183
149 Ga0197907_10028247 3300020069 Bacteria 820
150 Ga0206354_11572828 3300020081 Unclassified 587
151 Ga0213873_10210147 3300021358 Unclassified 606
152 Ga0213874_10060282 3300021377 Unclassified 1187
153 Ga0213876_10418247 3300021384 Bacteria 713
154 Ga0213875_10000245 3300021388 Bacteria 54419
155 Ga0213875_10086192 3300021388 Bacteria 1465
156 Ga0213875_10222773 3300021388 Bacteria 888
157 Ga0207682_10212427 3300025893 Bacteria 893
158 Ga0207692_10019298 3300025898 Bacteria 3079
159 Ga0207692_11071663 3300025898 Unclassified 533
160 Ga0207642_10000977 3300025899 Bacteria 8923
161 Ga0207710_10007569 3300025900 Bacteria 4593
162 Ga0207688_10013016 3300025901 Bacteria 4523
163 Ga0207680_10209077 3300025903 Bacteria 1333
164 Ga0207685_10064397 3300025905 Bacteria 1464
165 Ga0207699_10300341 3300025906 Unclassified 1121
166 Ga0207645_10014477 3300025907 Bacteria 5278
167 Ga0207643_10227752 3300025908 Unclassified 1143
168 Ga0207684_11028502 3300025910 Bacteria 688
169 Ga0207671_10108152 3300025914 Unclassified 2113
170 Ga0207693_10000947 3300025915 Bacteria 26033
171 Ga0207693_10007844 3300025915 Bacteria 8765
172 Ga0207663_10094389 3300025916 Bacteria 1993
173 Ga0207663_11102187 3300025916 Unclassified 638
174 Ga0207660_10114534 3300025917 Bacteria 2034
175 Ga0207649_10036458 3300025920 Bacteria 2962
176 Ga0207652_10000196 3300025921 Bacteria 63727
177 Ga0207652_10519901 3300025921 Bacteria 1071
178 Ga0207646_10051458 3300025922 Bacteria 3686
179 Ga0207646_10657047 3300025922 Bacteria 939
180 Ga0207646_10731719 3300025922 Bacteria 883
181 Ga0207646_11180272 3300025922 Bacteria 672
182 Ga0207646_11493620 3300025922 Unclassified 585
183 Ga0207646_11604679 3300025922 Bacteria 561
184 Ga0207687_10000802 3300025927 Bacteria 21232
185 Ga0207687_10172668 3300025927 Bacteria 1669
186 Ga0207687_10469989 3300025927 Bacteria 1045
187 Ga0207664_10637741 3300025929 Bacteria 957
188 Ga0207664_10679152 3300025929 Bacteria 926
189 Ga0207644_10080251 3300025931 Unclassified 2409
190 Ga0207709_10249474 3300025935 Bacteria 1296
191 Ga0207709_11304111 3300025935 Bacteria 600
192 Ga0207670_10006206 3300025936 Bacteria 6614
193 Ga0207669_10001710 3300025937 Bacteria 9311
194 Ga0207704_10001333 3300025938 Bacteria 11016
195 Ga0207665_10000711 3300025939 Bacteria 22571
196 Ga0207691_11056076 3300025940 Unclassified 677
197 Ga0207711_10051774 3300025941 Bacteria 3517
198 Ga0207711_11295696 3300025941 Bacteria 671
199 Ga0207679_11271470 3300025945 Unclassified 675
200 Ga0207667_11860197 3300025949 Bacteria 565
201 Ga0207651_10001034 3300025960 Bacteria 12297
202 Ga0207712_10004962 3300025961 Bacteria 8416
203 Ga0207668_10048401 3300025972 Bacteria 2917
204 Ga0207658_10004349 3300025986 Bacteria 9851
205 Ga0207677_10222634 3300026023 Bacteria 1514
206 Ga0207677_10490915 3300026023 Unclassified 1060
207 Ga0207703_10010139 3300026035 Bacteria 7386
208 Ga0207703_10047798 3300026035 Bacteria 3451
209 Ga0207639_10017442 3300026041 Bacteria 5090
210 Ga0207678_10028469 3300026067 Bacteria 4878
211 Ga0207708_10007878 3300026075 Bacteria 7891
212 Ga0207702_10400383 3300026078 Bacteria 1324
213 Ga0207648_10002357 3300026089 Bacteria 20386
214 Ga0207675_100009180 3300026118 Bacteria 9278
215 Ga0207683_10011112 3300026121 Bacteria 7672
216 Ga0207698_10284739 3300026142 Bacteria 1531
217 Ga0207698_12719965 3300026142 Unclassified 503
218 Ga0268266_10516605 3300028379 Bacteria 1142
219 Ga0268265_10012784 3300028380 Bacteria 5698
220 Ga0268264_10182186 3300028381 Unclassified 1908
221 Ga0307517_10222553 3300028786 Bacteria 1145
222 Ga0307513_10481547 3300031456 Bacteria 961
223 Ga0316579_10205022 3300031691 Unclassified 954
224 Ga0316576_10109421 3300031727 Bacteria 2071
225 Ga0316576_10164718 3300031727 Unclassified 1673
226 Ga0316576_10834800 3300031727 Bacteria 662
227 Ga0316578_10154296 3300031728 Bacteria 1384
228 Ga0316577_10356320 3300031733 Unclassified 831
229 Ga0307413_11464930 3300031824 Unclassified 602
230 Ga0307410_10055640 3300031852 Bacteria 2687
231 Ga0307406_10000043 3300031901 Bacteria 71775
232 Ga0307407_10005378 3300031903 Bacteria 5553
233 Ga0307412_10003548 3300031911 Bacteria 8663
234 Ga0307409_100000091 3300031995 Bacteria 32395
235 Ga0307416_100000142 3300032002 Bacteria 42204
236 Ga0307416_101615160 3300032002 Bacteria 753
237 Ga0307411_10430899 3300032005 Bacteria 1098
238 Ga0307411_11458670 3300032005 Bacteria 628
239 Ga0307415_100011625 3300032126 Bacteria 5048
240 Ga0316580_10074147 3300032139 Bacteria 1042
241 Ga0373934_0012406 3300035086 Bacteria 3217
242 Ga0373951_0230151 3300035091 Bacteria 550
243 Ga0373923_0019991 3300035111 Bacteria 2597
244 Ga0373936_0021204 3300035113 Bacteria 2526
245 Ga0373939_0469947 3300035114 Bacteria 532
246 Ga0373945_0044284 3300035116 Bacteria 1617
247 Ga0373953_0003086 3300035117 Bacteria 5122
248 Ga0373953_0012956 3300035117 Unclassified 2967
249 Ga0373953_0180614 3300035117 Bacteria 910
250 Ga0373954_0027055 3300035118 Bacteria 2630
251 Ga0373956_0013330 3300035119 Bacteria 3419
252 Ga0373957_0014678 3300035120 Bacteria 2682
253 Ga0373943_0006996 3300035170 Bacteria 5060
254 Ga0373943_0722639 3300035170 Unclassified 591
255 Ga0373955_0033692 3300035172 Bacteria 2699
256 Ga0373955_0441668 3300035172 Unclassified 792
257 Ga0316574_0055930 3300035398 Bacteria 2467
258 Ga0316574_0367628 3300035398 Bacteria 909
259 Ga0316574_0494259 3300035398 Bacteria 763
260 Ga0373924_0004629 3300035410 Bacteria 4821
261 Ga0373924_0052448 3300035410 Bacteria 1693
262 Ga0373935_0076038 3300035692 Bacteria 2173
263 Ga0373927_0162653 3300035695 Unclassified 1462
264 Ga0373933_0003838 3300035724 Bacteria 8302
265 Ga0373933_0052881 3300035724 Bacteria 2431
266 Ga0373947_0115870 3300035725 Unclassified 1698
267 Ga0373937_0002347 3300036401 Bacteria 15774
268 Ga0373937_0012772 3300036401 Bacteria 7393
269 Ga0316582_0027473 3300036647 Bacteria 3438
270 Ga0316582_0728765 3300036647 Bacteria 681
271 Ga0316584_0060740 3300036712 Bacteria 2831
272 Ga0316584_0548534 3300036712 Unclassified 807
273 Ga0316584_0633709 3300036712 Bacteria 738
274 Ga0316584_0680314 3300036712 Bacteria 707
275 Ga0373925_1753591 3300037068 Unclassified 507
276 Ga0395899_0128558 3300037312 Bacteria 1810
277 Ga0395900_0112877 3300037418 Bacteria 2790
278 Ga0395898_0028255 3300037466 Bacteria 5624
279 Ga0395905_0417155 3300037471 Bacteria 1238
280 Ga0436364_0172109 3300037853 Bacteria 710
281 Ga0436364_0205652 3300037853 Unclassified 501
282 Ga0436364_0595019 3300037853 Bacteria 1257
283 Ga0436364_0598457 3300037853 Bacteria 535
284 Ga0436364_0825914 3300037853 Bacteria 7424
285 Ga0436364_0830865 3300037853 Unclassified 687
286 Ga0436364_1171458 3300037853 Bacteria 1607
287 Ga0436364_1176730 3300037853 Bacteria 110313
288 Ga0395901_0011617 3300038443 Bacteria 8919
289 Ga0400489_58026 3300039093 Bacteria 5157
290 Ga0436365_0562948 3300039437 Bacteria 546
291 Ga0436365_1678316 3300039437 Unclassified 3672
292 Ga0436365_1722956 3300039437 Bacteria 2443
293 Ga0436365_1862142 3300039437 Bacteria 1514
294 Ga0436360_0320088 3300039438 Bacteria 866
295 Ga0436360_1102922 3300039438 Bacteria 828
296 Ga0436363_0773035 3300039450 Bacteria 3023
297 Ga0436363_0773602 3300039450 Unclassified 2409
298 Ga0436363_0877914 3300039450 Bacteria 592
299 Ga0436363_1025381 3300039450 Bacteria 2075
300 Ga0436362_0589127 3300039453 Unclassified 606
301 Ga0436362_0617474 3300039453 Bacteria 2415
302 Ga0436362_0783084 3300039453 Unclassified 665
303 Ga0436362_1109566 3300039453 Unclassified 920
304 Ga0451845_0942775 3300041501 Bacteria 600
305 Ga0451853_2381572 3300041512 Bacteria 870
306 Ga0451853_2967054 3300041512 Bacteria 770
307 Ga0451853_3213639 3300041512 Bacteria 593
308 Ga0439434_0318591 3300042435 Unclassified 540
309 Ga0466969_0144517 3300044656 Bacteria 1098
310 Ga0466969_0365906 3300044656 Unclassified 653
311 Ga0466961_0047457 3300044693 Bacteria 2746
312 Ga0466961_0515237 3300044693 Bacteria 722
313 Ga0466963_0044205 3300044694 Bacteria 2932
314 Ga0466963_0381328 3300044694 Bacteria 994
315 Ga0466964_0600396 3300044706 Bacteria 604
316 Ga0466968_0149011 3300044735 Bacteria 1074
317 Ga0466970_0296912 3300044765 Bacteria 911
318 Ga0466959_0077517 3300045049 Bacteria 2398
319 Ga0466959_0086856 3300045049 Bacteria 2250
320 Ga0466959_0579180 3300045049 Unclassified 756
321 Ga0466958_0033997 3300045836 Bacteria 3040
322 Ga0466958_0114036 3300045836 Bacteria 1688
323 Ga0466958_0288638 3300045836 Unclassified 1052
324 Ga0466967_0076568 3300045976 Bacteria 3010
325 Ga0466967_0540939 3300045976 Bacteria 1146
326 Ga0466967_0757944 3300045976 Bacteria 963
327 Ga0466967_1137270 3300045976 Bacteria 778
328 Ga0495592_0003871 3300046454 Bacteria 10826
329 Ga0495592_0009570 3300046454 Bacteria 7292
330 Ga0495603_0047255 3300046455 Bacteria 2564
331 Ga0495629_0032190 3300046459 Bacteria 3713
332 Ga0495629_0206346 3300046459 Bacteria 1358
333 Ga0495641_0002409 3300046461 Bacteria 14800
334 Ga0495651_0017015 3300046462 Bacteria 5632
335 Ga0495653_0020189 3300046463 Bacteria 5401
336 Ga0495580_0068698 3300046472 Bacteria 2477
337 Ga0495582_0026794 3300046473 Unclassified 3159
338 Ga0495639_0690307 3300046475 Bacteria 527
339 Ga0495662_0055178 3300046476 Bacteria 1919
340 Ga0495664_0055467 3300046477 Bacteria 2358
341 Ga0495664_0262181 3300046477 Bacteria 1045
342 Ga0495664_0266493 3300046477 Unclassified 1035
343 Ga0495594_0014955 3300046499 Bacteria 4073
344 Ga0495608_0002599 3300046511 Bacteria 12977
345 Ga0495608_0873606 3300046511 Bacteria 527
346 Ga0495618_0069249 3300046514 Bacteria 2243
347 Ga0495628_0009376 3300046516 Bacteria 8354
348 Ga0495628_0038732 3300046516 Bacteria 3814
349 Ga0495628_0245749 3300046516 Bacteria 1337
350 Ga0495628_0254994 3300046516 Bacteria 1308
351 Ga0495630_0226543 3300046517 Unclassified 1427
352 Ga0495666_0083419 3300046526 Unclassified 1511
353 Ga0495652_0005203 3300046529 Bacteria 12297
354 Ga0495652_0335115 3300046529 Bacteria 1089
355 Ga0495665_0085624 3300046531 Unclassified 1656
356 Ga0495640_0056786 3300046533 Bacteria 2673
357 Ga0495640_0413838 3300046533 Bacteria 826
358 Ga0495586_0786444 3300046535 Bacteria 549
359 Ga0495587_0017239 3300046536 Bacteria 4490
360 Ga0495587_0047054 3300046536 Bacteria 2558
361 Ga0495621_0184281 3300046539 Bacteria 834
362 Ga0495645_0127580 3300046543 Bacteria 1786
363 Ga0495645_0244563 3300046543 Bacteria 1195
364 Ga0495645_0393998 3300046543 Bacteria 884
365 Ga0495645_0529314 3300046543 Bacteria 733
366 Ga0495667_0061169 3300046559 Unclassified 2469
367 Ga0495667_0441984 3300046559 Bacteria 817
368 Ga0495667_0521443 3300046559 Bacteria 744
369 Ga0495667_0731882 3300046559 Unclassified 612
370 Ga0495634_0403615 3300046642 Unclassified 811
371 Ga0495635_0000017 3300046663 Bacteria 195506
372 Ga0495635_0005804 3300046663 Bacteria 8602
373 Ga0495657_0003222 3300046675 Bacteria 13423
374 Ga0495657_0012736 3300046675 Bacteria 6237
375 Ga0495599_0046563 3300046678 Bacteria 2719
376 Ga0495599_0711685 3300046678 Unclassified 578
377 Ga0495623_0020513 3300046679 Bacteria 4271
378 Ga0495646_0004009 3300046680 Bacteria 9222
379 Ga0495646_0007917 3300046680 Bacteria 6751
380 Ga0495647_0005759 3300046681 Bacteria 4073
381 Ga0495647_0151999 3300046681 Bacteria 993
382 Ga0495658_0050860 3300046683 Bacteria 2345
383 Ga0495669_0000466 3300046684 Bacteria 18887
384 Ga0495613_0079851 3300046689 Bacteria 2378
385 Ga0495613_0126506 3300046689 Bacteria 1832
386 Ga0495624_0000343 3300046690 Bacteria 36927
387 Ga0495624_0148479 3300046690 Unclassified 1434
388 Ga0495600_0001058 3300046809 Bacteria 14909
389 Ga0495600_0155084 3300046809 Bacteria 1481
390 Ga0495581_0579253 3300047315 Bacteria 650
391 Ga0495604_0000146 3300047317 Bacteria 61319
392 Ga0495604_0002791 3300047317 Bacteria 14012
393 Ga0495604_0442211 3300047317 Bacteria 850
394 Ga0495604_0842619 3300047317 Unclassified 576
395 Ga0495674_0004240 3300047319 Bacteria 13818
396 Ga0495674_0294843 3300047319 Unclassified 1325
397 Ga0495676_0000687 3300047321 Bacteria 28193
398 Ga0495676_0091403 3300047321 Bacteria 2275
399 Ga0495680_0003896 3300047322 Bacteria 14443
400 Ga0495680_0885713 3300047322 Unclassified 577
401 Ga0495675_0401143 3300047444 Unclassified 799
402 Ga0495679_015502 3300047446 Bacteria 2785
403 Ga0495684_0050418 3300047471 Bacteria 3178
404 Ga0495684_0138540 3300047471 Unclassified 1825
405 Ga0495684_0634445 3300047471 Unclassified 716
406 Ga0495593_0197421 3300047673 Unclassified 1011
407 Ga0495602_0010731 3300048088 Bacteria 9495
408 Ga0495602_0013215 3300048088 Bacteria 8445
409 Ga0495614_0004869 3300048089 Bacteria 6062
410 Ga0496100_0010390 3300048903 Bacteria 5266
411 Ga0496100_0629372 3300048903 Bacteria 835
412 Ga0496101_0002430 3300048904 Bacteria 11445
413 Ga0496102_0009091 3300048905 Bacteria 8526
414 Ga0496102_0252257 3300048905 Bacteria 1664
415 Ga0496102_0971451 3300048905 Bacteria 770
416 Ga0496103_0009516 3300048906 Bacteria 5753
417 Ga0496104_0085764 3300048907 Bacteria 3006
418 Ga0496104_0237036 3300048907 Unclassified 1736
419 Ga0496104_0812460 3300048907 Bacteria 841
420 Ga0496105_0145796 3300048908 Unclassified 1947
421 Ga0496106_0019074 3300048909 Bacteria 5083
422 Ga0496107_0005549 3300048910 Bacteria 8639
423 Ga0496108_0001236 3300048911 Bacteria 20040
424 Ga0496109_0000589 3300048912 Bacteria 30428
425 Ga0496109_0387318 3300048912 Unclassified 1321
426 Ga0496110_0040657 3300048913 Bacteria 4053
427 Ga0496111_1300173 3300048914 Bacteria 512
428 Ga0496112_0000026 3300048915 Bacteria 144758
429 Ga0496113_0119256 3300048916 Bacteria 2061
430 Ga0496114_0017569 3300048917 Bacteria 5776
431 Ga0496115_0019766 3300048918 Bacteria 5187
432 Ga0501031_0007148 3300049568 Bacteria 7287
433 Ga0501031_0049280 3300049568 Bacteria 2745
434 Ga0501031_0106079 3300049568 Bacteria 1834
435 Ga0501031_0743868 3300049568 Bacteria 629
436 Ga0501032_0001285 3300049569 Bacteria 20138
437 Ga0501032_0041295 3300049569 Bacteria 3133
438 Ga0501032_0740421 3300049569 Bacteria 622
439 Ga0501033_0060270 3300049570 Bacteria 2800
440 Ga0501033_0733384 3300049570 Unclassified 671
441 Ga0501034_0025573 3300049571 Bacteria 6011
442 Ga0501034_0184493 3300049571 Bacteria 2050
443 Ga0501034_0650448 3300049571 Unclassified 956
444 Ga0501034_0680512 3300049571 Bacteria 928
445 Ga0501036_0004702 3300049572 Bacteria 11023
446 Ga0501036_0074645 3300049572 Bacteria 2868
447 Ga0501036_0255247 3300049572 Bacteria 1469
448 Ga0501036_0305194 3300049572 Unclassified 1331
449 Ga0501036_0433876 3300049572 Bacteria 1095
450 Ga0501036_0532516 3300049572 Unclassified 977
451 Ga0501036_1141274 3300049572 Unclassified 636
452 Ga0501037_0001495 3300049573 Bacteria 17092
453 Ga0501037_0006954 3300049573 Bacteria 8265
454 Ga0501037_0196249 3300049573 Unclassified 1428
455 Ga0501037_0397880 3300049573 Bacteria 945
456 Ga0501038_0035116 3300049574 Bacteria 4404
457 Ga0501038_0056951 3300049574 Bacteria 3357
458 Ga0501038_0369599 3300049574 Bacteria 1114
459 Ga0501038_0471258 3300049574 Archaea 963
460 Ga0501038_0480845 3300049574 Bacteria 952
461 Ga0501038_1035879 3300049574 Bacteria 601
462 Ga0501039_0014493 3300049575 Bacteria 6036
463 Ga0501039_0046043 3300049575 Bacteria 3370
464 Ga0501039_0139030 3300049575 Bacteria 1907
465 Ga0501039_0632067 3300049575 Unclassified 838
466 Ga0501039_0632382 3300049575 Unclassified 838
467 Ga0501039_0948818 3300049575 Bacteria 669
468 Ga0501039_1027093 3300049575 Bacteria 640
469 Ga0501039_1378988 3300049575 Unclassified 543
470 Ga0501040_0012118 3300049576 Bacteria 5644
471 Ga0501040_0333257 3300049576 Unclassified 1086
472 Ga0501040_0431071 3300049576 Unclassified 948
473 Ga0501040_0498738 3300049576 Bacteria 877
474 Ga0501041_0003625 3300049577 Bacteria 8878
475 Ga0501041_0134716 3300049577 Bacteria 1539
476 Ga0501041_0159082 3300049577 Unclassified 1412
477 Ga0501041_0279082 3300049577 Bacteria 1051
478 Ga0501041_0430394 3300049577 Bacteria 837
479 Ga0501042_0067059 3300049578 Bacteria 2565
480 Ga0501042_0097617 3300049578 Bacteria 2112
481 Ga0501042_0436976 3300049578 Bacteria 949
482 Ga0501042_0617692 3300049578 Bacteria 788
483 Ga0501042_0763882 3300049578 Bacteria 703
484 Ga0501043_0004591 3300049579 Bacteria 11202
485 Ga0501043_0018269 3300049579 Bacteria 5498
486 Ga0501043_0683288 3300049579 Bacteria 751
487 Ga0501043_1020111 3300049579 Bacteria 588
488 Ga0501043_1236054 3300049579 Unclassified 523
489 Ga0501046_0012367 3300049580 Bacteria 7270
490 Ga0501046_0027092 3300049580 Bacteria 4680
491 Ga0501046_0070917 3300049580 Bacteria 2708
492 Ga0501046_0347910 3300049580 Archaea 1077
493 Ga0501046_0685754 3300049580 Bacteria 722
494 Ga0501047_0052821 3300049581 Bacteria 3928
495 Ga0501047_0165654 3300049581 Bacteria 2081
496 Ga0501047_0174478 3300049581 Bacteria 2018
497 Ga0501048_0006165 3300049582 Bacteria 9128
498 Ga0501048_0016957 3300049582 Bacteria 5368
499 Ga0501048_0047963 3300049582 Unclassified 3047
500 Ga0501048_0214646 3300049582 Bacteria 1364
501 Ga0501048_0357097 3300049582 Bacteria 1042
502 Ga0501048_0373750 3300049582 Bacteria 1017
503 Ga0501048_0551530 3300049582 Bacteria 827
504 Ga0501048_0948343 3300049582 Unclassified 619
505 Ga0501067_0019112 3300049583 Bacteria 3793
506 Ga0501067_0707449 3300049583 Bacteria 566
507 Ga0501068_0006420 3300049584 Bacteria 6481
508 Ga0501068_0040791 3300049584 Bacteria 2788
509 Ga0501068_0619084 3300049584 Bacteria 706
510 Ga0501068_0667875 3300049584 Bacteria 679
511 Ga0501069_0011212 3300049585 Bacteria 4754
512 Ga0501070_0001535 3300049586 Bacteria 20528
513 Ga0501070_0025414 3300049586 Bacteria 4967
514 Ga0501070_0350841 3300049586 Bacteria 1197
515 Ga0501070_0365248 3300049586 Bacteria 1170
516 Ga0501070_0856007 3300049586 Unclassified 711
517 Ga0501071_0013826 3300049587 Bacteria 5508
518 Ga0501071_0059464 3300049587 Bacteria 2765
519 Ga0501071_0166402 3300049587 Bacteria 1650
520 Ga0501071_0169453 3300049587 Bacteria 1634
521 Ga0501071_0361568 3300049587 Bacteria 1105
522 Ga0501072_0077129 3300049588 Bacteria 2638
523 Ga0501072_0107759 3300049588 Bacteria 2216
524 Ga0501072_0360933 3300049588 Bacteria 1153
525 Ga0501072_0576598 3300049588 Bacteria 888
526 Ga0501072_1076551 3300049588 Unclassified 626
527 Ga0501072_1097427 3300049588 Bacteria 619
528 Ga0501073_0018970 3300049589 Bacteria 4970
529 Ga0501073_0073021 3300049589 Bacteria 2389
530 Ga0501073_0485901 3300049589 Unclassified 854
531 Ga0501073_0787290 3300049589 Archaea 656
532 Ga0501074_0006494 3300049590 Bacteria 8445
533 Ga0501074_0010074 3300049590 Bacteria 6863
534 Ga0501074_0051545 3300049590 Bacteria 2970
535 Ga0501074_0076346 3300049590 Bacteria 2405
536 Ga0501074_0178715 3300049590 Bacteria 1514
537 Ga0501074_0332753 3300049590 Archaea 1078
538 Ga0501075_0018878 3300049591 Bacteria 4997
539 Ga0501075_0028374 3300049591 Bacteria 4131
540 Ga0501075_0041042 3300049591 Bacteria 3467
541 Ga0501075_0288096 3300049591 Bacteria 1251
542 Ga0501075_0908182 3300049591 Unclassified 669
543 Ga0501076_0015871 3300049592 Bacteria 5699
544 Ga0501076_0033246 3300049592 Bacteria 4027
545 Ga0501076_0046934 3300049592 Bacteria 3413
546 Ga0501076_0123906 3300049592 Bacteria 2093
547 Ga0501076_0413598 3300049592 Unclassified 1109
548 Ga0501076_1073049 3300049592 Unclassified 663
549 Ga0501077_0006820 3300049593 Bacteria 7026
550 Ga0501077_0021014 3300049593 Bacteria 4130
551 Ga0501077_0422334 3300049593 Bacteria 853
552 Ga0501077_0470404 3300049593 Bacteria 805
553 Ga0501079_0102371 3300049741 Bacteria 2221
554 Ga0501079_0129130 3300049741 Bacteria 1966
555 Ga0501079_0812417 3300049741 Bacteria 736
556 Ga0501079_0965556 3300049741 Bacteria 671
557 Ga0501079_1098968 3300049741 Bacteria 626
558 Ga0501080_0042990 3300049742 Bacteria 4206
559 Ga0501080_0111853 3300049742 Bacteria 2531
560 Ga0501080_0185838 3300049742 Bacteria 1911
561 Ga0501080_0215189 3300049742 Bacteria 1760
562 Ga0501080_0319816 3300049742 Bacteria 1405
563 Ga0501080_0321536 3300049742 Bacteria 1401
564 Ga0501081_0012841 3300049743 Bacteria 5506
565 Ga0501081_0024057 3300049743 Bacteria 4088
566 Ga0501081_0484658 3300049743 Unclassified 921
567 Ga0501081_0736198 3300049743 Unclassified 741
568 Ga0501083_0010021 3300049744 Bacteria 6686
569 Ga0501083_0086043 3300049744 Bacteria 2079
570 Ga0501035_0028824 3300049822 Bacteria 5065
571 Ga0501035_0518334 3300049822 Bacteria 980
572 Ga0501035_0617503 3300049822 Unclassified 882
573 Ga0501035_1293940 3300049822 Bacteria 562
574 Ga0501044_0001233 3300049823 Bacteria 30387
575 Ga0501044_0031392 3300049823 Bacteria 5592
576 Ga0501044_0324707 3300049823 Bacteria 1463
577 Ga0501044_0470588 3300049823 Bacteria 1161
578 Ga0501045_0025925 3300049824 Bacteria 4214
579 Ga0501045_0028486 3300049824 Bacteria 4029
580 Ga0501045_0038766 3300049824 Bacteria 3466
581 Ga0501045_0067171 3300049824 Unclassified 2633
582 Ga0501045_0136883 3300049824 Bacteria 1821
583 Ga0501045_0142026 3300049824 Bacteria 1785
584 nmdc:mga0yw44_188067_c1 3300050492 Bacteria 1361
585 nmdc:mga05p37_825_c1 3300050507 Bacteria 34757
586 nmdc:mga09592_1191602_c1 3300050508 Bacteria 630
587 nmdc:mga09592_3396_c1 3300050508 Bacteria 12869
588 nmdc:mga0qj67_1785_c1 3300050509 Bacteria 15215
589 nmdc:mga0qj67_504836_c1 3300050509 Bacteria 972
590 nmdc:mga06r32_2487_c1 3300050510 Bacteria 16493
591 nmdc:mga06r32_55300_c1 3300050510 Bacteria 3807
592 nmdc:mga0rr50_99266_c1 3300050513 Bacteria 2284
593 nmdc:mga08x19_415336_c1 3300050514 Bacteria 945
594 Ga0495601_0000179 3300053077 Bacteria 33502
595 Ga0495601_0028025 3300053077 Bacteria 3486
596 Ga0495601_0115968 3300053077 Bacteria 1737
597 Ga0495601_0412453 3300053077 Unclassified 875
598 Ga0495595_0004393 3300053084 Bacteria 5673
599 Ga0495619_0054442 3300053085 Unclassified 2648
600 Ga0495619_0373435 3300053085 Unclassified 985
601 Ga0500569_128550 3300053109 Unclassified 847
602 Ga0501084_0034721 3300054114 Bacteria 4216
603 Ga0501084_0099017 3300054114 Bacteria 2448
604 Ga0501084_0149838 3300054114 Bacteria 1966
605 Ga0501084_0259231 3300054114 Bacteria 1468
606 Ga0501084_1434299 3300054114 Unclassified 578
607 Ga0501082_0020179 3300060353 Bacteria 5743
608 Ga0501082_0035905 3300060353 Bacteria 4271
609 Ga0501082_0074771 3300060353 Bacteria 2918
610 Ga0501082_0154729 3300060353 Bacteria 1992
611 Ga0501082_0287247 3300060353 Bacteria 1432
612 Ga0501082_1119624 3300060353 Unclassified 688
613 Ga0501082_1540402 3300060353 Unclassified 580
614 Ga0501082_1567150 3300060353 Unclassified 575
615 Ga0530510_0019950 3300061734 Bacteria 4763
616 Ga0530510_0090405 3300061734 Bacteria 2233
617 Ga0530510_0571466 3300061734 Bacteria 859
618 Ga0530510_0661308 3300061734 Bacteria 796
619 Ga0530510_0725019 3300061734 Bacteria 758
620 Ga0530510_0821771 3300061734 Bacteria 709
621 Ga0530510_0925602 3300061734 Unclassified 666
622 Ga0501084_0061140
623 JGI24738J21930_10029105
624 JGI24744J21845_10000294
625 JGI24742J22300_10000694
626 JGI25406J46586_10011304
627 JGI25406J46586_10041296
628 Ga0070676_10009710
629 Ga0070690_100002355
630 Ga0070670_100175029
631 Ga0070677_10330937
632 Ga0068869_100011426
633 Ga0070666_10108425
634 Ga0070680_100768587
635 Ga0070680_100864023
636 Ga0070682_100015499
637 Ga0070682_100504691
638 Ga0070682_101384826
639 Ga0068868_100051215
640 Ga0070660_100061161
641 Ga0070689_100027320
642 Ga0070661_100653444
643 Ga0070692_10045087
644 Ga0070668_100011731
645 Ga0070668_100669836
646 Ga0070669_100007792
647 Ga0070671_100033873
648 Ga0070671_100096887
649 Ga0070674_100007150
650 Ga0070673_100370671
651 Ga0070688_100009822
652 Ga0070659_100029807
653 Ga0070667_100008563
654 Ga0070703_10112961
655 Ga0070709_10169558
656 Ga0070714_100001383
657 Ga0070714_100528579
658 Ga0070713_100988562
659 Ga0070710_10032360
660 Ga0070701_10003078
661 Ga0070711_100015531
662 Ga0070711_100055055
663 Ga0070705_100007542
664 Ga0070700_100004880
665 Ga0070694_100019150
666 Ga0070708_100012480
667 Ga0070708_100048668
668 Ga0070708_102096435
669 Ga0070663_100014211
670 Ga0070678_100002940
671 Ga0070662_100012042
672 Ga0070681_10010901
673 Ga0070681_11107917
674 Ga0068867_100018205
675 Ga0070685_10027688
676 Ga0070706_101231578
677 Ga0070707_100464197
678 Ga0070707_100828246
679 Ga0070707_101503388
680 Ga0070707_101810355
681 Ga0070698_100565108
682 Ga0070679_100000258
683 Ga0070679_100588093
684 Ga0070679_100988601
685 Ga0070684_100275634
686 Ga0070697_100389461
687 Ga0070697_101782554
688 Ga0068853_100013440
689 Ga0070686_100110334
690 Ga0070695_100051652
691 Ga0070696_100004524
692 Ga0070693_100006056
693 Ga0070693_100254522
694 Ga0070693_101581311
695 Ga0070665_100604587
696 Ga0070665_100675498
697 Ga0070704_101744367
698 Ga0068855_100685959
699 Ga0068855_102533588
700 Ga0070664_101358774
701 Ga0068854_100004011
702 Ga0068856_100035480
703 Ga0068856_100291990
704 Ga0070702_100014152
705 Ga0068852_100052639
706 Ga0068852_100328817
707 Ga0068859_100021190
708 Ga0068859_100636291
709 Ga0068864_101573873
710 Ga0068866_10021097
711 Ga0068861_100006904
712 Ga0068870_10188837
713 Ga0068863_102639616
714 Ga0068858_100015510
715 Ga0068858_100035445
716 Ga0068858_101359444
717 Ga0068860_100015238
718 Ga0068860_100053932
719 Ga0068862_100027467
720 Ga0081539_10000200
721 Ga0081539_10000440
722 Ga0075365_10311271
723 Ga0070715_10002511
724 Ga0070716_100006794
725 Ga0070712_100034899
726 Ga0070712_100367531
727 Ga0070712_100475936
728 Ga0097621_100183468
729 Ga0075428_100018695
730 Ga0075430_100000151
731 Ga0075430_100449231
732 Ga0075431_100000040
733 Ga0075434_101731826
734 Ga0075429_100000328
735 Ga0075429_100503142
736 Ga0068865_100011170
737 Ga0097620_100021190
738 Ga0097620_100636208
739 Ga0105240_10176008
740 Ga0105245_10000455
741 Ga0105245_10003007
742 Ga0105245_10895185
743 Ga0105247_10017418
744 Ga0114129_10000157
745 Ga0105243_10016144
746 Ga0105242_10011655
747 Ga0105242_10776053
748 Ga0105248_10012653
749 Ga0105248_11557184
750 Ga0105237_10032039
751 Ga0105237_10153204
752 Ga0105249_10056819
753 Ga0105239_10028722
754 Ga0105239_10496041
755 Ga0105239_11046507
756 Ga0105246_10384539
757 Ga0157373_10657778
758 Ga0157370_10003677
759 Ga0157370_11065843
760 Ga0157374_10005364
761 Ga0157374_10023974
762 Ga0157372_10061806
763 Ga0157372_10474887
764 Ga0157375_10016668
765 Ga0157375_13356165
766 Ga0157380_10012892
767 Ga0157380_10227135
768 Ga0157376_10016548
769 Ga0163161_10008323
770 Ga0197907_10028247
771 Ga0206354_11572828
772 Ga0213873_10210147
773 Ga0213874_10060282
774 Ga0213876_10418247
775 Ga0213875_10000245
776 Ga0213875_10086192
777 Ga0213875_10222773
778 Ga0207682_10212427
779 Ga0207692_10019298
780 Ga0207692_11071663
781 Ga0207642_10000977
782 Ga0207710_10007569
783 Ga0207688_10013016
784 Ga0207680_10209077
785 Ga0207685_10064397
786 Ga0207699_10300341
787 Ga0207645_10014477
788 Ga0207643_10227752
789 Ga0207684_11028502
790 Ga0207671_10108152
791 Ga0207693_10000947
792 Ga0207693_10007844
793 Ga0207663_10094389
794 Ga0207663_11102187
795 Ga0207660_10114534
796 Ga0207649_10036458
797 Ga0207652_10000196
798 Ga0207652_10519901
799 Ga0207646_10051458
800 Ga0207646_10657047
801 Ga0207646_10731719
802 Ga0207646_11180272
803 Ga0207646_11493620
804 Ga0207646_11604679
805 Ga0207687_10000802
806 Ga0207687_10172668
807 Ga0207687_10469989
808 Ga0207664_10637741
809 Ga0207664_10679152
810 Ga0207644_10080251
811 Ga0207709_10249474
812 Ga0207709_11304111
813 Ga0207670_10006206
814 Ga0207669_10001710
815 Ga0207704_10001333
816 Ga0207665_10000711
817 Ga0207691_11056076
818 Ga0207711_10051774
819 Ga0207711_11295696
820 Ga0207679_11271470
821 Ga0207667_11860197
822 Ga0207651_10001034
823 Ga0207712_10004962
824 Ga0207668_10048401
825 Ga0207658_10004349
826 Ga0207677_10222634
827 Ga0207677_10490915
828 Ga0207703_10010139
829 Ga0207703_10047798
830 Ga0207639_10017442
831 Ga0207678_10028469
832 Ga0207708_10007878
833 Ga0207702_10400383
834 Ga0207648_10002357
835 Ga0207675_100009180
836 Ga0207683_10011112
837 Ga0207698_10284739
838 Ga0207698_12719965
839 Ga0268266_10516605
840 Ga0268265_10012784
841 Ga0268264_10182186
842 Ga0307517_10222553
843 Ga0307513_10481547
844 Ga0316579_10205022
845 Ga0316576_10109421
846 Ga0316576_10164718
847 Ga0316576_10834800
848 Ga0316578_10154296
849 Ga0316577_10356320
850 Ga0307413_11464930
851 Ga0307410_10055640
852 Ga0307406_10000043
853 Ga0307407_10005378
854 Ga0307412_10003548
855 Ga0307409_100000091
856 Ga0307416_100000142
857 Ga0307416_101615160
858 Ga0307411_10430899
859 Ga0307411_11458670
860 Ga0307415_100011625
861 Ga0316580_10074147
862 Ga0373934_0012406
863 Ga0373951_0230151
864 Ga0373923_0019991
865 Ga0373936_0021204
866 Ga0373939_0469947
867 Ga0373945_0044284
868 Ga0373953_0003086
869 Ga0373953_0012956
870 Ga0373953_0180614
871 Ga0373954_0027055
872 Ga0373956_0013330
873 Ga0373957_0014678
874 Ga0373943_0006996
875 Ga0373943_0722639
876 Ga0373955_0033692
877 Ga0373955_0441668
878 Ga0316574_0055930
879 Ga0316574_0367628
880 Ga0316574_0494259
881 Ga0373924_0004629
882 Ga0373924_0052448
883 Ga0373935_0076038
884 Ga0373927_0162653
885 Ga0373933_0003838
886 Ga0373933_0052881
887 Ga0373947_0115870
888 Ga0373937_0002347
889 Ga0373937_0012772
890 Ga0316582_0027473
891 Ga0316582_0728765
892 Ga0316584_0060740
893 Ga0316584_0548534
894 Ga0316584_0633709
895 Ga0316584_0680314
896 Ga0373925_1753591
897 Ga0395899_0128558
898 Ga0395900_0112877
899 Ga0395898_0028255
900 Ga0395905_0417155
901 Ga0436364_0172109
902 Ga0436364_0205652
903 Ga0436364_0595019
904 Ga0436364_0598457
905 Ga0436364_0825914
906 Ga0436364_0830865
907 Ga0436364_1171458
908 Ga0436364_1176730
909 Ga0395901_0011617
910 Ga0400489_58026
911 Ga0436365_0562948
912 Ga0436365_1678316
913 Ga0436365_1722956
914 Ga0436365_1862142
915 Ga0436360_0320088
916 Ga0436360_1102922
917 Ga0436363_0773035
918 Ga0436363_0773602
919 Ga0436363_0877914
920 Ga0436363_1025381
921 Ga0436362_0589127
922 Ga0436362_0617474
923 Ga0436362_0783084
924 Ga0436362_1109566
925 Ga0451845_0942775
926 Ga0451853_2381572
927 Ga0451853_2967054
928 Ga0451853_3213639
929 Ga0439434_0318591
930 Ga0466969_0144517
931 Ga0466969_0365906
932 Ga0466961_0047457
933 Ga0466961_0515237
934 Ga0466963_0044205
935 Ga0466963_0381328
936 Ga0466964_0600396
937 Ga0466968_0149011
938 Ga0466970_0296912
939 Ga0466959_0077517
940 Ga0466959_0086856
941 Ga0466959_0579180
942 Ga0466958_0033997
943 Ga0466958_0114036
944 Ga0466958_0288638
945 Ga0466967_0076568
946 Ga0466967_0540939
947 Ga0466967_0757944
948 Ga0466967_1137270
949 Ga0495592_0003871
950 Ga0495592_0009570
951 Ga0495603_0047255
952 Ga0495629_0032190
953 Ga0495629_0206346
954 Ga0495641_0002409
955 Ga0495651_0017015
956 Ga0495653_0020189
957 Ga0495580_0068698
958 Ga0495582_0026794
959 Ga0495639_0690307
960 Ga0495662_0055178
961 Ga0495664_0055467
962 Ga0495664_0262181
963 Ga0495664_0266493
964 Ga0495594_0014955
965 Ga0495608_0002599
966 Ga0495608_0873606
967 Ga0495618_0069249
968 Ga0495628_0009376
969 Ga0495628_0038732
970 Ga0495628_0245749
971 Ga0495628_0254994
972 Ga0495630_0226543
973 Ga0495666_0083419
974 Ga0495652_0005203
975 Ga0495652_0335115
976 Ga0495665_0085624
977 Ga0495640_0056786
978 Ga0495640_0413838
979 Ga0495586_0786444
980 Ga0495587_0017239
981 Ga0495587_0047054
982 Ga0495621_0184281
983 Ga0495645_0127580
984 Ga0495645_0244563
985 Ga0495645_0393998
986 Ga0495645_0529314
987 Ga0495667_0061169
988 Ga0495667_0441984
989 Ga0495667_0521443
990 Ga0495667_0731882
991 Ga0495634_0403615
992 Ga0495635_0000017
993 Ga0495635_0005804
994 Ga0495657_0003222
995 Ga0495657_0012736
996 Ga0495599_0046563
997 Ga0495599_0711685
998 Ga0495623_0020513
999 Ga0495646_0004009
1000 Ga0495646_0007917
1001 Ga0495647_0005759
1002 Ga0495647_0151999
1003 Ga0495658_0050860
1004 Ga0495669_0000466
1005 Ga0495613_0079851
1006 Ga0495613_0126506
1007 Ga0495624_0000343
1008 Ga0495624_0148479
1009 Ga0495600_0001058
1010 Ga0495600_0155084
1011 Ga0495581_0579253
1012 Ga0495604_0000146
1013 Ga0495604_0002791
1014 Ga0495604_0442211
1015 Ga0495604_0842619
1016 Ga0495674_0004240
1017 Ga0495674_0294843
1018 Ga0495676_0000687
1019 Ga0495676_0091403
1020 Ga0495680_0003896
1021 Ga0495680_0885713
1022 Ga0495675_0401143
1023 Ga0495679_015502
1024 Ga0495684_0050418
1025 Ga0495684_0138540
1026 Ga0495684_0634445
1027 Ga0495593_0197421
1028 Ga0495602_0010731
1029 Ga0495602_0013215
1030 Ga0495614_0004869
1031 Ga0496100_0010390
1032 Ga0496100_0629372
1033 Ga0496101_0002430
1034 Ga0496102_0009091
1035 Ga0496102_0252257
1036 Ga0496102_0971451
1037 Ga0496103_0009516
1038 Ga0496104_0085764
1039 Ga0496104_0237036
1040 Ga0496104_0812460
1041 Ga0496105_0145796
1042 Ga0496106_0019074
1043 Ga0496107_0005549
1044 Ga0496108_0001236
1045 Ga0496109_0000589
1046 Ga0496109_0387318
1047 Ga0496110_0040657
1048 Ga0496111_1300173
1049 Ga0496112_0000026
1050 Ga0496113_0119256
1051 Ga0496114_0017569
1052 Ga0496115_0019766
1053 Ga0501031_0007148
1054 Ga0501031_0049280
1055 Ga0501031_0106079
1056 Ga0501031_0743868
1057 Ga0501032_0001285
1058 Ga0501032_0041295
1059 Ga0501032_0740421
1060 Ga0501033_0060270
1061 Ga0501033_0733384
1062 Ga0501034_0025573
1063 Ga0501034_0184493
1064 Ga0501034_0650448
1065 Ga0501034_0680512
1066 Ga0501036_0004702
1067 Ga0501036_0074645
1068 Ga0501036_0255247
1069 Ga0501036_0305194
1070 Ga0501036_0433876
1071 Ga0501036_0532516
1072 Ga0501036_1141274
1073 Ga0501037_0001495
1074 Ga0501037_0006954
1075 Ga0501037_0196249
1076 Ga0501037_0397880
1077 Ga0501038_0035116
1078 Ga0501038_0056951
1079 Ga0501038_0369599
1080 Ga0501038_0471258
1081 Ga0501038_0480845
1082 Ga0501038_1035879
1083 Ga0501039_0014493
1084 Ga0501039_0046043
1085 Ga0501039_0139030
1086 Ga0501039_0632067
1087 Ga0501039_0632382
1088 Ga0501039_0948818
1089 Ga0501039_1027093
1090 Ga0501039_1378988
1091 Ga0501040_0012118
1092 Ga0501040_0333257
1093 Ga0501040_0431071
1094 Ga0501040_0498738
1095 Ga0501041_0003625
1096 Ga0501041_0134716
1097 Ga0501041_0159082
1098 Ga0501041_0279082
1099 Ga0501041_0430394
1100 Ga0501042_0067059
1101 Ga0501042_0097617
1102 Ga0501042_0436976
1103 Ga0501042_0617692
1104 Ga0501042_0763882
1105 Ga0501043_0004591
1106 Ga0501043_0018269
1107 Ga0501043_0683288
1108 Ga0501043_1020111
1109 Ga0501043_1236054
1110 Ga0501046_0012367
1111 Ga0501046_0027092
1112 Ga0501046_0070917
1113 Ga0501046_0347910
1114 Ga0501046_0685754
1115 Ga0501047_0052821
1116 Ga0501047_0165654
1117 Ga0501047_0174478
1118 Ga0501048_0006165
1119 Ga0501048_0016957
1120 Ga0501048_0047963
1121 Ga0501048_0214646
1122 Ga0501048_0357097
1123 Ga0501048_0373750
1124 Ga0501048_0551530
1125 Ga0501048_0948343
1126 Ga0501067_0019112
1127 Ga0501067_0707449
1128 Ga0501068_0006420
1129 Ga0501068_0040791
1130 Ga0501068_0619084
1131 Ga0501068_0667875
1132 Ga0501069_0011212
1133 Ga0501070_0001535
1134 Ga0501070_0025414
1135 Ga0501070_0350841
1136 Ga0501070_0365248
1137 Ga0501070_0856007
1138 Ga0501071_0013826
1139 Ga0501071_0059464
1140 Ga0501071_0166402
1141 Ga0501071_0169453
1142 Ga0501071_0361568
1143 Ga0501072_0077129
1144 Ga0501072_0107759
1145 Ga0501072_0360933
1146 Ga0501072_0576598
1147 Ga0501072_1076551
1148 Ga0501072_1097427
1149 Ga0501073_0018970
1150 Ga0501073_0073021
1151 Ga0501073_0485901
1152 Ga0501073_0787290
1153 Ga0501074_0006494
1154 Ga0501074_0010074
1155 Ga0501074_0051545
1156 Ga0501074_0076346
1157 Ga0501074_0178715
1158 Ga0501074_0332753
1159 Ga0501075_0018878
1160 Ga0501075_0028374
1161 Ga0501075_0041042
1162 Ga0501075_0288096
1163 Ga0501075_0908182
1164 Ga0501076_0015871
1165 Ga0501076_0033246
1166 Ga0501076_0046934
1167 Ga0501076_0123906
1168 Ga0501076_0413598
1169 Ga0501076_1073049
1170 Ga0501077_0006820
1171 Ga0501077_0021014
1172 Ga0501077_0422334
1173 Ga0501077_0470404
1174 Ga0501079_0102371
1175 Ga0501079_0129130
1176 Ga0501079_0812417
1177 Ga0501079_0965556
1178 Ga0501079_1098968
1179 Ga0501080_0042990
1180 Ga0501080_0111853
1181 Ga0501080_0185838
1182 Ga0501080_0215189
1183 Ga0501080_0319816
1184 Ga0501080_0321536
1185 Ga0501081_0012841
1186 Ga0501081_0024057
1187 Ga0501081_0484658
1188 Ga0501081_0736198
1189 Ga0501083_0010021
1190 Ga0501083_0086043
1191 Ga0501035_0028824
1192 Ga0501035_0518334
1193 Ga0501035_0617503
1194 Ga0501035_1293940
1195 Ga0501044_0001233
1196 Ga0501044_0031392
1197 Ga0501044_0324707
1198 Ga0501044_0470588
1199 Ga0501045_0025925
1200 Ga0501045_0028486
1201 Ga0501045_0038766
1202 Ga0501045_0067171
1203 Ga0501045_0136883
1204 Ga0501045_0142026
1205 nmdc:mga0yw44_188067_c1
1206 nmdc:mga05p37_825_c1
1207 nmdc:mga09592_1191602_c1
1208 nmdc:mga09592_3396_c1
1209 nmdc:mga0qj67_1785_c1
1210 nmdc:mga0qj67_504836_c1
1211 nmdc:mga06r32_2487_c1
1212 nmdc:mga06r32_55300_c1
1213 nmdc:mga0rr50_99266_c1
1214 nmdc:mga08x19_415336_c1
1215 Ga0495601_0000179
1216 Ga0495601_0028025
1217 Ga0495601_0115968
1218 Ga0495601_0412453
1219 Ga0495595_0004393
1220 Ga0495619_0054442
1221 Ga0495619_0373435
1222 Ga0500569_128550
1223 Ga0501084_0034721
1224 Ga0501084_0099017
1225 Ga0501084_0149838
1226 Ga0501084_0259231
1227 Ga0501084_1434299
1228 Ga0501082_0020179
1229 Ga0501082_0035905
1230 Ga0501082_0074771
1231 Ga0501082_0154729
1232 Ga0501082_0287247
1233 Ga0501082_1119624
1234 Ga0501082_1540402
1235 Ga0501082_1567150
1236 Ga0530510_0019950
1237 Ga0530510_0090405
1238 Ga0530510_0571466
1239 Ga0530510_0661308
1240 Ga0530510_0725019
1241 Ga0530510_0821771
1242 Ga0530510_0925602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

2

95

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hk0-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.921 1 102
5hk0-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9125 1 102
5cca-assembly1.cif.gz_B crystal structure of mtb toxin 0.9107 6 99
1ne8-assembly1.cif.gz_A-2 ydce protein from bacillus subtilis 0.9068 1 101
4me7-assembly1.cif.gz_C crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze 0.904 1 101
ID Description Score Start End Superfamily
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9374 3 102 2.30.30.110
af_P9WII1_5_102_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9352 5 102 2.30.30.110
af_P9WII1_5_102_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.926 5 102 2.30.30.110
5ccaB00 Mainly Beta;Roll;SH3 type barrels.; 0.9107 6 99 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8986 1 101 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A0E7T340-F1-model_v4 Toxin (Toxin MazF5 (EC 3.1.-.-)) 0.9872 27 102 GO:0003677
GO:0016787
AF-X8C8A8-F1-model_v4 Putative toxin MazF2 0.9846 30 102
AF-A0A0E7T340-F1-model_v4 Toxin (Toxin MazF5 (EC 3.1.-.-)) 0.9622 27 102 GO:0003677
GO:0016787
AF-A0A2N7YSI7-F1-model_v4 Toxin 0.9578 29 102 GO:0003677
AF-A0A0E2BNE0-F1-model_v4 deleted 0.947 34 101

Map