F470037

General Info

Members Datasets Scaffolds Average Seq Length
621 263 1242 68

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0110947|Ga0495580_0110947_383_586
Length 67
Sequence MAAQKKAAAGSTVKIKWVISFIGCTDDMRQTIRGLGLRRLHQVVERQDTPETRGMILKVRHLVEVVE

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
194 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
201 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 1.29
Rhizosphere 97.1
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0110947 3300046472 Bacteria 1905
2 JGI24744J21845_10082921 3300002077 Bacteria 587
3 JGI24742J22300_10050722 3300002244 Bacteria 751
4 Ga0065704_10767716 3300005289 Bacteria 536
5 Ga0065712_10028176 3300005290 Bacteria 1057
6 Ga0065712_10125706 3300005290 Bacteria 1610
7 Ga0065712_10435253 3300005290 Bacteria 699
8 Ga0065715_10121279 3300005293 Bacteria 2234
9 Ga0065715_10139250 3300005293 Bacteria 1879
10 Ga0065715_10301753 3300005293 Bacteria 1040
11 Ga0065715_10515114 3300005293 Bacteria 768
12 Ga0065707_10098114 3300005295 Bacteria 3112
13 Ga0065707_10428812 3300005295 Bacteria 822
14 Ga0065707_10429985 3300005295 Bacteria 821
15 Ga0070676_10077191 3300005328 Bacteria 2013
16 Ga0070683_100247402 3300005329 Bacteria 1696
17 Ga0070690_100216467 3300005330 Bacteria 1340
18 Ga0070690_100708412 3300005330 Bacteria 774
19 Ga0070670_100028507 3300005331 Bacteria 4805
20 Ga0070670_100085662 3300005331 Bacteria 2707
21 Ga0070670_100188788 3300005331 Bacteria 1790
22 Ga0070677_10045731 3300005333 Bacteria 1747
23 Ga0070677_10131600 3300005333 Bacteria 1143
24 Ga0070677_10344014 3300005333 Bacteria 771
25 Ga0070677_10765769 3300005333 Bacteria 549
26 Ga0068869_100034210 3300005334 Bacteria 3593
27 Ga0068869_100078319 3300005334 Bacteria 2461
28 Ga0068869_100136147 3300005334 Bacteria 1893
29 Ga0068869_100307181 3300005334 Bacteria 1282
30 Ga0068869_100424420 3300005334 Bacteria 1098
31 Ga0068869_100493899 3300005334 Bacteria 1021
32 Ga0068869_100961360 3300005334 Bacteria 742
33 Ga0068869_101040870 3300005334 Bacteria 714
34 Ga0070666_10338024 3300005335 Bacteria 1076
35 Ga0070666_10435440 3300005335 Bacteria 946
36 Ga0070680_100470694 3300005336 Bacteria 1074
37 Ga0068868_100079170 3300005338 Bacteria 2632
38 Ga0068868_100409503 3300005338 Bacteria 1172
39 Ga0070689_100026719 3300005340 Bacteria 4347
40 Ga0070689_100083906 3300005340 Bacteria 2504
41 Ga0070689_100143839 3300005340 Bacteria 1919
42 Ga0070689_100721682 3300005340 Bacteria 872
43 Ga0070689_101432651 3300005340 Bacteria 625
44 Ga0070691_10269310 3300005341 Bacteria 920
45 Ga0070687_100040387 3300005343 Bacteria 2351
46 Ga0070687_100061774 3300005343 Bacteria 1981
47 Ga0070687_100335040 3300005343 Bacteria 971
48 Ga0070661_100157872 3300005344 Bacteria 1717
49 Ga0070661_100356354 3300005344 Bacteria 1149
50 Ga0070661_100628990 3300005344 Bacteria 870
51 Ga0070692_10062965 3300005345 Bacteria 1959
52 Ga0070692_10639351 3300005345 Bacteria 709
53 Ga0070668_100459570 3300005347 Bacteria 1096
54 Ga0070669_100004188 3300005353 Bacteria 10451
55 Ga0070669_100035931 3300005353 Bacteria 3589
56 Ga0070675_100002788 3300005354 Bacteria 13157
57 Ga0070675_100004981 3300005354 Bacteria 10137
58 Ga0070675_100007191 3300005354 Bacteria 8578
59 Ga0070675_100014470 3300005354 Bacteria 6222
60 Ga0070675_100110243 3300005354 Bacteria 2327
61 Ga0070675_100726307 3300005354 Bacteria 905
62 Ga0070675_101473657 3300005354 Bacteria 628
63 Ga0070675_101587703 3300005354 Bacteria 604
64 Ga0070671_100006715 3300005355 Bacteria 9208
65 Ga0070671_100332260 3300005355 Bacteria 1296
66 Ga0070674_100234188 3300005356 Bacteria 1435
67 Ga0070674_100746596 3300005356 Bacteria 840
68 Ga0070674_100854427 3300005356 Bacteria 789
69 Ga0070674_101042690 3300005356 Bacteria 720
70 Ga0070674_101946538 3300005356 Bacteria 535
71 Ga0070673_100141242 3300005364 Bacteria 2031
72 Ga0070673_100207110 3300005364 Bacteria 1692
73 Ga0070673_100236349 3300005364 Bacteria 1587
74 Ga0070673_100265276 3300005364 Bacteria 1501
75 Ga0070673_102311096 3300005364 Unclassified 511
76 Ga0070688_100071540 3300005365 Bacteria 2221
77 Ga0070688_100112800 3300005365 Bacteria 1811
78 Ga0070688_100192558 3300005365 Bacteria 1422
79 Ga0070688_100200560 3300005365 Bacteria 1396
80 Ga0070659_101058866 3300005366 Bacteria 714
81 Ga0070667_100218846 3300005367 Bacteria 1694
82 Ga0070667_101698840 3300005367 Bacteria 594
83 Ga0070713_100030866 3300005436 Bacteria 4262
84 Ga0070701_10020049 3300005438 Bacteria 3168
85 Ga0070701_10134120 3300005438 Bacteria 1409
86 Ga0070701_10373447 3300005438 Bacteria 897
87 Ga0070705_100008402 3300005440 Bacteria 5115
88 Ga0070705_100015890 3300005440 Bacteria 3899
89 Ga0070705_100075744 3300005440 Bacteria 2049
90 Ga0070705_100165605 3300005440 Bacteria 1482
91 Ga0070705_100494094 3300005440 Bacteria 927
92 Ga0070700_100052331 3300005441 Bacteria 2546
93 Ga0070700_100121881 3300005441 Bacteria 1748
94 Ga0070700_100372386 3300005441 Bacteria 1065
95 Ga0070700_100423505 3300005441 Bacteria 1006
96 Ga0070694_100013457 3300005444 Bacteria 5110
97 Ga0070694_100014289 3300005444 Bacteria 4969
98 Ga0070694_100098040 3300005444 Bacteria 2069
99 Ga0070694_100305312 3300005444 Bacteria 1221
100 Ga0070694_100594108 3300005444 Bacteria 891
101 Ga0070708_100056889 3300005445 Bacteria 3480
102 Ga0070708_100216485 3300005445 Bacteria 1795
103 Ga0070708_102142672 3300005445 Bacteria 517
104 Ga0070678_100132681 3300005456 Bacteria 1981
105 Ga0070678_100193489 3300005456 Bacteria 1674
106 Ga0070678_101262009 3300005456 Bacteria 687
107 Ga0070662_100076213 3300005457 Bacteria 2485
108 Ga0070662_100494372 3300005457 Bacteria 1020
109 Ga0070662_101009073 3300005457 Bacteria 713
110 Ga0070662_101463834 3300005457 Bacteria 589
111 Ga0070681_10006387 3300005458 Bacteria 11462
112 Ga0068867_100006640 3300005459 Bacteria 8180
113 Ga0068867_100023324 3300005459 Bacteria 4430
114 Ga0070685_10314302 3300005466 Bacteria 1060
115 Ga0070685_11409824 3300005466 Bacteria 535
116 Ga0070706_100173265 3300005467 Bacteria 2015
117 Ga0070706_100394746 3300005467 Bacteria 1288
118 Ga0070707_100650400 3300005468 Bacteria 1017
119 Ga0070707_101272529 3300005468 Bacteria 702
120 Ga0070707_101771806 3300005468 Bacteria 585
121 Ga0070707_101828918 3300005468 Bacteria 575
122 Ga0070707_102343326 3300005468 Bacteria 501
123 Ga0070698_100010970 3300005471 Bacteria 9640
124 Ga0070698_100415231 3300005471 Bacteria 1280
125 Ga0070698_101184884 3300005471 Unclassified 713
126 Ga0070698_101352604 3300005471 Bacteria 663
127 Ga0070699_100036688 3300005518 Bacteria 4240
128 Ga0070699_100047192 3300005518 Bacteria 3726
129 Ga0070699_100064132 3300005518 Bacteria 3187
130 Ga0070699_100796371 3300005518 Bacteria 865
131 Ga0070679_100087491 3300005530 Bacteria 3103
132 Ga0070697_100060416 3300005536 Bacteria 3089
133 Ga0070697_100067414 3300005536 Bacteria 2927
134 Ga0070697_101089846 3300005536 Bacteria 711
135 Ga0068853_101373927 3300005539 Bacteria 683
136 Ga0070672_100056997 3300005543 Bacteria 3066
137 Ga0070672_100129701 3300005543 Bacteria 2071
138 Ga0070672_100147295 3300005543 Bacteria 1946
139 Ga0070672_100533654 3300005543 Bacteria 1017
140 Ga0070672_100628592 3300005543 Bacteria 937
141 Ga0070672_100757208 3300005543 Bacteria 853
142 Ga0070672_101065909 3300005543 Bacteria 718
143 Ga0070686_100060876 3300005544 Bacteria 2437
144 Ga0070686_100174735 3300005544 Bacteria 1522
145 Ga0070686_100952938 3300005544 Bacteria 701
146 Ga0070695_100006902 3300005545 Bacteria 6724
147 Ga0070695_100007286 3300005545 Bacteria 6558
148 Ga0070695_100026046 3300005545 Bacteria 3615
149 Ga0070695_100258410 3300005545 Bacteria 1271
150 Ga0070696_100048468 3300005546 Bacteria 2949
151 Ga0070696_100085249 3300005546 Bacteria 2242
152 Ga0070696_100103569 3300005546 Bacteria 2042
153 Ga0070696_100743640 3300005546 Bacteria 803
154 Ga0070693_100362636 3300005547 Bacteria 995
155 Ga0070665_101695884 3300005548 Bacteria 639
156 Ga0070665_102051472 3300005548 Bacteria 577
157 Ga0070704_100000751 3300005549 Bacteria 15957
158 Ga0070704_100022722 3300005549 Bacteria 4085
159 Ga0070704_100151523 3300005549 Bacteria 1823
160 Ga0070704_100308929 3300005549 Bacteria 1320
161 Ga0070704_102297340 3300005549 Bacteria 502
162 Ga0070664_100014134 3300005564 Bacteria 6512
163 Ga0070664_100054522 3300005564 Bacteria 3392
164 Ga0070664_100348421 3300005564 Bacteria 1347
165 Ga0070664_100528072 3300005564 Bacteria 1090
166 Ga0070664_101434827 3300005564 Bacteria 653
167 Ga0068857_100371509 3300005577 Bacteria 1327
168 Ga0068857_102071850 3300005577 Bacteria 558
169 Ga0068854_100243256 3300005578 Bacteria 1434
170 Ga0070702_100063722 3300005615 Bacteria 2154
171 Ga0070702_100074211 3300005615 Bacteria 2017
172 Ga0070702_100120528 3300005615 Bacteria 1642
173 Ga0070702_100546998 3300005615 Bacteria 859
174 Ga0068852_100611483 3300005616 Bacteria 1095
175 Ga0068852_102740758 3300005616 Bacteria 512
176 Ga0068859_100081351 3300005617 Bacteria 3281
177 Ga0068859_100278770 3300005617 Bacteria 1764
178 Ga0068859_100431893 3300005617 Bacteria 1413
179 Ga0068859_100843034 3300005617 Bacteria 1003
180 Ga0068859_100901983 3300005617 Bacteria 968
181 Ga0068859_101711247 3300005617 Bacteria 695
182 Ga0068859_102350595 3300005617 Bacteria 588
183 Ga0068859_102629087 3300005617 Bacteria 554
184 Ga0068864_100040462 3300005618 Bacteria 3987
185 Ga0068864_100431255 3300005618 Bacteria 1257
186 Ga0068864_100688716 3300005618 Bacteria 998
187 Ga0068866_10551797 3300005718 Bacteria 771
188 Ga0068866_10803988 3300005718 Bacteria 654
189 Ga0068866_10911081 3300005718 Bacteria 619
190 Ga0068861_100081455 3300005719 Bacteria 2534
191 Ga0068861_100106644 3300005719 Bacteria 2238
192 Ga0068861_100150982 3300005719 Bacteria 1906
193 Ga0068861_101346331 3300005719 Bacteria 696
194 Ga0068861_101465584 3300005719 Bacteria 669
195 Ga0068851_10138188 3300005834 Bacteria 1323
196 Ga0068851_10830117 3300005834 Bacteria 576
197 Ga0068870_10134968 3300005840 Bacteria 1437
198 Ga0068870_10355071 3300005840 Bacteria 942
199 Ga0068870_10570518 3300005840 Bacteria 765
200 Ga0068870_10580890 3300005840 Bacteria 759
201 Ga0068870_10594460 3300005840 Bacteria 751
202 Ga0068863_100072819 3300005841 Bacteria 3251
203 Ga0068863_100707198 3300005841 Bacteria 1002
204 Ga0068863_100966314 3300005841 Bacteria 854
205 Ga0068863_101026916 3300005841 Bacteria 828
206 Ga0068863_101474614 3300005841 Bacteria 689
207 Ga0068863_102510503 3300005841 Bacteria 525
208 Ga0068858_100078615 3300005842 Bacteria 3065
209 Ga0068858_100306249 3300005842 Bacteria 1516
210 Ga0068858_101053670 3300005842 Bacteria 798
211 Ga0068860_100129166 3300005843 Bacteria 2423
212 Ga0068860_100301156 3300005843 Bacteria 1570
213 Ga0068860_100441173 3300005843 Bacteria 1293
214 Ga0068862_100025264 3300005844 Bacteria 4987
215 Ga0068862_100217895 3300005844 Bacteria 1727
216 Ga0068862_100301304 3300005844 Bacteria 1475
217 Ga0068862_102226672 3300005844 Bacteria 560
218 Ga0070717_11723740 3300006028 Bacteria 567
219 Ga0075432_10429337 3300006058 Bacteria 576
220 Ga0075367_10198803 3300006178 Bacteria 1252
221 Ga0075367_10628261 3300006178 Bacteria 683
222 Ga0075366_10461906 3300006195 Bacteria 783
223 Ga0097621_100110275 3300006237 Bacteria 2325
224 Ga0097621_100405831 3300006237 Bacteria 1221
225 Ga0097621_101166980 3300006237 Bacteria 725
226 Ga0097621_101231180 3300006237 Bacteria 706
227 Ga0097621_101747581 3300006237 Bacteria 593
228 Ga0068871_100077985 3300006358 Bacteria 2739
229 Ga0068871_100178147 3300006358 Bacteria 1826
230 Ga0068871_102096382 3300006358 Bacteria 539
231 Ga0075428_100089096 3300006844 Bacteria 3365
232 Ga0075428_100236605 3300006844 Bacteria 1971
233 Ga0075428_100559334 3300006844 Bacteria 1223
234 Ga0075428_100768579 3300006844 Bacteria 1025
235 Ga0075433_10034234 3300006852 Bacteria 4361
236 Ga0075433_10034313 3300006852 Bacteria 4357
237 Ga0075433_10391321 3300006852 Bacteria 1227
238 Ga0075434_100067078 3300006871 Bacteria 3575
239 Ga0075434_100076740 3300006871 Bacteria 3336
240 Ga0075434_100117511 3300006871 Bacteria 2672
241 Ga0075434_102582680 3300006871 Unclassified 508
242 Ga0075434_102591882 3300006871 Bacteria 507
243 Ga0075429_100753802 3300006880 Bacteria 853
244 Ga0068865_100215813 3300006881 Bacteria 1497
245 Ga0068865_100402881 3300006881 Bacteria 1121
246 Ga0068865_101798685 3300006881 Bacteria 554
247 Ga0075436_100697645 3300006914 Bacteria 752
248 Ga0097620_100081353 3300006931 Bacteria 3281
249 Ga0097620_100278782 3300006931 Bacteria 1764
250 Ga0097620_100431880 3300006931 Bacteria 1413
251 Ga0097620_100843029 3300006931 Bacteria 1003
252 Ga0097620_100901948 3300006931 Bacteria 968
253 Ga0097620_101711212 3300006931 Bacteria 695
254 Ga0097620_102350304 3300006931 Bacteria 588
255 Ga0097620_102629098 3300006931 Bacteria 554
256 Ga0075435_100046915 3300007076 Bacteria 3467
257 Ga0075435_100246072 3300007076 Bacteria 1521
258 Ga0075435_100272596 3300007076 Bacteria 1444
259 Ga0111539_11763919 3300009094 Bacteria 718
260 Ga0111539_11899468 3300009094 Bacteria 690
261 Ga0105245_10133246 3300009098 Bacteria 2333
262 Ga0105245_12004528 3300009098 Bacteria 632
263 Ga0105247_11315378 3300009101 Bacteria 581
264 Ga0105247_11399974 3300009101 Bacteria 566
265 Ga0114129_10074308 3300009147 Bacteria 4735
266 Ga0114129_11236843 3300009147 Bacteria 928
267 Ga0114129_11241004 3300009147 Bacteria 926
268 Ga0105243_10194452 3300009148 Bacteria 1774
269 Ga0105243_10814027 3300009148 Bacteria 922
270 Ga0105243_11204353 3300009148 Bacteria 771
271 Ga0105243_11266557 3300009148 Bacteria 753
272 Ga0105243_11440191 3300009148 Bacteria 711
273 Ga0105243_11853712 3300009148 Bacteria 635
274 Ga0105243_12021022 3300009148 Bacteria 611
275 Ga0105241_11318657 3300009174 Bacteria 688
276 Ga0105242_10021951 3300009176 Bacteria 5017
277 Ga0105242_10218220 3300009176 Bacteria 1703
278 Ga0105248_10149833 3300009177 Bacteria 2632
279 Ga0105248_10747472 3300009177 Bacteria 1104
280 Ga0105248_10859031 3300009177 Bacteria 1024
281 Ga0105248_11724069 3300009177 Bacteria 710
282 Ga0105238_10635890 3300009551 Bacteria 1076
283 Ga0105249_10019022 3300009553 Bacteria 6126
284 Ga0105249_10371605 3300009553 Bacteria 1454
285 Ga0105249_12994596 3300009553 Bacteria 542
286 Ga0105246_10222812 3300011119 Bacteria 1479
287 Ga0105246_10526931 3300011119 Bacteria 1008
288 Ga0157374_12648406 3300013296 Bacteria 529
289 Ga0157378_10285963 3300013297 Bacteria 1591
290 Ga0157378_10398965 3300013297 Bacteria 1355
291 Ga0157378_10726175 3300013297 Bacteria 1014
292 Ga0157378_11688346 3300013297 Bacteria 680
293 Ga0157378_12638753 3300013297 Bacteria 555
294 Ga0157378_12767293 3300013297 Bacteria 543
295 Ga0163162_10058002 3300013306 Bacteria 3900
296 Ga0163162_11481798 3300013306 Bacteria 773
297 Ga0157375_10050888 3300013308 Bacteria 4065
298 Ga0157375_11178755 3300013308 Bacteria 898
299 Ga0163163_10029752 3300014325 Bacteria 5256
300 Ga0163163_10250326 3300014325 Bacteria 1822
301 Ga0163163_10612765 3300014325 Bacteria 1152
302 Ga0163163_11228727 3300014325 Bacteria 812
303 Ga0163163_11602571 3300014325 Bacteria 712
304 Ga0157380_10130605 3300014326 Bacteria 2142
305 Ga0157380_10159106 3300014326 Bacteria 1961
306 Ga0157380_10348019 3300014326 Bacteria 1385
307 Ga0157380_10607578 3300014326 Bacteria 1083
308 Ga0157380_11838853 3300014326 Bacteria 665
309 Ga0157380_11940519 3300014326 Bacteria 650
310 Ga0157380_12944111 3300014326 Bacteria 542
311 Ga0157377_10088425 3300014745 Bacteria 1825
312 Ga0157377_10349330 3300014745 Bacteria 992
313 Ga0157377_10352918 3300014745 Bacteria 987
314 Ga0157377_11231927 3300014745 Bacteria 581
315 Ga0157376_10570745 3300014969 Bacteria 1122
316 Ga0157376_10770272 3300014969 Bacteria 973
317 Ga0157376_10889560 3300014969 Bacteria 908
318 Ga0157376_11710627 3300014969 Bacteria 664
319 Ga0157376_11956055 3300014969 Bacteria 624
320 Ga0157376_12198124 3300014969 Bacteria 590
321 Ga0163161_10192474 3300017792 Bacteria 1569
322 Ga0207666_1022238 3300025271 Bacteria 939
323 Ga0207697_10267849 3300025315 Bacteria 757
324 Ga0207656_10126063 3300025321 Bacteria 1196
325 Ga0207653_10034046 3300025885 Bacteria 1654
326 Ga0207653_10156924 3300025885 Bacteria 840
327 Ga0207653_10380558 3300025885 Bacteria 553
328 Ga0207682_10018499 3300025893 Bacteria 2724
329 Ga0207682_10216166 3300025893 Bacteria 885
330 Ga0207682_10303395 3300025893 Bacteria 749
331 Ga0207642_10808523 3300025899 Bacteria 597
332 Ga0207688_10035328 3300025901 Bacteria 2769
333 Ga0207688_10526516 3300025901 Bacteria 742
334 Ga0207688_10798939 3300025901 Bacteria 598
335 Ga0207680_10324801 3300025903 Bacteria 1077
336 Ga0207680_10746250 3300025903 Bacteria 702
337 Ga0207647_10493146 3300025904 Bacteria 683
338 Ga0207645_10423433 3300025907 Bacteria 897
339 Ga0207645_10818232 3300025907 Bacteria 633
340 Ga0207643_10011439 3300025908 Bacteria 4792
341 Ga0207643_10019923 3300025908 Bacteria 3678
342 Ga0207643_10072061 3300025908 Bacteria 1989
343 Ga0207643_10145617 3300025908 Bacteria 1417
344 Ga0207643_10255981 3300025908 Bacteria 1080
345 Ga0207643_10275311 3300025908 Bacteria 1042
346 Ga0207643_10392902 3300025908 Bacteria 876
347 Ga0207643_10538657 3300025908 Bacteria 748
348 Ga0207643_10581887 3300025908 Bacteria 720
349 Ga0207684_10453277 3300025910 Bacteria 1101
350 Ga0207707_10006304 3300025912 Bacteria 10359
351 Ga0207663_11577693 3300025916 Bacteria 528
352 Ga0207660_10704982 3300025917 Bacteria 823
353 Ga0207662_10027421 3300025918 Bacteria 3287
354 Ga0207662_10161773 3300025918 Bacteria 1430
355 Ga0207662_10741368 3300025918 Bacteria 690
356 Ga0207649_10371043 3300025920 Bacteria 1064
357 Ga0207652_10102128 3300025921 Bacteria 2534
358 Ga0207646_10071533 3300025922 Bacteria 3098
359 Ga0207646_10109852 3300025922 Bacteria 2474
360 Ga0207646_10124641 3300025922 Bacteria 2316
361 Ga0207646_10331874 3300025922 Bacteria 1374
362 Ga0207681_10017709 3300025923 Bacteria 4477
363 Ga0207681_10562525 3300025923 Bacteria 939
364 Ga0207681_11406450 3300025923 Bacteria 585
365 Ga0207694_10132993 3300025924 Bacteria 1995
366 Ga0207650_10014338 3300025925 Bacteria 5510
367 Ga0207650_10032902 3300025925 Bacteria 3753
368 Ga0207650_10058557 3300025925 Bacteria 2868
369 Ga0207659_10007868 3300025926 Bacteria 6590
370 Ga0207659_10013032 3300025926 Bacteria 5314
371 Ga0207659_10020916 3300025926 Bacteria 4334
372 Ga0207659_10148615 3300025926 Bacteria 1827
373 Ga0207659_10311434 3300025926 Bacteria 1296
374 Ga0207659_10684192 3300025926 Bacteria 878
375 Ga0207659_10835157 3300025926 Bacteria 792
376 Ga0207659_11150338 3300025926 Bacteria 667
377 Ga0207687_10460189 3300025927 Bacteria 1056
378 Ga0207700_10116755 3300025928 Bacteria 2157
379 Ga0207644_10006450 3300025931 Bacteria 7646
380 Ga0207690_10133244 3300025932 Bacteria 1821
381 Ga0207690_11489740 3300025932 Bacteria 566
382 Ga0207706_10078599 3300025933 Bacteria 2902
383 Ga0207706_10221488 3300025933 Bacteria 1656
384 Ga0207706_10775281 3300025933 Bacteria 816
385 Ga0207706_11566057 3300025933 Unclassified 535
386 Ga0207686_10083208 3300025934 Bacteria 2094
387 Ga0207709_10532592 3300025935 Bacteria 921
388 Ga0207709_10649464 3300025935 Bacteria 840
389 Ga0207709_11584424 3300025935 Unclassified 544
390 Ga0207670_10043637 3300025936 Bacteria 2963
391 Ga0207670_11072921 3300025936 Bacteria 679
392 Ga0207669_10308935 3300025937 Bacteria 1205
393 Ga0207669_10700941 3300025937 Bacteria 832
394 Ga0207669_10793296 3300025937 Bacteria 785
395 Ga0207669_11048700 3300025937 Bacteria 687
396 Ga0207704_10334856 3300025938 Bacteria 1173
397 Ga0207691_10062500 3300025940 Bacteria 3378
398 Ga0207691_10118137 3300025940 Bacteria 2352
399 Ga0207691_10273237 3300025940 Bacteria 1455
400 Ga0207691_10439703 3300025940 Bacteria 1110
401 Ga0207691_10537278 3300025940 Bacteria 992
402 Ga0207691_10912830 3300025940 Bacteria 735
403 Ga0207711_10549962 3300025941 Bacteria 1077
404 Ga0207711_10933005 3300025941 Bacteria 806
405 Ga0207711_11059224 3300025941 Bacteria 751
406 Ga0207689_10046381 3300025942 Bacteria 3592
407 Ga0207689_10090334 3300025942 Bacteria 2517
408 Ga0207689_10218760 3300025942 Bacteria 1574
409 Ga0207689_10293746 3300025942 Bacteria 1346
410 Ga0207689_10415336 3300025942 Bacteria 1122
411 Ga0207689_10447376 3300025942 Bacteria 1079
412 Ga0207689_10670616 3300025942 Bacteria 874
413 Ga0207689_10679038 3300025942 Bacteria 868
414 Ga0207679_10027564 3300025945 Bacteria 3930
415 Ga0207679_10027627 3300025945 Bacteria 3927
416 Ga0207679_10102212 3300025945 Bacteria 2244
417 Ga0207679_10146514 3300025945 Bacteria 1916
418 Ga0207679_10317238 3300025945 Bacteria 1348
419 Ga0207679_10717674 3300025945 Bacteria 908
420 Ga0207679_10949706 3300025945 Bacteria 787
421 Ga0207679_11316889 3300025945 Bacteria 663
422 Ga0207651_10029028 3300025960 Bacteria 3499
423 Ga0207651_10225684 3300025960 Bacteria 1517
424 Ga0207651_10329350 3300025960 Bacteria 1279
425 Ga0207651_10463311 3300025960 Bacteria 1089
426 Ga0207651_10871482 3300025960 Bacteria 801
427 Ga0207651_11134612 3300025960 Bacteria 701
428 Ga0207712_10023337 3300025961 Bacteria 4081
429 Ga0207668_10207963 3300025972 Bacteria 1563
430 Ga0207640_10095340 3300025981 Bacteria 2072
431 Ga0207658_11591458 3300025986 Bacteria 597
432 Ga0207677_10349553 3300026023 Bacteria 1238
433 Ga0207677_11474264 3300026023 Bacteria 628
434 Ga0207703_10032004 3300026035 Bacteria 4160
435 Ga0207703_10721945 3300026035 Bacteria 948
436 Ga0207678_10414795 3300026067 Bacteria 1167
437 Ga0207708_10031117 3300026075 Bacteria 4049
438 Ga0207708_10114328 3300026075 Bacteria 2098
439 Ga0207708_10247511 3300026075 Bacteria 1435
440 Ga0207708_10261005 3300026075 Bacteria 1398
441 Ga0207641_10054731 3300026088 Bacteria 3387
442 Ga0207641_10117176 3300026088 Bacteria 2371
443 Ga0207641_10772155 3300026088 Bacteria 949
444 Ga0207648_10009527 3300026089 Bacteria 9295
445 Ga0207648_10212464 3300026089 Bacteria 1718
446 Ga0207648_10904222 3300026089 Bacteria 825
447 Ga0207648_11548754 3300026089 Bacteria 623
448 Ga0207648_11835122 3300026089 Bacteria 568
449 Ga0207676_10262762 3300026095 Bacteria 1559
450 Ga0207676_10281934 3300026095 Bacteria 1509
451 Ga0207676_10304613 3300026095 Bacteria 1456
452 Ga0207676_10703135 3300026095 Bacteria 979
453 Ga0207674_10094380 3300026116 Bacteria 2978
454 Ga0207674_10277678 3300026116 Bacteria 1623
455 Ga0207675_100018398 3300026118 Bacteria 6515
456 Ga0207675_100508312 3300026118 Bacteria 1200
457 Ga0207683_10270135 3300026121 Bacteria 1553
458 Ga0207683_10288059 3300026121 Bacteria 1502
459 Ga0207683_11917221 3300026121 Bacteria 541
460 Ga0207698_10188666 3300026142 Bacteria 1834
461 Ga0207698_10636452 3300026142 Bacteria 1055
462 Ga0209996_1012116 3300027395 Bacteria 1156
463 Ga0209998_10144256 3300027717 Bacteria 609
464 Ga0207428_10003291 3300027907 Bacteria 15710
465 Ga0207428_11299273 3300027907 Unclassified 504
466 Ga0268265_10000103 3300028380 Bacteria 106177
467 Ga0268265_10130721 3300028380 Bacteria 2086
468 Ga0268264_10422574 3300028381 Bacteria 1286
469 Ga0268264_10523807 3300028381 Bacteria 1159
470 Ga0268264_11045584 3300028381 Bacteria 824
471 Ga0307408_100221067 3300031548 Bacteria 1545
472 Ga0307408_100641843 3300031548 Bacteria 948
473 Ga0307405_10030030 3300031731 Bacteria 3183
474 Ga0307405_10322303 3300031731 Bacteria 1181
475 Ga0307413_10098350 3300031824 Bacteria 1926
476 Ga0307413_10517101 3300031824 Bacteria 962
477 Ga0307410_10021298 3300031852 Bacteria 3984
478 Ga0307406_10006390 3300031901 Bacteria 6502
479 Ga0307407_10028719 3300031903 Bacteria 2977
480 Ga0307412_10004598 3300031911 Bacteria 7693
481 Ga0307409_100011077 3300031995 Bacteria 5659
482 Ga0307409_102814231 3300031995 Bacteria 514
483 Ga0307416_100046923 3300032002 Bacteria 3414
484 Ga0307416_103004430 3300032002 Bacteria 564
485 Ga0307414_10076590 3300032004 Bacteria 2431
486 Ga0307411_10471934 3300032005 Bacteria 1054
487 Ga0307415_100018033 3300032126 Bacteria 4250
488 Ga0307510_10271225 3300033180 Bacteria 1173
489 Ga0373930_0201738 3300034816 Bacteria 518
490 Ga0373936_0222911 3300035113 Bacteria 837
491 Ga0373939_0063688 3300035114 Bacteria 1182
492 Ga0373941_0472547 3300035115 Bacteria 529
493 Ga0373945_0343154 3300035116 Bacteria 646
494 Ga0373957_0370972 3300035120 Bacteria 613
495 Ga0373943_0463670 3300035170 Unclassified 737
496 Ga0373946_0217808 3300035171 Bacteria 921
497 Ga0373942_0247596 3300035207 Bacteria 605
498 Ga0373962_0041050 3300035242 Bacteria 1303
499 Ga0373924_0488578 3300035410 Bacteria 553
500 Ga0373931_0086669 3300035691 Bacteria 1738
501 Ga0373935_0742773 3300035692 Bacteria 723
502 Ga0373935_0971823 3300035692 Bacteria 630
503 Ga0373935_1244006 3300035692 Bacteria 555
504 Ga0373933_0987626 3300035724 Bacteria 554
505 Ga0373937_0103422 3300036401 Bacteria 2645
506 Ga0373925_0266905 3300037068 Bacteria 1376
507 Ga0436365_1882318 3300039437 Bacteria 852
508 Ga0451795_1229949 3300041456 Unclassified 580
509 Ga0451798_0105593 3300041458 Unclassified 513
510 Ga0451802_1757315 3300041460 Bacteria 718
511 Ga0451804_0520613 3300041463 Bacteria 550
512 Ga0451804_1051684 3300041463 Bacteria 536
513 Ga0451807_0362292 3300041486 Bacteria 617
514 Ga0451849_0943197 3300041505 Bacteria 529
515 Ga0451853_0935933 3300041512 Bacteria 518
516 Ga0451853_1716075 3300041512 Bacteria 1256
517 Ga0450888_056551 3300042126 Bacteria 570
518 Ga0450908_064031 3300042184 Bacteria 648
519 Ga0451577_0227611 3300042876 Bacteria 1686
520 Ga0453684_1599256 3300044712 Bacteria 669
521 Ga0451576_0030744 3300045051 Bacteria 5734
522 Ga0451576_0049051 3300045051 Bacteria 4431
523 Ga0451576_0066682 3300045051 Bacteria 3746
524 Ga0451576_1565814 3300045051 Bacteria 684
525 Ga0495603_0011963 3300046455 Bacteria 5252
526 Ga0495651_0644801 3300046462 Bacteria 664
527 Ga0495582_0134516 3300046473 Bacteria 1398
528 Ga0495582_0401800 3300046473 Bacteria 790
529 Ga0495605_0310467 3300046474 Bacteria 666
530 Ga0495584_0006905 3300046491 Bacteria 5932
531 Ga0495584_0025424 3300046491 Bacteria 3002
532 Ga0495594_0141090 3300046499 Bacteria 1367
533 Ga0495594_0345308 3300046499 Unclassified 847
534 Ga0495618_0756869 3300046514 Bacteria 568
535 Ga0495637_0135018 3300046520 Bacteria 940
536 Ga0495644_0080885 3300046523 Bacteria 1225
537 Ga0495663_0143150 3300046525 Bacteria 812
538 Ga0495663_0224185 3300046525 Bacteria 661
539 Ga0495665_0152106 3300046531 Bacteria 1208
540 Ga0495640_0593955 3300046533 Bacteria 669
541 Ga0495598_0031989 3300046537 Bacteria 1484
542 Ga0495598_0077317 3300046537 Bacteria 1061
543 Ga0495598_0209596 3300046537 Unclassified 707
544 Ga0495609_0080729 3300046538 Bacteria 1422
545 Ga0495609_0127111 3300046538 Bacteria 1093
546 Ga0495609_0130751 3300046538 Bacteria 1075
547 Ga0495621_0011914 3300046539 Bacteria 2702
548 Ga0495621_0057352 3300046539 Bacteria 1406
549 Ga0495621_0062890 3300046539 Bacteria 1351
550 Ga0495621_0530372 3300046539 Unclassified 510
551 Ga0495597_0290994 3300046542 Bacteria 635
552 Ga0495633_0258627 3300046558 Bacteria 794
553 Ga0495656_0652529 3300046615 Bacteria 565
554 Ga0495635_0824277 3300046663 Bacteria 597
555 Ga0495659_0020200 3300046664 Bacteria 2235
556 Ga0495659_0029621 3300046664 Bacteria 1901
557 Ga0495659_0044578 3300046664 Bacteria 1595
558 Ga0495659_0095127 3300046664 Bacteria 1148
559 Ga0495659_0150350 3300046664 Bacteria 934
560 Ga0495588_0004710 3300046674 Bacteria 6030
561 Ga0495657_0885554 3300046675 Bacteria 508
562 Ga0495623_0064561 3300046679 Bacteria 2291
563 Ga0495647_0114662 3300046681 Bacteria 1128
564 Ga0495658_0613974 3300046683 Bacteria 697
565 Ga0495669_0645287 3300046684 Bacteria 515
566 Ga0495649_0588622 3300046694 Bacteria 549
567 Ga0495581_0556071 3300047315 Unclassified 666
568 Ga0495636_0001627 3300047318 Bacteria 8550
569 Ga0495636_0042145 3300047318 Bacteria 1896
570 Ga0495636_0316935 3300047318 Bacteria 732
571 Ga0495636_0356316 3300047318 Bacteria 691
572 Ga0495675_0492574 3300047444 Bacteria 705
573 Ga0495677_0117279 3300047445 Bacteria 1014
574 Ga0495677_0121407 3300047445 Bacteria 997
575 Ga0495685_029968 3300047447 Bacteria 1871
576 Ga0495685_257475 3300047447 Bacteria 553
577 Ga0495684_0268225 3300047471 Bacteria 1236
578 Ga0496106_0065457 3300048909 Bacteria 2767
579 Ga0496107_0798891 3300048910 Bacteria 691
580 Ga0501300_024415 3300049523 Bacteria 886
581 Ga0501070_0304859 3300049586 Bacteria 1297
582 Ga0501070_1171433 3300049586 Bacteria 591
583 Ga0501071_0118501 3300049587 Bacteria 1961
584 Ga0501073_0177021 3300049589 Bacteria 1476
585 Ga0501073_0931877 3300049589 Bacteria 598
586 Ga0501075_1353046 3300049591 Bacteria 539
587 Ga0501076_0222021 3300049592 Bacteria 1544
588 Ga0501077_0308324 3300049593 Bacteria 1009
589 Ga0501239_021019 3300049672 Bacteria 801
590 Ga0501080_0673335 3300049742 Bacteria 914
591 Ga0501083_0464434 3300049744 Bacteria 824
592 nmdc:mga0yw44_927774_c1 3300050492 Bacteria 590
593 nmdc:mga06z11_526447_c1 3300050494 Bacteria 717
594 nmdc:mga05p37_1363061_c1 3300050507 Bacteria 717
595 nmdc:mga05p37_376826_c1 3300050507 Bacteria 1664
596 nmdc:mga05p37_750093_c1 3300050507 Bacteria 1076
597 nmdc:mga05p37_78028_c1 3300050507 Bacteria 4078
598 nmdc:mga09592_1506274_c1 3300050508 Unclassified 547
599 nmdc:mga09592_68398_c1 3300050508 Bacteria 3012
600 nmdc:mga06r32_1628882_c1 3300050510 Bacteria 583
601 nmdc:mga08y16_180860_c1 3300050511 Bacteria 2190
602 nmdc:mga08y16_2048179_c1 3300050511 Bacteria 521
603 nmdc:mga08y16_266902_c1 3300050511 Bacteria 1767
604 nmdc:mga08y16_43408_c1 3300050511 Bacteria 4712
605 nmdc:mga08y16_516314_c1 3300050511 Bacteria 1212
606 nmdc:mga0n895_1855110_c1 3300050512 Bacteria 563
607 nmdc:mga0n895_412466_c1 3300050512 Bacteria 1366
608 nmdc:mga0n895_68426_c1 3300050512 Bacteria 3518
609 nmdc:mga0rr50_423338_c1 3300050513 Bacteria 1127
610 nmdc:mga0rr50_46324_c1 3300050513 Bacteria 3201
611 nmdc:mga0rr50_486201_c1 3300050513 Bacteria 1049
612 nmdc:mga0rr50_818159_c1 3300050513 Bacteria 795
613 nmdc:mga0a205_10220_c1 3300050515 Bacteria 8622
614 nmdc:mga0a205_281986_c1 3300050515 Bacteria 1537
615 nmdc:mga0a205_7364_c1 3300050515 Bacteria 9967
616 Ga0501084_0122215 3300054114 Bacteria 2190
617 Ga0590071_036756 3300059421 Bacteria 1174
618 Ga0590075_027970 3300059424 Bacteria 1424
619 Ga0590075_127742 3300059424 Bacteria 667
620 Ga0590077_004094 3300059426 Bacteria 3001
621 Ga0501082_0222511 3300060353 Bacteria 1642
622 Ga0495580_0110947
623 JGI24744J21845_10082921
624 JGI24742J22300_10050722
625 Ga0065704_10767716
626 Ga0065712_10028176
627 Ga0065712_10125706
628 Ga0065712_10435253
629 Ga0065715_10121279
630 Ga0065715_10139250
631 Ga0065715_10301753
632 Ga0065715_10515114
633 Ga0065707_10098114
634 Ga0065707_10428812
635 Ga0065707_10429985
636 Ga0070676_10077191
637 Ga0070683_100247402
638 Ga0070690_100216467
639 Ga0070690_100708412
640 Ga0070670_100028507
641 Ga0070670_100085662
642 Ga0070670_100188788
643 Ga0070677_10045731
644 Ga0070677_10131600
645 Ga0070677_10344014
646 Ga0070677_10765769
647 Ga0068869_100034210
648 Ga0068869_100078319
649 Ga0068869_100136147
650 Ga0068869_100307181
651 Ga0068869_100424420
652 Ga0068869_100493899
653 Ga0068869_100961360
654 Ga0068869_101040870
655 Ga0070666_10338024
656 Ga0070666_10435440
657 Ga0070680_100470694
658 Ga0068868_100079170
659 Ga0068868_100409503
660 Ga0070689_100026719
661 Ga0070689_100083906
662 Ga0070689_100143839
663 Ga0070689_100721682
664 Ga0070689_101432651
665 Ga0070691_10269310
666 Ga0070687_100040387
667 Ga0070687_100061774
668 Ga0070687_100335040
669 Ga0070661_100157872
670 Ga0070661_100356354
671 Ga0070661_100628990
672 Ga0070692_10062965
673 Ga0070692_10639351
674 Ga0070668_100459570
675 Ga0070669_100004188
676 Ga0070669_100035931
677 Ga0070675_100002788
678 Ga0070675_100004981
679 Ga0070675_100007191
680 Ga0070675_100014470
681 Ga0070675_100110243
682 Ga0070675_100726307
683 Ga0070675_101473657
684 Ga0070675_101587703
685 Ga0070671_100006715
686 Ga0070671_100332260
687 Ga0070674_100234188
688 Ga0070674_100746596
689 Ga0070674_100854427
690 Ga0070674_101042690
691 Ga0070674_101946538
692 Ga0070673_100141242
693 Ga0070673_100207110
694 Ga0070673_100236349
695 Ga0070673_100265276
696 Ga0070673_102311096
697 Ga0070688_100071540
698 Ga0070688_100112800
699 Ga0070688_100192558
700 Ga0070688_100200560
701 Ga0070659_101058866
702 Ga0070667_100218846
703 Ga0070667_101698840
704 Ga0070713_100030866
705 Ga0070701_10020049
706 Ga0070701_10134120
707 Ga0070701_10373447
708 Ga0070705_100008402
709 Ga0070705_100015890
710 Ga0070705_100075744
711 Ga0070705_100165605
712 Ga0070705_100494094
713 Ga0070700_100052331
714 Ga0070700_100121881
715 Ga0070700_100372386
716 Ga0070700_100423505
717 Ga0070694_100013457
718 Ga0070694_100014289
719 Ga0070694_100098040
720 Ga0070694_100305312
721 Ga0070694_100594108
722 Ga0070708_100056889
723 Ga0070708_100216485
724 Ga0070708_102142672
725 Ga0070678_100132681
726 Ga0070678_100193489
727 Ga0070678_101262009
728 Ga0070662_100076213
729 Ga0070662_100494372
730 Ga0070662_101009073
731 Ga0070662_101463834
732 Ga0070681_10006387
733 Ga0068867_100006640
734 Ga0068867_100023324
735 Ga0070685_10314302
736 Ga0070685_11409824
737 Ga0070706_100173265
738 Ga0070706_100394746
739 Ga0070707_100650400
740 Ga0070707_101272529
741 Ga0070707_101771806
742 Ga0070707_101828918
743 Ga0070707_102343326
744 Ga0070698_100010970
745 Ga0070698_100415231
746 Ga0070698_101184884
747 Ga0070698_101352604
748 Ga0070699_100036688
749 Ga0070699_100047192
750 Ga0070699_100064132
751 Ga0070699_100796371
752 Ga0070679_100087491
753 Ga0070697_100060416
754 Ga0070697_100067414
755 Ga0070697_101089846
756 Ga0068853_101373927
757 Ga0070672_100056997
758 Ga0070672_100129701
759 Ga0070672_100147295
760 Ga0070672_100533654
761 Ga0070672_100628592
762 Ga0070672_100757208
763 Ga0070672_101065909
764 Ga0070686_100060876
765 Ga0070686_100174735
766 Ga0070686_100952938
767 Ga0070695_100006902
768 Ga0070695_100007286
769 Ga0070695_100026046
770 Ga0070695_100258410
771 Ga0070696_100048468
772 Ga0070696_100085249
773 Ga0070696_100103569
774 Ga0070696_100743640
775 Ga0070693_100362636
776 Ga0070665_101695884
777 Ga0070665_102051472
778 Ga0070704_100000751
779 Ga0070704_100022722
780 Ga0070704_100151523
781 Ga0070704_100308929
782 Ga0070704_102297340
783 Ga0070664_100014134
784 Ga0070664_100054522
785 Ga0070664_100348421
786 Ga0070664_100528072
787 Ga0070664_101434827
788 Ga0068857_100371509
789 Ga0068857_102071850
790 Ga0068854_100243256
791 Ga0070702_100063722
792 Ga0070702_100074211
793 Ga0070702_100120528
794 Ga0070702_100546998
795 Ga0068852_100611483
796 Ga0068852_102740758
797 Ga0068859_100081351
798 Ga0068859_100278770
799 Ga0068859_100431893
800 Ga0068859_100843034
801 Ga0068859_100901983
802 Ga0068859_101711247
803 Ga0068859_102350595
804 Ga0068859_102629087
805 Ga0068864_100040462
806 Ga0068864_100431255
807 Ga0068864_100688716
808 Ga0068866_10551797
809 Ga0068866_10803988
810 Ga0068866_10911081
811 Ga0068861_100081455
812 Ga0068861_100106644
813 Ga0068861_100150982
814 Ga0068861_101346331
815 Ga0068861_101465584
816 Ga0068851_10138188
817 Ga0068851_10830117
818 Ga0068870_10134968
819 Ga0068870_10355071
820 Ga0068870_10570518
821 Ga0068870_10580890
822 Ga0068870_10594460
823 Ga0068863_100072819
824 Ga0068863_100707198
825 Ga0068863_100966314
826 Ga0068863_101026916
827 Ga0068863_101474614
828 Ga0068863_102510503
829 Ga0068858_100078615
830 Ga0068858_100306249
831 Ga0068858_101053670
832 Ga0068860_100129166
833 Ga0068860_100301156
834 Ga0068860_100441173
835 Ga0068862_100025264
836 Ga0068862_100217895
837 Ga0068862_100301304
838 Ga0068862_102226672
839 Ga0070717_11723740
840 Ga0075432_10429337
841 Ga0075367_10198803
842 Ga0075367_10628261
843 Ga0075366_10461906
844 Ga0097621_100110275
845 Ga0097621_100405831
846 Ga0097621_101166980
847 Ga0097621_101231180
848 Ga0097621_101747581
849 Ga0068871_100077985
850 Ga0068871_100178147
851 Ga0068871_102096382
852 Ga0075428_100089096
853 Ga0075428_100236605
854 Ga0075428_100559334
855 Ga0075428_100768579
856 Ga0075433_10034234
857 Ga0075433_10034313
858 Ga0075433_10391321
859 Ga0075434_100067078
860 Ga0075434_100076740
861 Ga0075434_100117511
862 Ga0075434_102582680
863 Ga0075434_102591882
864 Ga0075429_100753802
865 Ga0068865_100215813
866 Ga0068865_100402881
867 Ga0068865_101798685
868 Ga0075436_100697645
869 Ga0097620_100081353
870 Ga0097620_100278782
871 Ga0097620_100431880
872 Ga0097620_100843029
873 Ga0097620_100901948
874 Ga0097620_101711212
875 Ga0097620_102350304
876 Ga0097620_102629098
877 Ga0075435_100046915
878 Ga0075435_100246072
879 Ga0075435_100272596
880 Ga0111539_11763919
881 Ga0111539_11899468
882 Ga0105245_10133246
883 Ga0105245_12004528
884 Ga0105247_11315378
885 Ga0105247_11399974
886 Ga0114129_10074308
887 Ga0114129_11236843
888 Ga0114129_11241004
889 Ga0105243_10194452
890 Ga0105243_10814027
891 Ga0105243_11204353
892 Ga0105243_11266557
893 Ga0105243_11440191
894 Ga0105243_11853712
895 Ga0105243_12021022
896 Ga0105241_11318657
897 Ga0105242_10021951
898 Ga0105242_10218220
899 Ga0105248_10149833
900 Ga0105248_10747472
901 Ga0105248_10859031
902 Ga0105248_11724069
903 Ga0105238_10635890
904 Ga0105249_10019022
905 Ga0105249_10371605
906 Ga0105249_12994596
907 Ga0105246_10222812
908 Ga0105246_10526931
909 Ga0157374_12648406
910 Ga0157378_10285963
911 Ga0157378_10398965
912 Ga0157378_10726175
913 Ga0157378_11688346
914 Ga0157378_12638753
915 Ga0157378_12767293
916 Ga0163162_10058002
917 Ga0163162_11481798
918 Ga0157375_10050888
919 Ga0157375_11178755
920 Ga0163163_10029752
921 Ga0163163_10250326
922 Ga0163163_10612765
923 Ga0163163_11228727
924 Ga0163163_11602571
925 Ga0157380_10130605
926 Ga0157380_10159106
927 Ga0157380_10348019
928 Ga0157380_10607578
929 Ga0157380_11838853
930 Ga0157380_11940519
931 Ga0157380_12944111
932 Ga0157377_10088425
933 Ga0157377_10349330
934 Ga0157377_10352918
935 Ga0157377_11231927
936 Ga0157376_10570745
937 Ga0157376_10770272
938 Ga0157376_10889560
939 Ga0157376_11710627
940 Ga0157376_11956055
941 Ga0157376_12198124
942 Ga0163161_10192474
943 Ga0207666_1022238
944 Ga0207697_10267849
945 Ga0207656_10126063
946 Ga0207653_10034046
947 Ga0207653_10156924
948 Ga0207653_10380558
949 Ga0207682_10018499
950 Ga0207682_10216166
951 Ga0207682_10303395
952 Ga0207642_10808523
953 Ga0207688_10035328
954 Ga0207688_10526516
955 Ga0207688_10798939
956 Ga0207680_10324801
957 Ga0207680_10746250
958 Ga0207647_10493146
959 Ga0207645_10423433
960 Ga0207645_10818232
961 Ga0207643_10011439
962 Ga0207643_10019923
963 Ga0207643_10072061
964 Ga0207643_10145617
965 Ga0207643_10255981
966 Ga0207643_10275311
967 Ga0207643_10392902
968 Ga0207643_10538657
969 Ga0207643_10581887
970 Ga0207684_10453277
971 Ga0207707_10006304
972 Ga0207663_11577693
973 Ga0207660_10704982
974 Ga0207662_10027421
975 Ga0207662_10161773
976 Ga0207662_10741368
977 Ga0207649_10371043
978 Ga0207652_10102128
979 Ga0207646_10071533
980 Ga0207646_10109852
981 Ga0207646_10124641
982 Ga0207646_10331874
983 Ga0207681_10017709
984 Ga0207681_10562525
985 Ga0207681_11406450
986 Ga0207694_10132993
987 Ga0207650_10014338
988 Ga0207650_10032902
989 Ga0207650_10058557
990 Ga0207659_10007868
991 Ga0207659_10013032
992 Ga0207659_10020916
993 Ga0207659_10148615
994 Ga0207659_10311434
995 Ga0207659_10684192
996 Ga0207659_10835157
997 Ga0207659_11150338
998 Ga0207687_10460189
999 Ga0207700_10116755
1000 Ga0207644_10006450
1001 Ga0207690_10133244
1002 Ga0207690_11489740
1003 Ga0207706_10078599
1004 Ga0207706_10221488
1005 Ga0207706_10775281
1006 Ga0207706_11566057
1007 Ga0207686_10083208
1008 Ga0207709_10532592
1009 Ga0207709_10649464
1010 Ga0207709_11584424
1011 Ga0207670_10043637
1012 Ga0207670_11072921
1013 Ga0207669_10308935
1014 Ga0207669_10700941
1015 Ga0207669_10793296
1016 Ga0207669_11048700
1017 Ga0207704_10334856
1018 Ga0207691_10062500
1019 Ga0207691_10118137
1020 Ga0207691_10273237
1021 Ga0207691_10439703
1022 Ga0207691_10537278
1023 Ga0207691_10912830
1024 Ga0207711_10549962
1025 Ga0207711_10933005
1026 Ga0207711_11059224
1027 Ga0207689_10046381
1028 Ga0207689_10090334
1029 Ga0207689_10218760
1030 Ga0207689_10293746
1031 Ga0207689_10415336
1032 Ga0207689_10447376
1033 Ga0207689_10670616
1034 Ga0207689_10679038
1035 Ga0207679_10027564
1036 Ga0207679_10027627
1037 Ga0207679_10102212
1038 Ga0207679_10146514
1039 Ga0207679_10317238
1040 Ga0207679_10717674
1041 Ga0207679_10949706
1042 Ga0207679_11316889
1043 Ga0207651_10029028
1044 Ga0207651_10225684
1045 Ga0207651_10329350
1046 Ga0207651_10463311
1047 Ga0207651_10871482
1048 Ga0207651_11134612
1049 Ga0207712_10023337
1050 Ga0207668_10207963
1051 Ga0207640_10095340
1052 Ga0207658_11591458
1053 Ga0207677_10349553
1054 Ga0207677_11474264
1055 Ga0207703_10032004
1056 Ga0207703_10721945
1057 Ga0207678_10414795
1058 Ga0207708_10031117
1059 Ga0207708_10114328
1060 Ga0207708_10247511
1061 Ga0207708_10261005
1062 Ga0207641_10054731
1063 Ga0207641_10117176
1064 Ga0207641_10772155
1065 Ga0207648_10009527
1066 Ga0207648_10212464
1067 Ga0207648_10904222
1068 Ga0207648_11548754
1069 Ga0207648_11835122
1070 Ga0207676_10262762
1071 Ga0207676_10281934
1072 Ga0207676_10304613
1073 Ga0207676_10703135
1074 Ga0207674_10094380
1075 Ga0207674_10277678
1076 Ga0207675_100018398
1077 Ga0207675_100508312
1078 Ga0207683_10270135
1079 Ga0207683_10288059
1080 Ga0207683_11917221
1081 Ga0207698_10188666
1082 Ga0207698_10636452
1083 Ga0209996_1012116
1084 Ga0209998_10144256
1085 Ga0207428_10003291
1086 Ga0207428_11299273
1087 Ga0268265_10000103
1088 Ga0268265_10130721
1089 Ga0268264_10422574
1090 Ga0268264_10523807
1091 Ga0268264_11045584
1092 Ga0307408_100221067
1093 Ga0307408_100641843
1094 Ga0307405_10030030
1095 Ga0307405_10322303
1096 Ga0307413_10098350
1097 Ga0307413_10517101
1098 Ga0307410_10021298
1099 Ga0307406_10006390
1100 Ga0307407_10028719
1101 Ga0307412_10004598
1102 Ga0307409_100011077
1103 Ga0307409_102814231
1104 Ga0307416_100046923
1105 Ga0307416_103004430
1106 Ga0307414_10076590
1107 Ga0307411_10471934
1108 Ga0307415_100018033
1109 Ga0307510_10271225
1110 Ga0373930_0201738
1111 Ga0373936_0222911
1112 Ga0373939_0063688
1113 Ga0373941_0472547
1114 Ga0373945_0343154
1115 Ga0373957_0370972
1116 Ga0373943_0463670
1117 Ga0373946_0217808
1118 Ga0373942_0247596
1119 Ga0373962_0041050
1120 Ga0373924_0488578
1121 Ga0373931_0086669
1122 Ga0373935_0742773
1123 Ga0373935_0971823
1124 Ga0373935_1244006
1125 Ga0373933_0987626
1126 Ga0373937_0103422
1127 Ga0373925_0266905
1128 Ga0436365_1882318
1129 Ga0451795_1229949
1130 Ga0451798_0105593
1131 Ga0451802_1757315
1132 Ga0451804_0520613
1133 Ga0451804_1051684
1134 Ga0451807_0362292
1135 Ga0451849_0943197
1136 Ga0451853_0935933
1137 Ga0451853_1716075
1138 Ga0450888_056551
1139 Ga0450908_064031
1140 Ga0451577_0227611
1141 Ga0453684_1599256
1142 Ga0451576_0030744
1143 Ga0451576_0049051
1144 Ga0451576_0066682
1145 Ga0451576_1565814
1146 Ga0495603_0011963
1147 Ga0495651_0644801
1148 Ga0495582_0134516
1149 Ga0495582_0401800
1150 Ga0495605_0310467
1151 Ga0495584_0006905
1152 Ga0495584_0025424
1153 Ga0495594_0141090
1154 Ga0495594_0345308
1155 Ga0495618_0756869
1156 Ga0495637_0135018
1157 Ga0495644_0080885
1158 Ga0495663_0143150
1159 Ga0495663_0224185
1160 Ga0495665_0152106
1161 Ga0495640_0593955
1162 Ga0495598_0031989
1163 Ga0495598_0077317
1164 Ga0495598_0209596
1165 Ga0495609_0080729
1166 Ga0495609_0127111
1167 Ga0495609_0130751
1168 Ga0495621_0011914
1169 Ga0495621_0057352
1170 Ga0495621_0062890
1171 Ga0495621_0530372
1172 Ga0495597_0290994
1173 Ga0495633_0258627
1174 Ga0495656_0652529
1175 Ga0495635_0824277
1176 Ga0495659_0020200
1177 Ga0495659_0029621
1178 Ga0495659_0044578
1179 Ga0495659_0095127
1180 Ga0495659_0150350
1181 Ga0495588_0004710
1182 Ga0495657_0885554
1183 Ga0495623_0064561
1184 Ga0495647_0114662
1185 Ga0495658_0613974
1186 Ga0495669_0645287
1187 Ga0495649_0588622
1188 Ga0495581_0556071
1189 Ga0495636_0001627
1190 Ga0495636_0042145
1191 Ga0495636_0316935
1192 Ga0495636_0356316
1193 Ga0495675_0492574
1194 Ga0495677_0117279
1195 Ga0495677_0121407
1196 Ga0495685_029968
1197 Ga0495685_257475
1198 Ga0495684_0268225
1199 Ga0496106_0065457
1200 Ga0496107_0798891
1201 Ga0501300_024415
1202 Ga0501070_0304859
1203 Ga0501070_1171433
1204 Ga0501071_0118501
1205 Ga0501073_0177021
1206 Ga0501073_0931877
1207 Ga0501075_1353046
1208 Ga0501076_0222021
1209 Ga0501077_0308324
1210 Ga0501239_021019
1211 Ga0501080_0673335
1212 Ga0501083_0464434
1213 nmdc:mga0yw44_927774_c1
1214 nmdc:mga06z11_526447_c1
1215 nmdc:mga05p37_1363061_c1
1216 nmdc:mga05p37_376826_c1
1217 nmdc:mga05p37_750093_c1
1218 nmdc:mga05p37_78028_c1
1219 nmdc:mga09592_1506274_c1
1220 nmdc:mga09592_68398_c1
1221 nmdc:mga06r32_1628882_c1
1222 nmdc:mga08y16_180860_c1
1223 nmdc:mga08y16_2048179_c1
1224 nmdc:mga08y16_266902_c1
1225 nmdc:mga08y16_43408_c1
1226 nmdc:mga08y16_516314_c1
1227 nmdc:mga0n895_1855110_c1
1228 nmdc:mga0n895_412466_c1
1229 nmdc:mga0n895_68426_c1
1230 nmdc:mga0rr50_423338_c1
1231 nmdc:mga0rr50_46324_c1
1232 nmdc:mga0rr50_486201_c1
1233 nmdc:mga0rr50_818159_c1
1234 nmdc:mga0a205_10220_c1
1235 nmdc:mga0a205_281986_c1
1236 nmdc:mga0a205_7364_c1
1237 Ga0501084_0122215
1238 Ga0590071_036756
1239 Ga0590075_027970
1240 Ga0590075_127742
1241 Ga0590077_004094
1242 Ga0501082_0222511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

13

63

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvm-assembly1.cif.gz_y cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9948 14 69
6fxc-assembly1.cif.gz_AX the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus 0.9895 15 69
7nhn-assembly1.cif.gz_3 vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9891 16 69
7msh-assembly1.cif.gz_Z mtb 70sic in complex with mtbetta at pre_r1 state 0.9878 15 69
5hl7-assembly1.cif.gz_W the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin 0.9864 15 69
ID Description Score Start End Superfamily
af_P9WHA3_1_65_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.991 15 69 3.30.1390.20
af_B6SIL2_19_102_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9872 15 69 3.30.1390.20
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9864 15 69 3.30.1390.20
af_Q502J9_61_114_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9843 18 69 3.30.1390.20
4wfbW00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9841 15 69 3.30.1390.20
ID Description Score Start End GO Terms
AF-A0A6L9IZY2-F1-model_v4 Large ribosomal subunit protein uL30 1.009 15 69 GO:0003735
GO:0006412
GO:0022625
AF-A1T0C4-F1-model_v4 Large ribosomal subunit protein uL30 (50S ribosomal protein L30) 1.009 15 69 GO:0003735
GO:0006412
GO:0022625
AF-A0A495A0Q6-F1-model_v4 Large ribosomal subunit protein uL30 1.008 15 69 GO:0003735
GO:0006412
GO:0022625
AF-A0A3A0A9M6-F1-model_v4 Large ribosomal subunit protein uL30 1.007 15 69 GO:0003735
GO:0006412
GO:0022625
AF-A0A3A1YNJ4-F1-model_v4 Large ribosomal subunit protein uL30 1.007 15 69 GO:0003735
GO:0006412
GO:0022625

Map