F470028

General Info

Members Datasets Scaffolds Average Seq Length
621 220 617 314

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0005877|Ga0466957_0005877_4637_5674
Length 345
Sequence LKNNGTVSCKRTGLAGTTYKTCRDAAASMAQPGSTGAAGWLLALFLFFSHCLHAQDSLVKVQNKAVLLKEVVVRNNLNVAAFIERIKNDTTFYKAFRNLKVLGYTSLNDIRMLDKKGNAEASLYSRTKQHVQHGCRYTEVVEEQTTGDIYDRHHQFNYYTPNMYAGLFFAHDTICGETNIVKDAGFSMQGKSGLEKHKEQLKMLFFNPGKKIPGIPFIGNKIALFDDEVAARYDFTIDMDVFKGDMCYVFTCRPRAGLPEGDKDKIVVNNMTTWFKIDTWEIVARDYDLSYNAGVYDFDVSMQVEMTKFGDYLVPKLLRYNGNWDVVLKKRERCSFTATLFDFTR

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2914759650 Rhizosphaericola mali Isolate Rhizosphere
4 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
175 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
215 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
216 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
217 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0
Rhizoplane 0.48
Rhizosphere 95.01
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10029687 3300001979 Bacteria 1792
2 JGI25406J46586_10000164 3300003203 Bacteria 29453
3 rootH1_10027226 3300003316 Bacteria 1908
4 rootL2_10184023 3300003322 Bacteria 2601
5 rootH1_10130286 3300003323 Bacteria 2551
6 JGI25160J50197_1000890 3300003354 Bacteria 15723
7 Ga0065714_10071790 3300005288 Bacteria 3494
8 Ga0065712_10077630 3300005290 Bacteria 3464
9 Ga0065712_10092087 3300005290 Bacteria 2344
10 Ga0065712_10120338 3300005290 Bacteria 1680
11 Ga0065715_10005566 3300005293 Unclassified 3438
12 Ga0070658_10042499 3300005327 Bacteria 3671
13 Ga0070658_10063887 3300005327 Bacteria 3002
14 Ga0070658_10074363 3300005327 Bacteria 2786
15 Ga0070658_10083412 3300005327 Bacteria 2627
16 Ga0070658_10122131 3300005327 Unclassified 2165
17 Ga0070658_10200696 3300005327 Unclassified 1683
18 Ga0070676_10009111 3300005328 Bacteria 5368
19 Ga0070676_10014038 3300005328 Bacteria 4395
20 Ga0070683_100000862 3300005329 Bacteria 22425
21 Ga0070683_100013449 3300005329 Bacteria 7137
22 Ga0070683_100050705 3300005329 Bacteria 3843
23 Ga0070683_100073584 3300005329 Unclassified 3190
24 Ga0070683_100158225 3300005329 Bacteria 2149
25 Ga0070690_100222626 3300005330 Bacteria 1323
26 Ga0070670_100037676 3300005331 Bacteria 4160
27 Ga0070670_100067808 3300005331 Bacteria 3061
28 Ga0070670_100075792 3300005331 Bacteria 2890
29 Ga0070670_100091083 3300005331 Bacteria 2621
30 Ga0070670_100181776 3300005331 Unclassified 1826
31 Ga0070670_100253266 3300005331 Unclassified 1534
32 Ga0068869_100009985 3300005334 Bacteria 6173
33 Ga0068869_100022928 3300005334 Bacteria 4306
34 Ga0068869_100055657 3300005334 Unclassified 2883
35 Ga0068869_100127384 3300005334 Bacteria 1954
36 Ga0068869_100276642 3300005334 Bacteria 1349
37 Ga0070666_10000028 3300005335 Bacteria 144796
38 Ga0070666_10005690 3300005335 Bacteria 7645
39 Ga0070666_10057201 3300005335 Bacteria 2635
40 Ga0070680_100004942 3300005336 Bacteria 10040
41 Ga0070680_100063974 3300005336 Bacteria 3014
42 Ga0070680_100151852 3300005336 Bacteria 1944
43 Ga0070682_100001801 3300005337 Bacteria 11968
44 Ga0070682_100007803 3300005337 Bacteria 6026
45 Ga0070682_100022879 3300005337 Bacteria 3707
46 Ga0068868_100001540 3300005338 Bacteria 15748
47 Ga0068868_100010912 3300005338 Bacteria 6593
48 Ga0068868_100043201 3300005338 Bacteria 3520
49 Ga0068868_100108878 3300005338 Bacteria 2250
50 Ga0068868_100184491 3300005338 Bacteria 1732
51 Ga0068868_100492669 3300005338 Bacteria 1072
52 Ga0070660_100001807 3300005339 Bacteria 14682
53 Ga0070660_100009507 3300005339 Bacteria 6841
54 Ga0070689_100001483 3300005340 Bacteria 14964
55 Ga0070689_100004391 3300005340 Bacteria 9521
56 Ga0070689_100011247 3300005340 Bacteria 6407
57 Ga0070661_100001691 3300005344 Bacteria 15284
58 Ga0070661_100037273 3300005344 Bacteria 3536
59 Ga0070661_100176582 3300005344 Bacteria 1624
60 Ga0070668_100189328 3300005347 Unclassified 1684
61 Ga0070669_100000458 3300005353 Bacteria 30951
62 Ga0070669_100026149 3300005353 Unclassified 4198
63 Ga0070669_100124832 3300005353 Bacteria 1968
64 Ga0070669_100181644 3300005353 Bacteria 1646
65 Ga0070675_100068217 3300005354 Bacteria 2945
66 Ga0070675_100172804 3300005354 Bacteria 1864
67 Ga0070671_100015312 3300005355 Bacteria 6193
68 Ga0070671_100096968 3300005355 Bacteria 2473
69 Ga0070671_100222920 3300005355 Bacteria 1599
70 Ga0070674_100050049 3300005356 Bacteria 2875
71 Ga0070674_100076273 3300005356 Bacteria 2383
72 Ga0070673_100006930 3300005364 Bacteria 7414
73 Ga0070673_100041630 3300005364 Bacteria 3536
74 Ga0070673_100049130 3300005364 Bacteria 3292
75 Ga0070673_100127065 3300005364 Bacteria 2134
76 Ga0070673_100465640 3300005364 Bacteria 1139
77 Ga0070688_100000687 3300005365 Bacteria 16799
78 Ga0070688_100301193 3300005365 Bacteria 1159
79 Ga0070659_100006693 3300005366 Bacteria 8332
80 Ga0070659_100008078 3300005366 Bacteria 7672
81 Ga0070659_100008332 3300005366 Bacteria 7568
82 Ga0070659_100010915 3300005366 Bacteria 6702
83 Ga0070659_100121677 3300005366 Bacteria 2115
84 Ga0070667_100011625 3300005367 Bacteria 7279
85 Ga0070667_100045885 3300005367 Bacteria 3676
86 Ga0070667_100047282 3300005367 Bacteria 3620
87 Ga0070667_100079651 3300005367 Unclassified 2800
88 Ga0070667_100109669 3300005367 Bacteria 2392
89 Ga0070667_100120221 3300005367 Unclassified 2284
90 Ga0070667_100188766 3300005367 Bacteria 1825
91 Ga0070701_10171924 3300005438 Bacteria 1262
92 Ga0070663_100076860 3300005455 Bacteria 2443
93 Ga0070663_100233894 3300005455 Unclassified 1448
94 Ga0070663_100241962 3300005455 Bacteria 1425
95 Ga0070678_100006600 3300005456 Bacteria 6821
96 Ga0070662_100058746 3300005457 Unclassified 2800
97 Ga0070662_100059767 3300005457 Bacteria 2777
98 Ga0070662_100070054 3300005457 Bacteria 2583
99 Ga0070662_100114618 3300005457 Bacteria 2058
100 Ga0070681_10017972 3300005458 Bacteria 7066
101 Ga0070681_10162932 3300005458 Bacteria 2154
102 Ga0068867_100052640 3300005459 Unclassified 3005
103 Ga0068867_100110302 3300005459 Bacteria 2113
104 Ga0068867_100129533 3300005459 Bacteria 1959
105 Ga0068867_100161277 3300005459 Bacteria 1768
106 Ga0070685_10005886 3300005466 Bacteria 6240
107 Ga0070685_10069690 3300005466 Bacteria 2080
108 Ga0070685_10203156 3300005466 Bacteria 1289
109 Ga0070698_100000219 3300005471 Bacteria 56179
110 Ga0070698_100025806 3300005471 Bacteria 6124
111 Ga0070679_100002696 3300005530 Bacteria 16171
112 Ga0070679_100007239 3300005530 Bacteria 10356
113 Ga0070679_100057881 3300005530 Bacteria 3863
114 Ga0070679_100080128 3300005530 Bacteria 3254
115 Ga0070679_100152045 3300005530 Bacteria 2291
116 Ga0070679_100164335 3300005530 Bacteria 2194
117 Ga0070684_100003259 3300005535 Bacteria 12159
118 Ga0070684_100003664 3300005535 Bacteria 11592
119 Ga0070684_100426108 3300005535 Unclassified 1225
120 Ga0068853_100007345 3300005539 Bacteria 8818
121 Ga0068853_100035993 3300005539 Bacteria 4207
122 Ga0068853_100045401 3300005539 Bacteria 3763
123 Ga0068853_100112192 3300005539 Unclassified 2423
124 Ga0068853_100128855 3300005539 Unclassified 2263
125 Ga0068853_100180505 3300005539 Bacteria 1914
126 Ga0068853_100246739 3300005539 Unclassified 1638
127 Ga0068853_100258408 3300005539 Unclassified 1600
128 Ga0068853_100339836 3300005539 Bacteria 1395
129 Ga0070672_100031816 3300005543 Bacteria 3976
130 Ga0070672_100041579 3300005543 Bacteria 3534
131 Ga0070686_100019060 3300005544 Bacteria 4037
132 Ga0070665_100049266 3300005548 Bacteria 4227
133 Ga0070704_100225172 3300005549 Unclassified 1527
134 Ga0068855_100005487 3300005563 Bacteria 15473
135 Ga0068855_100015674 3300005563 Bacteria 9120
136 Ga0068855_100067351 3300005563 Bacteria 4172
137 Ga0068855_100205792 3300005563 Bacteria 2214
138 Ga0068855_100212804 3300005563 Bacteria 2171
139 Ga0068855_100221014 3300005563 Bacteria 2124
140 Ga0070664_100013991 3300005564 Bacteria 6543
141 Ga0070664_100070880 3300005564 Bacteria 2986
142 Ga0070664_100075700 3300005564 Bacteria 2891
143 Ga0070664_100218172 3300005564 Bacteria 1706
144 Ga0068857_100022428 3300005577 Bacteria 5554
145 Ga0068857_100207829 3300005577 Bacteria 1786
146 Ga0068857_100256507 3300005577 Bacteria 1604
147 Ga0068857_100256662 3300005577 Unclassified 1604
148 Ga0068857_100277417 3300005577 Bacteria 1541
149 Ga0068857_100403430 3300005577 Bacteria 1272
150 Ga0068857_100419371 3300005577 Bacteria 1248
151 Ga0068854_100181909 3300005578 Bacteria 1643
152 Ga0068856_100050531 3300005614 Bacteria 4099
153 Ga0068852_100004976 3300005616 Bacteria 9451
154 Ga0068852_100006019 3300005616 Bacteria 8738
155 Ga0068852_100581986 3300005616 Bacteria 1122
156 Ga0068859_100000012 3300005617 Bacteria 300376
157 Ga0068859_100004526 3300005617 Bacteria 14178
158 Ga0068859_100010347 3300005617 Bacteria 9388
159 Ga0068859_100014457 3300005617 Bacteria 7923
160 Ga0068859_100014474 3300005617 Bacteria 7919
161 Ga0068859_100071266 3300005617 Bacteria 3511
162 Ga0068859_100105670 3300005617 Bacteria 2875
163 Ga0068859_100120114 3300005617 Bacteria 2695
164 Ga0068859_100497048 3300005617 Bacteria 1315
165 Ga0068864_100007320 3300005618 Bacteria 9082
166 Ga0068864_100070017 3300005618 Bacteria 3051
167 Ga0068864_100192521 3300005618 Bacteria 1870
168 Ga0068866_10033997 3300005718 Bacteria 2479
169 Ga0068861_100001813 3300005719 Bacteria 13764
170 Ga0068851_10050281 3300005834 Bacteria 2116
171 Ga0068870_10014000 3300005840 Bacteria 3780
172 Ga0068870_10041624 3300005840 Bacteria 2388
173 Ga0068863_100002125 3300005841 Bacteria 19657
174 Ga0068863_100008194 3300005841 Bacteria 10212
175 Ga0068863_100009422 3300005841 Bacteria 9532
176 Ga0068863_100169946 3300005841 Bacteria 2091
177 Ga0068863_100314305 3300005841 Bacteria 1521
178 Ga0068858_100086356 3300005842 Bacteria 2918
179 Ga0068860_100002572 3300005843 Bacteria 18984
180 Ga0068860_100015531 3300005843 Bacteria 7435
181 Ga0068860_100020230 3300005843 Bacteria 6450
182 Ga0068860_100020290 3300005843 Bacteria 6437
183 Ga0068860_100167093 3300005843 Unclassified 2124
184 Ga0068860_100206597 3300005843 Bacteria 1905
185 Ga0068860_100573171 3300005843 Bacteria 1132
186 Ga0068862_100003547 3300005844 Bacteria 13375
187 Ga0068862_100018106 3300005844 Bacteria 5866
188 Ga0081539_10000042 3300005985 Bacteria 289955
189 Ga0097621_100000063 3300006237 Bacteria 55571
190 Ga0097621_100172927 3300006237 Bacteria 1863
191 Ga0097621_100491160 3300006237 Bacteria 1111
192 Ga0068871_100000251 3300006358 Bacteria 37472
193 Ga0068871_100003922 3300006358 Bacteria 10260
194 Ga0068871_100203672 3300006358 Bacteria 1709
195 Ga0068871_100326494 3300006358 Unclassified 1352
196 Ga0068871_100362669 3300006358 Bacteria 1284
197 Ga0075428_100003382 3300006844 Bacteria 17450
198 Ga0075428_100030666 3300006844 Bacteria 5945
199 Ga0075428_100134618 3300006844 Bacteria 2687
200 Ga0075431_100036042 3300006847 Bacteria 5095
201 Ga0075429_100004591 3300006880 Bacteria 11873
202 Ga0075429_100048056 3300006880 Bacteria 3711
203 Ga0075429_100294899 3300006880 Bacteria 1420
204 Ga0068865_100093559 3300006881 Bacteria 2186
205 Ga0068865_100216827 3300006881 Unclassified 1494
206 Ga0097620_100000012 3300006931 Bacteria 300376
207 Ga0097620_100004526 3300006931 Bacteria 14178
208 Ga0097620_100010347 3300006931 Bacteria 9388
209 Ga0097620_100014457 3300006931 Bacteria 7923
210 Ga0097620_100014474 3300006931 Bacteria 7919
211 Ga0097620_100071265 3300006931 Bacteria 3511
212 Ga0097620_100105667 3300006931 Bacteria 2875
213 Ga0097620_100120114 3300006931 Bacteria 2695
214 Ga0097620_100497061 3300006931 Bacteria 1315
215 Ga0105251_10149762 3300009011 Bacteria 1054
216 Ga0105240_10164323 3300009093 Bacteria 2634
217 Ga0105240_10632131 3300009093 Bacteria 1175
218 Ga0111539_10006834 3300009094 Bacteria 14661
219 Ga0111539_10032122 3300009094 Bacteria 6377
220 Ga0111539_10232439 3300009094 Bacteria 2147
221 Ga0111539_10260807 3300009094 Unclassified 2017
222 Ga0111539_10532279 3300009094 Bacteria 1369
223 Ga0105247_10003345 3300009101 Bacteria 10493
224 Ga0105247_10008343 3300009101 Bacteria 6317
225 Ga0114129_10015943 3300009147 Bacteria 10687
226 Ga0114129_10029791 3300009147 Bacteria 7728
227 Ga0105241_10000619 3300009174 Bacteria 26737
228 Ga0105241_10243239 3300009174 Bacteria 1522
229 Ga0105241_10320216 3300009174 Unclassified 1337
230 Ga0105242_10003805 3300009176 Bacteria 11735
231 Ga0105242_10038298 3300009176 Bacteria 3855
232 Ga0105242_10071482 3300009176 Bacteria 2879
233 Ga0105248_10055021 3300009177 Bacteria 4463
234 Ga0105248_10285162 3300009177 Bacteria 1859
235 Ga0105248_10529940 3300009177 Bacteria 1328
236 Ga0105248_10602106 3300009177 Unclassified 1240
237 Ga0105237_10005882 3300009545 Bacteria 13751
238 Ga0105237_10007560 3300009545 Bacteria 11876
239 Ga0105237_10009852 3300009545 Bacteria 10215
240 Ga0105249_10002774 3300009553 Bacteria 15117
241 Ga0105249_10014173 3300009553 Bacteria 7047
242 Ga0105249_10022623 3300009553 Bacteria 5632
243 Ga0105249_10055586 3300009553 Bacteria 3622
244 Ga0105249_10103085 3300009553 Bacteria 2686
245 Ga0105249_10107760 3300009553 Bacteria 2629
246 Ga0105249_10301727 3300009553 Bacteria 1607
247 Ga0105249_10867196 3300009553 Unclassified 969
248 Ga0105239_10010863 3300010375 Bacteria 10172
249 Ga0105239_10015270 3300010375 Bacteria 8508
250 Ga0105239_10039464 3300010375 Bacteria 5173
251 Ga0105239_10452514 3300010375 Unclassified 1457
252 Ga0105239_10523822 3300010375 Unclassified 1349
253 Ga0105246_10016670 3300011119 Bacteria 4655
254 Ga0105246_10138938 3300011119 Bacteria 1824
255 Ga0157373_10018157 3300013100 Bacteria 5123
256 Ga0157373_10031113 3300013100 Bacteria 3841
257 Ga0157373_10035635 3300013100 Bacteria 3572
258 Ga0157373_10054349 3300013100 Bacteria 2845
259 Ga0157373_10082332 3300013100 Bacteria 2268
260 Ga0157373_10130557 3300013100 Bacteria 1767
261 Ga0157371_10001955 3300013102 Bacteria 20487
262 Ga0157371_10002374 3300013102 Bacteria 18004
263 Ga0157371_10003617 3300013102 Bacteria 13918
264 Ga0157371_10003640 3300013102 Bacteria 13876
265 Ga0157371_10007345 3300013102 Bacteria 8935
266 Ga0157371_10009513 3300013102 Bacteria 7642
267 Ga0157371_10011624 3300013102 Bacteria 6768
268 Ga0157371_10029334 3300013102 Bacteria 3980
269 Ga0157371_10054078 3300013102 Bacteria 2852
270 Ga0157371_10075177 3300013102 Bacteria 2392
271 Ga0157371_10098688 3300013102 Bacteria 2071
272 Ga0157371_10138042 3300013102 Bacteria 1737
273 Ga0157371_10177834 3300013102 Bacteria 1521
274 Ga0157371_10196342 3300013102 Unclassified 1446
275 Ga0157371_10413930 3300013102 Bacteria 988
276 Ga0157370_10005999 3300013104 Bacteria 13518
277 Ga0157370_10009965 3300013104 Bacteria 10055
278 Ga0157370_10079950 3300013104 Bacteria 3079
279 Ga0157370_10161449 3300013104 Bacteria 2085
280 Ga0157369_10019398 3300013105 Bacteria 7607
281 Ga0157369_10038758 3300013105 Bacteria 5210
282 Ga0157369_10112164 3300013105 Bacteria 2897
283 Ga0157369_10122279 3300013105 Bacteria 2761
284 Ga0157374_10007434 3300013296 Bacteria 9343
285 Ga0157374_10017139 3300013296 Bacteria 6376
286 Ga0157374_10074742 3300013296 Bacteria 3201
287 Ga0157374_10444695 3300013296 Bacteria 1297
288 Ga0157378_10014604 3300013297 Bacteria 6874
289 Ga0157378_10027501 3300013297 Bacteria 5018
290 Ga0157378_10040574 3300013297 Bacteria 4128
291 Ga0157378_10062812 3300013297 Bacteria 3318
292 Ga0157378_10078887 3300013297 Bacteria 2971
293 Ga0157378_10090003 3300013297 Bacteria 2788
294 Ga0157378_10103832 3300013297 Bacteria 2597
295 Ga0157378_10168521 3300013297 Unclassified 2052
296 Ga0157378_10213153 3300013297 Bacteria 1832
297 Ga0157378_10236885 3300013297 Bacteria 1742
298 Ga0163162_10000158 3300013306 Bacteria 62514
299 Ga0163162_10000634 3300013306 Bacteria 32545
300 Ga0163162_10014469 3300013306 Bacteria 7709
301 Ga0163162_10027000 3300013306 Bacteria 5677
302 Ga0163162_10032632 3300013306 Bacteria 5172
303 Ga0163162_10161372 3300013306 Bacteria 2363
304 Ga0163162_10182570 3300013306 Bacteria 2224
305 Ga0163162_10281540 3300013306 Bacteria 1795
306 Ga0163162_10284353 3300013306 Bacteria 1786
307 Ga0163162_10300979 3300013306 Bacteria 1736
308 Ga0157372_10003307 3300013307 Bacteria 17410
309 Ga0157372_10023311 3300013307 Bacteria 6709
310 Ga0157372_10028609 3300013307 Bacteria 6084
311 Ga0157372_10044826 3300013307 Bacteria 4902
312 Ga0157372_10057886 3300013307 Bacteria 4332
313 Ga0157372_10079493 3300013307 Bacteria 3709
314 Ga0157372_10103678 3300013307 Bacteria 3250
315 Ga0157372_10113417 3300013307 Bacteria 3106
316 Ga0157372_10121142 3300013307 Bacteria 3005
317 Ga0157372_10171813 3300013307 Bacteria 2508
318 Ga0157372_10188274 3300013307 Bacteria 2390
319 Ga0157372_10370771 3300013307 Bacteria 1668
320 Ga0157375_10000228 3300013308 Bacteria 52278
321 Ga0157375_10006929 3300013308 Bacteria 9893
322 Ga0157375_10015917 3300013308 Bacteria 6743
323 Ga0157375_10034238 3300013308 Bacteria 4837
324 Ga0157375_10113504 3300013308 Bacteria 2810
325 Ga0157375_10240628 3300013308 Bacteria 1969
326 Ga0157375_10465340 3300013308 Unclassified 1430
327 Ga0157375_10534880 3300013308 Bacteria 1334
328 Ga0157375_10737425 3300013308 Unclassified 1137
329 Ga0163163_10207135 3300014325 Unclassified 2010
330 Ga0163163_10220404 3300014325 Bacteria 1946
331 Ga0163163_10270216 3300014325 Bacteria 1751
332 Ga0157380_10000252 3300014326 Bacteria 32093
333 Ga0157380_10013322 3300014326 Bacteria 5992
334 Ga0157380_10396635 3300014326 Bacteria 1308
335 Ga0157380_10496555 3300014326 Bacteria 1184
336 Ga0157377_10000289 3300014745 Bacteria 23989
337 Ga0157377_10072704 3300014745 Bacteria 1991
338 Ga0157377_10093190 3300014745 Bacteria 1782
339 Ga0157377_10206829 3300014745 Bacteria 1249
340 Ga0157379_10001931 3300014968 Bacteria 17146
341 Ga0157379_10008718 3300014968 Bacteria 8837
342 Ga0157379_10076489 3300014968 Bacteria 2997
343 Ga0157379_10144753 3300014968 Bacteria 2143
344 Ga0157376_10000439 3300014969 Bacteria 26775
345 Ga0157376_10064270 3300014969 Bacteria 3094
346 Ga0157376_10083973 3300014969 Bacteria 2741
347 Ga0157376_10095992 3300014969 Bacteria 2579
348 Ga0157376_10139443 3300014969 Bacteria 2173
349 Ga0163161_10002200 3300017792 Bacteria 14068
350 Ga0163161_10036913 3300017792 Bacteria 3501
351 Ga0163161_10102302 3300017792 Bacteria 2133
352 Ga0163161_10380546 3300017792 Unclassified 1128
353 Ga0207426_1000192 3300025302 Bacteria 151680
354 Ga0207656_10039574 3300025321 Unclassified 1995
355 Ga0207656_10076077 3300025321 Unclassified 1501
356 Ga0207682_10041061 3300025893 Bacteria 1887
357 Ga0207682_10126321 3300025893 Bacteria 1138
358 Ga0207642_10031151 3300025899 Bacteria 2230
359 Ga0207710_10004222 3300025900 Bacteria 6296
360 Ga0207710_10004223 3300025900 Bacteria 6296
361 Ga0207680_10000181 3300025903 Bacteria 30852
362 Ga0207647_10170208 3300025904 Bacteria 1268
363 Ga0207645_10000354 3300025907 Bacteria 38157
364 Ga0207645_10091819 3300025907 Bacteria 1953
365 Ga0207643_10003608 3300025908 Bacteria 8342
366 Ga0207643_10021340 3300025908 Bacteria 3557
367 Ga0207705_10010065 3300025909 Bacteria 6883
368 Ga0207705_10053670 3300025909 Bacteria 2904
369 Ga0207705_10067765 3300025909 Bacteria 2583
370 Ga0207705_10173953 3300025909 Bacteria 1622
371 Ga0207654_10000479 3300025911 Bacteria 22913
372 Ga0207654_10125575 3300025911 Bacteria 1617
373 Ga0207707_10094651 3300025912 Bacteria 2610
374 Ga0207695_10006821 3300025913 Bacteria 14709
375 Ga0207671_10005924 3300025914 Bacteria 11082
376 Ga0207671_10079793 3300025914 Bacteria 2452
377 Ga0207660_10011947 3300025917 Bacteria 5668
378 Ga0207660_10017304 3300025917 Bacteria 4787
379 Ga0207660_10059071 3300025917 Bacteria 2752
380 Ga0207662_10137068 3300025918 Bacteria 1547
381 Ga0207657_10005867 3300025919 Bacteria 12792
382 Ga0207657_10010608 3300025919 Bacteria 9183
383 Ga0207657_10020438 3300025919 Bacteria 6256
384 Ga0207657_10023438 3300025919 Bacteria 5747
385 Ga0207649_10060571 3300025920 Bacteria 2379
386 Ga0207649_10079779 3300025920 Bacteria 2115
387 Ga0207652_10000010 3300025921 Bacteria 247079
388 Ga0207652_10000844 3300025921 Bacteria 29188
389 Ga0207652_10014339 3300025921 Bacteria 6418
390 Ga0207652_10044159 3300025921 Bacteria 3796
391 Ga0207652_10049340 3300025921 Bacteria 3603
392 Ga0207652_10153616 3300025921 Unclassified 2062
393 Ga0207681_10002677 3300025923 Bacteria 11289
394 Ga0207681_10206770 3300025923 Bacteria 1510
395 Ga0207681_10215680 3300025923 Bacteria 1482
396 Ga0207650_10026219 3300025925 Bacteria 4156
397 Ga0207650_10049518 3300025925 Bacteria 3103
398 Ga0207650_10055745 3300025925 Bacteria 2935
399 Ga0207650_10072482 3300025925 Bacteria 2592
400 Ga0207650_10148358 3300025925 Bacteria 1849
401 Ga0207650_10182982 3300025925 Bacteria 1671
402 Ga0207650_10223872 3300025925 Unclassified 1515
403 Ga0207659_10017243 3300025926 Bacteria 4714
404 Ga0207659_10065311 3300025926 Bacteria 2636
405 Ga0207659_10123525 3300025926 Bacteria 1987
406 Ga0207644_10011499 3300025931 Bacteria 5858
407 Ga0207644_10074079 3300025931 Bacteria 2498
408 Ga0207690_10006254 3300025932 Bacteria 7051
409 Ga0207690_10396476 3300025932 Unclassified 1100
410 Ga0207706_10004117 3300025933 Bacteria 13721
411 Ga0207706_10019199 3300025933 Bacteria 6147
412 Ga0207706_10030375 3300025933 Bacteria 4820
413 Ga0207706_10032095 3300025933 Bacteria 4677
414 Ga0207706_10119172 3300025933 Bacteria 2321
415 Ga0207686_10001204 3300025934 Bacteria 14998
416 Ga0207686_10004907 3300025934 Bacteria 7197
417 Ga0207686_10024746 3300025934 Bacteria 3483
418 Ga0207686_10043129 3300025934 Bacteria 2762
419 Ga0207670_10009484 3300025936 Bacteria 5556
420 Ga0207669_10133082 3300025937 Bacteria 1712
421 Ga0207704_10114916 3300025938 Bacteria 1828
422 Ga0207704_10327731 3300025938 Bacteria 1184
423 Ga0207704_10358185 3300025938 Bacteria 1138
424 Ga0207691_10008243 3300025940 Bacteria 10005
425 Ga0207691_10052281 3300025940 Bacteria 3731
426 Ga0207691_10064380 3300025940 Bacteria 3322
427 Ga0207691_10168047 3300025940 Unclassified 1922
428 Ga0207711_10112234 3300025941 Bacteria 2426
429 Ga0207711_10304036 3300025941 Unclassified 1471
430 Ga0207689_10001630 3300025942 Bacteria 21256
431 Ga0207689_10004925 3300025942 Bacteria 12028
432 Ga0207689_10017184 3300025942 Bacteria 6123
433 Ga0207689_10035703 3300025942 Bacteria 4128
434 Ga0207689_10047698 3300025942 Bacteria 3534
435 Ga0207689_10163592 3300025942 Bacteria 1833
436 Ga0207689_10167468 3300025942 Bacteria 1810
437 Ga0207689_10174095 3300025942 Unclassified 1775
438 Ga0207661_10000927 3300025944 Bacteria 19231
439 Ga0207679_10012496 3300025945 Bacteria 5538
440 Ga0207679_10069732 3300025945 Unclassified 2647
441 Ga0207679_10265258 3300025945 Bacteria 1466
442 Ga0207667_10001278 3300025949 Bacteria 31572
443 Ga0207667_10016684 3300025949 Bacteria 8288
444 Ga0207667_10055402 3300025949 Bacteria 4168
445 Ga0207667_10304562 3300025949 Bacteria 1628
446 Ga0207651_10036790 3300025960 Bacteria 3200
447 Ga0207651_10058610 3300025960 Bacteria 2662
448 Ga0207712_10001140 3300025961 Bacteria 18539
449 Ga0207712_10002540 3300025961 Bacteria 11739
450 Ga0207712_10010175 3300025961 Bacteria 5964
451 Ga0207712_10011532 3300025961 Bacteria 5633
452 Ga0207712_10014418 3300025961 Bacteria 5085
453 Ga0207712_10032957 3300025961 Bacteria 3499
454 Ga0207712_10195536 3300025961 Unclassified 1599
455 Ga0207668_10090972 3300025972 Bacteria 2241
456 Ga0207658_10036058 3300025986 Bacteria 3545
457 Ga0207658_10055445 3300025986 Bacteria 2937
458 Ga0207658_10137081 3300025986 Bacteria 1975
459 Ga0207677_10007101 3300026023 Bacteria 6166
460 Ga0207677_10105146 3300026023 Bacteria 2088
461 Ga0207677_10157248 3300026023 Bacteria 1762
462 Ga0207703_10028673 3300026035 Bacteria 4391
463 Ga0207703_10138152 3300026035 Bacteria 2112
464 Ga0207703_10251176 3300026035 Bacteria 1594
465 Ga0207639_10078272 3300026041 Bacteria 2609
466 Ga0207639_10148490 3300026041 Bacteria 1961
467 Ga0207639_10170403 3300026041 Unclassified 1843
468 Ga0207639_10351001 3300026041 Unclassified 1317
469 Ga0207639_10376460 3300026041 Unclassified 1274
470 Ga0207678_10105356 3300026067 Bacteria 2406
471 Ga0207678_10216477 3300026067 Unclassified 1639
472 Ga0207702_10061650 3300026078 Bacteria 3200
473 Ga0207641_10000152 3300026088 Bacteria 98311
474 Ga0207641_10008689 3300026088 Bacteria 8388
475 Ga0207641_10008722 3300026088 Bacteria 8374
476 Ga0207641_10630602 3300026088 Unclassified 1051
477 Ga0207648_10000404 3300026089 Bacteria 48036
478 Ga0207648_10020145 3300026089 Bacteria 6014
479 Ga0207648_10133294 3300026089 Bacteria 2187
480 Ga0207648_10288670 3300026089 Unclassified 1468
481 Ga0207648_10392622 3300026089 Bacteria 1256
482 Ga0207648_10394065 3300026089 Bacteria 1254
483 Ga0207676_10012515 3300026095 Bacteria 6082
484 Ga0207676_10040485 3300026095 Bacteria 3571
485 Ga0207676_10041652 3300026095 Bacteria 3527
486 Ga0207676_10090400 3300026095 Bacteria 2512
487 Ga0207674_10002719 3300026116 Bacteria 22062
488 Ga0207674_10011898 3300026116 Bacteria 9755
489 Ga0207674_10018664 3300026116 Bacteria 7534
490 Ga0207674_10059507 3300026116 Bacteria 3866
491 Ga0207674_10062365 3300026116 Unclassified 3765
492 Ga0207674_10292881 3300026116 Bacteria 1576
493 Ga0207674_10307711 3300026116 Bacteria 1534
494 Ga0207675_100000386 3300026118 Bacteria 42305
495 Ga0207675_100042508 3300026118 Bacteria 4244
496 Ga0207675_100285316 3300026118 Unclassified 1605
497 Ga0207683_10019452 3300026121 Bacteria 5798
498 Ga0207683_10121946 3300026121 Unclassified 2341
499 Ga0207698_10004716 3300026142 Bacteria 8340
500 Ga0207698_10044432 3300026142 Bacteria 3338
501 Ga0207698_10187073 3300026142 Bacteria 1840
502 Ga0207698_10542222 3300026142 Bacteria 1139
503 Ga0209974_10061366 3300027876 Bacteria 1272
504 Ga0268265_10007727 3300028380 Bacteria 7257
505 Ga0268265_10216922 3300028380 Bacteria 1671
506 Ga0268265_10587955 3300028380 Bacteria 1062
507 Ga0268264_10026350 3300028381 Bacteria 4749
508 Ga0268264_10026772 3300028381 Bacteria 4711
509 Ga0268264_10064722 3300028381 Bacteria 3078
510 Ga0268264_10077111 3300028381 Bacteria 2838
511 Ga0268264_10173325 3300028381 Bacteria 1953
512 Ga0268264_10463746 3300028381 Bacteria 1229
513 Ga0268264_10631983 3300028381 Unclassified 1058
514 Ga0307515_10000002 3300028794 Bacteria 1231751
515 Ga0307515_10000039 3300028794 Bacteria 323229
516 Ga0265327_10000148 3300031251 Bacteria 151952
517 Ga0307509_10065959 3300031507 Bacteria 3799
518 Ga0307509_10116023 3300031507 Bacteria 2668
519 Ga0307509_10222477 3300031507 Bacteria 1699
520 Ga0307408_100034355 3300031548 Unclassified 3552
521 Ga0307508_10002192 3300031616 Bacteria 20875
522 Ga0307409_100499783 3300031995 Unclassified 1184
523 Ga0307411_10393172 3300032005 Unclassified 1144
524 Ga0373937_0007249 3300036401 Bacteria 9595
525 Ga0395899_0001121 3300037312 Bacteria 23926
526 Ga0395899_0030989 3300037312 Bacteria 4021
527 Ga0395899_0043326 3300037312 Bacteria 3357
528 Ga0395899_0049843 3300037312 Bacteria 3111
529 Ga0395899_0212874 3300037312 Bacteria 1342
530 Ga0395900_0002932 3300037418 Bacteria 18581
531 Ga0395900_0027821 3300037418 Bacteria 5792
532 Ga0395900_0171226 3300037418 Bacteria 2210
533 Ga0395900_0410952 3300037418 Bacteria 1316
534 Ga0395898_0000488 3300037466 Bacteria 78598
535 Ga0395898_0087288 3300037466 Bacteria 3005
536 Ga0395898_0132617 3300037466 Bacteria 2385
537 Ga0395898_0224559 3300037466 Bacteria 1791
538 Ga0395905_0013318 3300037471 Bacteria 7885
539 Ga0395901_0017432 3300038443 Bacteria 7331
540 Ga0395901_0048123 3300038443 Bacteria 4428
541 Ga0395901_0070286 3300038443 Bacteria 3647
542 Ga0395901_0118359 3300038443 Bacteria 2783
543 Ga0436365_0763475 3300039437 Bacteria 1575
544 Ga0451807_1858500 3300041486 Bacteria 1037
545 Ga0451853_1924967 3300041512 Bacteria 2127
546 Ga0439442_002689 3300042002 Bacteria 3489
547 Ga0439449_0028544 3300042007 Bacteria 2080
548 Ga0439457_007434 3300042014 Bacteria 2628
549 Ga0439457_016275 3300042014 Bacteria 1658
550 Ga0450894_006152 3300042131 Unclassified 1552
551 Ga0451577_0003916 3300042876 Bacteria 16080
552 Ga0451577_0413567 3300042876 Unclassified 1224
553 Ga0466969_0000182 3300044656 Bacteria 33828
554 Ga0466972_0000003 3300044658 Bacteria 391452
555 Ga0466972_0000013 3300044658 Bacteria 229345
556 Ga0466966_0002356 3300044684 Bacteria 12337
557 Ga0453684_0196748 3300044712 Unclassified 2353
558 Ga0466968_0155307 3300044735 Bacteria 1053
559 Ga0466970_0005282 3300044765 Bacteria 6398
560 Ga0466957_0005877 3300044842 Bacteria 6915
561 Ga0466957_0041275 3300044842 Bacteria 2790
562 Ga0466960_0165842 3300044901 Bacteria 1189
563 Ga0466959_0000056 3300045049 Bacteria 78465
564 Ga0495638_0148638 3300046460 Bacteria 1361
565 Ga0495662_0241889 3300046476 Bacteria 889
566 Ga0495643_0051735 3300046522 Bacteria 2208
567 Ga0495586_0025349 3300046535 Bacteria 3173
568 Ga0495668_0001941 3300046616 Bacteria 18402
569 Ga0495634_0054074 3300046642 Bacteria 2688
570 Ga0495657_0150012 3300046675 Bacteria 1448
571 Ga0495672_0003160 3300047320 Bacteria 14328
572 Ga0495675_0139085 3300047444 Bacteria 1506
573 Ga0496100_0088291 3300048903 Bacteria 2110
574 Ga0496106_0214042 3300048909 Bacteria 1536
575 Ga0501033_0114448 3300049570 Bacteria 1961
576 Ga0501033_0116235 3300049570 Bacteria 1944
577 Ga0501034_0000225 3300049571 Bacteria 107163
578 Ga0501034_0198120 3300049571 Bacteria 1967
579 Ga0501034_0230992 3300049571 Bacteria 1799
580 Ga0501036_0018399 3300049572 Bacteria 5853
581 Ga0501038_0012074 3300049574 Bacteria 7888
582 Ga0501039_0042830 3300049575 Bacteria 3497
583 Ga0501043_0054946 3300049579 Bacteria 3128
584 Ga0501047_0096415 3300049581 Bacteria 2836
585 Ga0501047_0111446 3300049581 Bacteria 2619
586 Ga0501047_0219628 3300049581 Bacteria 1757
587 Ga0501070_0020003 3300049586 Bacteria 5613
588 Ga0501225_0008587 3300049705 Unclassified 2927
589 Ga0501225_0009684 3300049705 Bacteria 2739
590 Ga0501035_0316937 3300049822 Bacteria 1311
591 Ga0501044_0014310 3300049823 Bacteria 8564
592 Ga0501044_0073142 3300049823 Bacteria 3484
593 Ga0501044_0086018 3300049823 Bacteria 3177
594 Ga0501044_0249923 3300049823 Bacteria 1715
595 Ga0501284_00052 3300050005 Bacteria 43054
596 nmdc:mga0k408_110035_c1 3300050493 Bacteria 1628
597 nmdc:mga0k408_51648_c1 3300050493 Bacteria 2382
598 nmdc:mga05p37_111907_c1 3300050507 Bacteria 3357
599 nmdc:mga05p37_81860_c1 3300050507 Bacteria 3977
600 nmdc:mga09592_277513_c1 3300050508 Unclassified 1453
601 nmdc:mga09592_3366_c1 3300050508 Bacteria 12924
602 nmdc:mga06r32_46433_c1 3300050510 Bacteria 4144
603 nmdc:mga06r32_93166_c1 3300050510 Bacteria 2946
604 nmdc:mga08y16_12116_c1 3300050511 Bacteria 9062
605 nmdc:mga08y16_153967_c1 3300050511 Bacteria 2389
606 nmdc:mga08y16_251759_c1 3300050511 Unclassified 1825
607 nmdc:mga08y16_567117_c1 3300050511 Bacteria 1147
608 Ga0500578_0000150 3300053086 Bacteria 83541
609 Ga0500578_0010134 3300053086 Bacteria 6111
610 Ga0500646_0003524 3300053090 Bacteria 4013
611 Ga0500583_0000144 3300053092 Bacteria 30151
612 Ga0500583_0000785 3300053092 Bacteria 9200
613 Ga0500588_0067629 3300053146 Bacteria 1163
614 Ga0500622_0000337 3300053156 Bacteria 46048
615 Ga0500622_0059202 3300053156 Bacteria 1956
616 Ga0500636_0058789 3300053177 Bacteria 2247
617 Ga0500645_010633 3300053730 Bacteria 3033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10534880 Ga0157375_105348801 258
2 3300037418 Ga0395900_0410952 Ga0395900_0410952_494_1294 265
3 3300037312 Ga0395899_0212874 Ga0395899_0212874_30_842 269
4 3300042014 Ga0439457_016275 Ga0439457_016275_454_1344 272
5 3300046476 Ga0495662_0241889 Ga0495662_0241889_43_870 275
6 3300046460 Ga0495638_0148638 Ga0495638_0148638_148_1008 278
7 3300005457 Ga0070662_100070054 Ga0070662_1000700543 281
8 3300013102 Ga0157371_10177834 Ga0157371_101778342 281
9 3300013307 Ga0157372_10103678 Ga0157372_101036782 281
10 3300025907 Ga0207645_10091819 Ga0207645_100918192 281
11 3300025933 Ga0207706_10032095 Ga0207706_100320953 281
12 3300044656 Ga0466969_0000182 Ga0466969_0000182_25691_26626 284
13 3300005338 Ga0068868_100184491 Ga0068868_1001844912 287
14 3300025931 Ga0207644_10074079 Ga0207644_100740792 287
15 3300050511 nmdc:mga08y16_153967_c1 nmdc:mga08y16_153967_c1_1087_1950 287
16 3300041486 Ga0451807_1858500 Ga0451807_1858500_101_1021 290
17 3300009093 Ga0105240_10632131 Ga0105240_106321311 291
18 3300042002 Ga0439442_002689 Ga0439442_002689_1562_2515 291
19 3300042131 Ga0450894_006152 Ga0450894_006152_355_1251 293
20 3300005617 Ga0068859_100004526 Ga0068859_10000452610 294
21 3300006931 Ga0097620_100004526 Ga0097620_10000452610 294
22 3300009174 Ga0105241_10243239 Ga0105241_102432392 294
23 3300009545 Ga0105237_10005882 Ga0105237_100058823 294
24 3300010375 Ga0105239_10039464 Ga0105239_100394642 294
25 3300013102 Ga0157371_10413930 Ga0157371_104139301 294
26 3300013297 Ga0157378_10078887 Ga0157378_100788873 294
27 3300026142 Ga0207698_10542222 Ga0207698_105422221 294
28 3300013102 Ga0157371_10054078 Ga0157371_100540783 295
29 3300013105 Ga0157369_10112164 Ga0157369_101121642 295
30 3300013306 Ga0163162_10014469 Ga0163162_100144695 295
31 3300013307 Ga0157372_10057886 Ga0157372_100578864 295
32 3300025909 Ga0207705_10053670 Ga0207705_100536704 295
33 3300005334 Ga0068869_100276642 Ga0068869_1002766422 296
34 3300005841 Ga0068863_100314305 Ga0068863_1003143051 296
35 3300031616 Ga0307508_10002192 Ga0307508_1000219211 296
36 3300046522 Ga0495643_0051735 Ga0495643_0051735_220_1125 296
37 3300050005 Ga0501284_00052 Ga0501284_00052_21711_22628 296
38 3300046616 Ga0495668_0001941 Ga0495668_0001941_3974_4876 297
39 3300049823 Ga0501044_0073142 Ga0501044_0073142_895_1809 299
40 3300044658 Ga0466972_0000003 Ga0466972_0000003_182218_183129 300
41 3300044765 Ga0466970_0005282 Ga0466970_0005282_3786_4697 300
42 3300044901 Ga0466960_0165842 Ga0466960_0165842_118_1029 300
43 3300047320 Ga0495672_0003160 Ga0495672_0003160_12279_13193 300
44 3300005290 Ga0065712_10077630 Ga0065712_100776302 301
45 3300005293 Ga0065715_10005566 Ga0065715_100055663 301
46 3300005329 Ga0070683_100158225 Ga0070683_1001582253 301
47 3300005334 Ga0068869_100055657 Ga0068869_1000556574 301
48 3300005353 Ga0070669_100124832 Ga0070669_1001248322 301
49 3300005353 Ga0070669_100181644 Ga0070669_1001816441 301
50 3300005466 Ga0070685_10069690 Ga0070685_100696902 301
51 3300005471 Ga0070698_100000219 Ga0070698_10000021955 301
52 3300005471 Ga0070698_100025806 Ga0070698_1000258064 301
53 3300005549 Ga0070704_100225172 Ga0070704_1002251722 301
54 3300005577 Ga0068857_100419371 Ga0068857_1004193712 301
55 3300005617 Ga0068859_100071266 Ga0068859_1000712662 301
56 3300005617 Ga0068859_100105670 Ga0068859_1001056704 301
57 3300005617 Ga0068859_100120114 Ga0068859_1001201144 301
58 3300005719 Ga0068861_100001813 Ga0068861_1000018135 301
59 3300005840 Ga0068870_10041624 Ga0068870_100416242 301
60 3300005843 Ga0068860_100206597 Ga0068860_1002065972 301
61 3300006237 Ga0097621_100491160 Ga0097621_1004911602 301
62 3300006358 Ga0068871_100326494 Ga0068871_1003264942 301
63 3300006844 Ga0075428_100003382 Ga0075428_10000338216 301
64 3300006844 Ga0075428_100030666 Ga0075428_1000306666 301
65 3300006844 Ga0075428_100134618 Ga0075428_1001346183 301
66 3300006880 Ga0075429_100004591 Ga0075429_1000045912 301
67 3300006880 Ga0075429_100048056 Ga0075429_1000480562 301
68 3300006880 Ga0075429_100294899 Ga0075429_1002948991 301
69 3300006931 Ga0097620_100071265 Ga0097620_1000712654 301
70 3300006931 Ga0097620_100105667 Ga0097620_1001056674 301
71 3300006931 Ga0097620_100120114 Ga0097620_1001201144 301
72 3300009094 Ga0111539_10232439 Ga0111539_102324392 301
73 3300009147 Ga0114129_10029791 Ga0114129_100297916 301
74 3300009176 Ga0105242_10003805 Ga0105242_100038058 301
75 3300009176 Ga0105242_10071482 Ga0105242_100714822 301
76 3300009177 Ga0105248_10285162 Ga0105248_102851622 301
77 3300009553 Ga0105249_10002774 Ga0105249_100027749 301
78 3300009553 Ga0105249_10103085 Ga0105249_101030853 301
79 3300009553 Ga0105249_10301727 Ga0105249_103017272 301
80 3300009553 Ga0105249_10867196 Ga0105249_108671961 301
81 3300013105 Ga0157369_10122279 Ga0157369_101222793 301
82 3300013296 Ga0157374_10074742 Ga0157374_100747422 301
83 3300013306 Ga0163162_10300979 Ga0163162_103009792 301
84 3300013308 Ga0157375_10015917 Ga0157375_100159173 301
85 3300013308 Ga0157375_10737425 Ga0157375_107374251 301
86 3300014325 Ga0163163_10207135 Ga0163163_102071353 301
87 3300014326 Ga0157380_10013322 Ga0157380_100133222 301
88 3300014745 Ga0157377_10072704 Ga0157377_100727042 301
89 3300014968 Ga0157379_10076489 Ga0157379_100764892 301
90 3300025321 Ga0207656_10039574 Ga0207656_100395742 301
91 3300025893 Ga0207682_10041061 Ga0207682_100410612 301
92 3300025908 Ga0207643_10021340 Ga0207643_100213402 301
93 3300025918 Ga0207662_10137068 Ga0207662_101370682 301
94 3300025923 Ga0207681_10206770 Ga0207681_102067702 301
95 3300025923 Ga0207681_10215680 Ga0207681_102156802 301
96 3300025934 Ga0207686_10001204 Ga0207686_100012049 301
97 3300025934 Ga0207686_10043129 Ga0207686_100431292 301
98 3300025940 Ga0207691_10168047 Ga0207691_101680471 301
99 3300025942 Ga0207689_10047698 Ga0207689_100476982 301
100 3300025942 Ga0207689_10163592 Ga0207689_101635923 301
101 3300025960 Ga0207651_10058610 Ga0207651_100586101 301
102 3300025961 Ga0207712_10001140 Ga0207712_1000114015 301
103 3300025961 Ga0207712_10002540 Ga0207712_1000254013 301
104 3300026035 Ga0207703_10251176 Ga0207703_102511761 301
105 3300026088 Ga0207641_10008722 Ga0207641_100087227 301
106 3300026116 Ga0207674_10062365 Ga0207674_100623654 301
107 3300026118 Ga0207675_100042508 Ga0207675_1000425083 301
108 3300026121 Ga0207683_10121946 Ga0207683_101219463 301
109 3300028381 Ga0268264_10026772 Ga0268264_100267722 301
110 3300050507 nmdc:mga05p37_111907_c1 nmdc:mga05p37_111907_c1_864_1784 301
111 3300050508 nmdc:mga09592_277513_c1 nmdc:mga09592_277513_c1_232_1152 301
112 3300050508 nmdc:mga09592_3366_c1 nmdc:mga09592_3366_c1_1134_2057 301
113 3300050510 nmdc:mga06r32_93166_c1 nmdc:mga06r32_93166_c1_1058_1981 301
114 3300050511 nmdc:mga08y16_251759_c1 nmdc:mga08y16_251759_c1_601_1521 301
115 3300005459 Ga0068867_100129533 Ga0068867_1001295333 302
116 3300009101 Ga0105247_10003345 Ga0105247_100033458 302
117 3300025900 Ga0207710_10004223 Ga0207710_100042234 302
118 3300025961 Ga0207712_10014418 Ga0207712_100144186 302
119 3300028381 Ga0268264_10077111 Ga0268264_100771114 302
120 3300005329 Ga0070683_100000862 Ga0070683_10000086212 303
121 3300005337 Ga0070682_100001801 Ga0070682_1000018012 303
122 3300005344 Ga0070661_100001691 Ga0070661_10000169110 303
123 3300005364 Ga0070673_100465640 Ga0070673_1004656401 303
124 3300005366 Ga0070659_100008078 Ga0070659_1000080786 303
125 3300005535 Ga0070684_100003259 Ga0070684_1000032594 303
126 3300005539 Ga0068853_100339836 Ga0068853_1003398362 303
127 3300005564 Ga0070664_100013991 Ga0070664_1000139912 303
128 3300005577 Ga0068857_100022428 Ga0068857_1000224286 303
129 3300005616 Ga0068852_100581986 Ga0068852_1005819862 303
130 3300006358 Ga0068871_100362669 Ga0068871_1003626692 303
131 3300013297 Ga0157378_10040574 Ga0157378_100405742 303
132 3300013306 Ga0163162_10161372 Ga0163162_101613722 303
133 3300014969 Ga0157376_10095992 Ga0157376_100959922 303
134 3300017792 Ga0163161_10102302 Ga0163161_101023022 303
135 3300025920 Ga0207649_10060571 Ga0207649_100605713 303
136 3300025944 Ga0207661_10000927 Ga0207661_1000092711 303
137 3300025945 Ga0207679_10012496 Ga0207679_100124966 303
138 3300026116 Ga0207674_10002719 Ga0207674_1000271914 303
139 3300028794 Ga0307515_10000002 Ga0307515_10000002448 303
140 3300003322 rootL2_10184023 rootL2_101840232 304
141 3300005367 Ga0070667_100188766 Ga0070667_1001887662 304
142 3300025925 Ga0207650_10148358 Ga0207650_101483582 304
143 3300049571 Ga0501034_0000225 Ga0501034_0000225_69019_69948 304
144 3300005331 Ga0070670_100067808 Ga0070670_1000678082 305
145 3300005539 Ga0068853_100112192 Ga0068853_1001121922 305
146 3300005539 Ga0068853_100180505 Ga0068853_1001805052 305
147 3300005834 Ga0068851_10050281 Ga0068851_100502812 305
148 3300009553 Ga0105249_10055586 Ga0105249_100555862 305
149 3300013100 Ga0157373_10018157 Ga0157373_100181574 305
150 3300013102 Ga0157371_10007345 Ga0157371_100073458 305
151 3300014325 Ga0163163_10270216 Ga0163163_102702162 305
152 3300025321 Ga0207656_10076077 Ga0207656_100760771 305
153 3300025925 Ga0207650_10026219 Ga0207650_100262195 305
154 3300025961 Ga0207712_10011532 Ga0207712_100115325 305
155 3300026041 Ga0207639_10148490 Ga0207639_101484902 305
156 3300026041 Ga0207639_10170403 Ga0207639_101704031 305
157 3300028381 Ga0268264_10631983 Ga0268264_106319831 305
158 3300037418 Ga0395900_0027821 Ga0395900_0027821_571_1494 305
159 iso_pu_bacteria 2738541278 2738726446 305
160 iso_pu_bacteria 2818991444 2819590776 305
161 iso_pu_bacteria 2929154850 2929157808 305
162 3300005288 Ga0065714_10071790 Ga0065714_100717905 306
163 3300005366 Ga0070659_100121677 Ga0070659_1001216772 306
164 3300005530 Ga0070679_100164335 Ga0070679_1001643354 306
165 3300005563 Ga0068855_100015674 Ga0068855_1000156742 306
166 3300005563 Ga0068855_100212804 Ga0068855_1002128041 306
167 3300005578 Ga0068854_100181909 Ga0068854_1001819092 306
168 3300013102 Ga0157371_10003617 Ga0157371_100036175 306
169 3300013104 Ga0157370_10005999 Ga0157370_1000599910 306
170 3300013307 Ga0157372_10003307 Ga0157372_1000330711 306
171 3300025911 Ga0207654_10125575 Ga0207654_101255751 306
172 3300025913 Ga0207695_10006821 Ga0207695_1000682112 306
173 3300025932 Ga0207690_10396476 Ga0207690_103964761 306
174 3300025949 Ga0207667_10016684 Ga0207667_100166847 306
175 3300025949 Ga0207667_10304562 Ga0207667_103045621 306
176 3300037312 Ga0395899_0043326 Ga0395899_0043326_779_1720 306
177 3300037418 Ga0395900_0171226 Ga0395900_0171226_772_1698 306
178 3300037466 Ga0395898_0132617 Ga0395898_0132617_1187_2116 306
179 3300037466 Ga0395898_0224559 Ga0395898_0224559_513_1439 306
180 3300037471 Ga0395905_0013318 Ga0395905_0013318_3238_4179 306
181 3300038443 Ga0395901_0048123 Ga0395901_0048123_1944_2885 306
182 3300038443 Ga0395901_0070286 Ga0395901_0070286_672_1601 306
183 3300005327 Ga0070658_10042499 Ga0070658_100424994 307
184 3300005327 Ga0070658_10063887 Ga0070658_100638872 307
185 3300005327 Ga0070658_10074363 Ga0070658_100743633 307
186 3300005327 Ga0070658_10083412 Ga0070658_100834121 307
187 3300005327 Ga0070658_10200696 Ga0070658_102006962 307
188 3300005329 Ga0070683_100073584 Ga0070683_1000735843 307
189 3300005336 Ga0070680_100004942 Ga0070680_10000494213 307
190 3300005336 Ga0070680_100063974 Ga0070680_1000639743 307
191 3300005336 Ga0070680_100151852 Ga0070680_1001518522 307
192 3300005337 Ga0070682_100007803 Ga0070682_1000078035 307
193 3300005337 Ga0070682_100022879 Ga0070682_1000228793 307
194 3300005338 Ga0068868_100108878 Ga0068868_1001088782 307
195 3300005338 Ga0068868_100492669 Ga0068868_1004926691 307
196 3300005339 Ga0070660_100001807 Ga0070660_10000180714 307
197 3300005339 Ga0070660_100009507 Ga0070660_1000095072 307
198 3300005366 Ga0070659_100006693 Ga0070659_1000066936 307
199 3300005366 Ga0070659_100008332 Ga0070659_1000083327 307
200 3300005366 Ga0070659_100010915 Ga0070659_1000109156 307
201 3300005367 Ga0070667_100120221 Ga0070667_1001202212 307
202 3300005455 Ga0070663_100076860 Ga0070663_1000768602 307
203 3300005457 Ga0070662_100059767 Ga0070662_1000597676 307
204 3300005458 Ga0070681_10017972 Ga0070681_100179724 307
205 3300005458 Ga0070681_10162932 Ga0070681_101629322 307
206 3300005530 Ga0070679_100002696 Ga0070679_1000026966 307
207 3300005530 Ga0070679_100007239 Ga0070679_1000072398 307
208 3300005530 Ga0070679_100080128 Ga0070679_1000801282 307
209 3300005530 Ga0070679_100152045 Ga0070679_1001520452 307
210 3300005539 Ga0068853_100007345 Ga0068853_1000073457 307
211 3300005539 Ga0068853_100045401 Ga0068853_1000454012 307
212 3300005563 Ga0068855_100005487 Ga0068855_1000054877 307
213 3300005563 Ga0068855_100205792 Ga0068855_1002057922 307
214 3300005563 Ga0068855_100221014 Ga0068855_1002210142 307
215 3300005577 Ga0068857_100207829 Ga0068857_1002078292 307
216 3300005577 Ga0068857_100256507 Ga0068857_1002565071 307
217 3300005616 Ga0068852_100006019 Ga0068852_1000060198 307
218 3300005843 Ga0068860_100002572 Ga0068860_10000257213 307
219 3300005844 Ga0068862_100018106 Ga0068862_1000181065 307
220 3300009093 Ga0105240_10164323 Ga0105240_101643232 307
221 3300009174 Ga0105241_10320216 Ga0105241_103202162 307
222 3300009553 Ga0105249_10107760 Ga0105249_101077603 307
223 3300013100 Ga0157373_10031113 Ga0157373_100311135 307
224 3300013100 Ga0157373_10035635 Ga0157373_100356352 307
225 3300013100 Ga0157373_10082332 Ga0157373_100823324 307
226 3300013102 Ga0157371_10001955 Ga0157371_1000195518 307
227 3300013102 Ga0157371_10002374 Ga0157371_100023748 307
228 3300013102 Ga0157371_10003640 Ga0157371_100036402 307
229 3300013102 Ga0157371_10009513 Ga0157371_100095132 307
230 3300013102 Ga0157371_10011624 Ga0157371_100116245 307
231 3300013102 Ga0157371_10029334 Ga0157371_100293344 307
232 3300013102 Ga0157371_10098688 Ga0157371_100986882 307
233 3300013102 Ga0157371_10138042 Ga0157371_101380422 307
234 3300013104 Ga0157370_10009965 Ga0157370_100099658 307
235 3300013104 Ga0157370_10079950 Ga0157370_100799505 307
236 3300013104 Ga0157370_10161449 Ga0157370_101614492 307
237 3300013105 Ga0157369_10019398 Ga0157369_100193988 307
238 3300013105 Ga0157369_10038758 Ga0157369_100387582 307
239 3300013296 Ga0157374_10444695 Ga0157374_104446951 307
240 3300013306 Ga0163162_10182570 Ga0163162_101825702 307
241 3300013306 Ga0163162_10284353 Ga0163162_102843532 307
242 3300013307 Ga0157372_10023311 Ga0157372_100233114 307
243 3300013307 Ga0157372_10028609 Ga0157372_100286095 307
244 3300013307 Ga0157372_10044826 Ga0157372_100448266 307
245 3300013307 Ga0157372_10121142 Ga0157372_101211424 307
246 3300013307 Ga0157372_10171813 Ga0157372_101718132 307
247 3300025909 Ga0207705_10010065 Ga0207705_100100652 307
248 3300025909 Ga0207705_10067765 Ga0207705_100677653 307
249 3300025909 Ga0207705_10173953 Ga0207705_101739531 307
250 3300025912 Ga0207707_10094651 Ga0207707_100946514 307
251 3300025917 Ga0207660_10011947 Ga0207660_100119472 307
252 3300025917 Ga0207660_10017304 Ga0207660_100173044 307
253 3300025917 Ga0207660_10059071 Ga0207660_100590714 307
254 3300025919 Ga0207657_10005867 Ga0207657_100058678 307
255 3300025919 Ga0207657_10010608 Ga0207657_100106085 307
256 3300025919 Ga0207657_10020438 Ga0207657_100204382 307
257 3300025919 Ga0207657_10023438 Ga0207657_100234384 307
258 3300025921 Ga0207652_10000010 Ga0207652_1000001083 307
259 3300025921 Ga0207652_10000844 Ga0207652_1000084428 307
260 3300025921 Ga0207652_10014339 Ga0207652_100143395 307
261 3300025921 Ga0207652_10044159 Ga0207652_100441592 307
262 3300025921 Ga0207652_10049340 Ga0207652_100493401 307
263 3300025932 Ga0207690_10006254 Ga0207690_100062546 307
264 3300025933 Ga0207706_10004117 Ga0207706_1000411710 307
265 3300025942 Ga0207689_10174095 Ga0207689_101740951 307
266 3300025949 Ga0207667_10001278 Ga0207667_100012789 307
267 3300026023 Ga0207677_10157248 Ga0207677_101572481 307
268 3300026035 Ga0207703_10138152 Ga0207703_101381523 307
269 3300026041 Ga0207639_10078272 Ga0207639_100782723 307
270 3300026041 Ga0207639_10351001 Ga0207639_103510012 307
271 3300026067 Ga0207678_10105356 Ga0207678_101053564 307
272 3300026116 Ga0207674_10018664 Ga0207674_1001866410 307
273 3300026116 Ga0207674_10059507 Ga0207674_100595075 307
274 3300026142 Ga0207698_10004716 Ga0207698_100047162 307
275 3300026142 Ga0207698_10187073 Ga0207698_101870732 307
276 3300028380 Ga0268265_10216922 Ga0268265_102169222 307
277 3300028381 Ga0268264_10026350 Ga0268264_100263503 307
278 3300031251 Ga0265327_10000148 Ga0265327_1000014811 307
279 3300037312 Ga0395899_0001121 Ga0395899_0001121_13858_14802 307
280 3300037312 Ga0395899_0030989 Ga0395899_0030989_337_1278 307
281 3300037312 Ga0395899_0049843 Ga0395899_0049843_1406_2341 307
282 3300037418 Ga0395900_0002932 Ga0395900_0002932_14376_15320 307
283 3300037466 Ga0395898_0000488 Ga0395898_0000488_12586_13530 307
284 3300037466 Ga0395898_0087288 Ga0395898_0087288_1093_2034 307
285 3300038443 Ga0395901_0017432 Ga0395901_0017432_4516_5460 307
286 3300038443 Ga0395901_0118359 Ga0395901_0118359_1460_2401 307
287 3300039437 Ga0436365_0763475 Ga0436365_0763475_397_1335 307
288 3300042876 Ga0451577_0413567 Ga0451577_0413567_162_1094 307
289 3300049570 Ga0501033_0116235 Ga0501033_0116235_817_1749 307
290 3300049571 Ga0501034_0230992 Ga0501034_0230992_801_1733 307
291 3300049586 Ga0501070_0020003 Ga0501070_0020003_3418_4350 307
292 3300049822 Ga0501035_0316937 Ga0501035_0316937_298_1230 307
293 3300049823 Ga0501044_0086018 Ga0501044_0086018_858_1790 307
294 3300049823 Ga0501044_0249923 Ga0501044_0249923_766_1698 307
295 3300003203 JGI25406J46586_10000164 JGI25406J46586_100001645 308
296 3300005328 Ga0070676_10009111 Ga0070676_100091116 308
297 3300005329 Ga0070683_100050705 Ga0070683_1000507055 308
298 3300005331 Ga0070670_100037676 Ga0070670_1000376763 308
299 3300005334 Ga0068869_100022928 Ga0068869_1000229284 308
300 3300005334 Ga0068869_100127384 Ga0068869_1001273842 308
301 3300005335 Ga0070666_10005690 Ga0070666_100056905 308
302 3300005335 Ga0070666_10057201 Ga0070666_100572011 308
303 3300005338 Ga0068868_100010912 Ga0068868_1000109125 308
304 3300005338 Ga0068868_100043201 Ga0068868_1000432013 308
305 3300005344 Ga0070661_100037273 Ga0070661_1000372731 308
306 3300005347 Ga0070668_100189328 Ga0070668_1001893281 308
307 3300005353 Ga0070669_100026149 Ga0070669_1000261495 308
308 3300005355 Ga0070671_100222920 Ga0070671_1002229202 308
309 3300005356 Ga0070674_100050049 Ga0070674_1000500493 308
310 3300005364 Ga0070673_100049130 Ga0070673_1000491301 308
311 3300005365 Ga0070688_100301193 Ga0070688_1003011931 308
312 3300005367 Ga0070667_100011625 Ga0070667_1000116255 308
313 3300005367 Ga0070667_100079651 Ga0070667_1000796511 308
314 3300005438 Ga0070701_10171924 Ga0070701_101719242 308
315 3300005455 Ga0070663_100233894 Ga0070663_1002338941 308
316 3300005456 Ga0070678_100006600 Ga0070678_1000066005 308
317 3300005459 Ga0068867_100052640 Ga0068867_1000526402 308
318 3300005459 Ga0068867_100110302 Ga0068867_1001103023 308
319 3300005466 Ga0070685_10203156 Ga0070685_102031561 308
320 3300005530 Ga0070679_100057881 Ga0070679_1000578815 308
321 3300005539 Ga0068853_100246739 Ga0068853_1002467392 308
322 3300005539 Ga0068853_100258408 Ga0068853_1002584082 308
323 3300005543 Ga0070672_100041579 Ga0070672_1000415792 308
324 3300005544 Ga0070686_100019060 Ga0070686_1000190605 308
325 3300005548 Ga0070665_100049266 Ga0070665_1000492662 308
326 3300005563 Ga0068855_100067351 Ga0068855_1000673512 308
327 3300005577 Ga0068857_100277417 Ga0068857_1002774172 308
328 3300005614 Ga0068856_100050531 Ga0068856_1000505312 308
329 3300005617 Ga0068859_100497048 Ga0068859_1004970482 308
330 3300005718 Ga0068866_10033997 Ga0068866_100339974 308
331 3300005840 Ga0068870_10014000 Ga0068870_100140002 308
332 3300005841 Ga0068863_100169946 Ga0068863_1001699463 308
333 3300005985 Ga0081539_10000042 Ga0081539_10000042165 308
334 3300006358 Ga0068871_100203672 Ga0068871_1002036721 308
335 3300006931 Ga0097620_100497061 Ga0097620_1004970612 308
336 3300009176 Ga0105242_10038298 Ga0105242_100382984 308
337 3300013100 Ga0157373_10054349 Ga0157373_100543493 308
338 3300013100 Ga0157373_10130557 Ga0157373_101305572 308
339 3300013102 Ga0157371_10075177 Ga0157371_100751773 308
340 3300013296 Ga0157374_10007434 Ga0157374_100074345 308
341 3300013297 Ga0157378_10168521 Ga0157378_101685211 308
342 3300013297 Ga0157378_10236885 Ga0157378_102368852 308
343 3300013307 Ga0157372_10188274 Ga0157372_101882741 308
344 3300013308 Ga0157375_10006929 Ga0157375_100069296 308
345 3300014968 Ga0157379_10008718 Ga0157379_100087183 308
346 3300014969 Ga0157376_10139443 Ga0157376_101394432 308
347 3300017792 Ga0163161_10036913 Ga0163161_100369132 308
348 3300017792 Ga0163161_10380546 Ga0163161_103805461 308
349 3300025907 Ga0207645_10000354 Ga0207645_1000035439 308
350 3300025908 Ga0207643_10003608 Ga0207643_100036087 308
351 3300025914 Ga0207671_10079793 Ga0207671_100797932 308
352 3300025921 Ga0207652_10153616 Ga0207652_101536163 308
353 3300025926 Ga0207659_10065311 Ga0207659_100653114 308
354 3300025934 Ga0207686_10004907 Ga0207686_100049077 308
355 3300025934 Ga0207686_10024746 Ga0207686_100247462 308
356 3300025937 Ga0207669_10133082 Ga0207669_101330822 308
357 3300025940 Ga0207691_10008243 Ga0207691_1000824311 308
358 3300025942 Ga0207689_10017184 Ga0207689_100171844 308
359 3300025942 Ga0207689_10035703 Ga0207689_100357032 308
360 3300025949 Ga0207667_10055402 Ga0207667_100554024 308
361 3300025960 Ga0207651_10036790 Ga0207651_100367903 308
362 3300025986 Ga0207658_10055445 Ga0207658_100554452 308
363 3300026023 Ga0207677_10105146 Ga0207677_101051463 308
364 3300026067 Ga0207678_10216477 Ga0207678_102164772 308
365 3300026078 Ga0207702_10061650 Ga0207702_100616504 308
366 3300026088 Ga0207641_10630602 Ga0207641_106306021 308
367 3300026089 Ga0207648_10000404 Ga0207648_1000040444 308
368 3300026089 Ga0207648_10133294 Ga0207648_101332941 308
369 3300026089 Ga0207648_10392622 Ga0207648_103926222 308
370 3300026116 Ga0207674_10292881 Ga0207674_102928812 308
371 3300026118 Ga0207675_100285316 Ga0207675_1002853161 308
372 3300026121 Ga0207683_10019452 Ga0207683_100194526 308
373 3300028380 Ga0268265_10587955 Ga0268265_105879551 308
374 3300028381 Ga0268264_10064722 Ga0268264_100647222 308
375 3300028794 Ga0307515_10000039 Ga0307515_10000039151 308
376 3300044684 Ga0466966_0002356 Ga0466966_0002356_5845_6780 308
377 3300045049 Ga0466959_0000056 Ga0466959_0000056_37275_38210 308
378 3300046675 Ga0495657_0150012 Ga0495657_0150012_199_1140 308
379 3300049572 Ga0501036_0018399 Ga0501036_0018399_3493_4443 308
380 3300049575 Ga0501039_0042830 Ga0501039_0042830_144_1094 308
381 3300049823 Ga0501044_0014310 Ga0501044_0014310_2234_3184 308
382 3300050493 nmdc:mga0k408_110035_c1 nmdc:mga0k408_110035_c1_119_1051 308
383 3300053730 Ga0500645_010633 Ga0500645_010633_1692_2624 308
384 iso_pu_bacteria 2914759650 2914763820 308
385 3300003316 rootH1_10027226 rootH1_100272262 309
386 3300003323 rootH1_10130286 rootH1_101302861 309
387 3300005290 Ga0065712_10092087 Ga0065712_100920871 309
388 3300005328 Ga0070676_10014038 Ga0070676_100140384 309
389 3300005330 Ga0070690_100222626 Ga0070690_1002226261 309
390 3300005340 Ga0070689_100001483 Ga0070689_1000014836 309
391 3300005344 Ga0070661_100176582 Ga0070661_1001765822 309
392 3300005353 Ga0070669_100000458 Ga0070669_10000045818 309
393 3300005354 Ga0070675_100068217 Ga0070675_1000682173 309
394 3300005355 Ga0070671_100015312 Ga0070671_1000153125 309
395 3300005364 Ga0070673_100006930 Ga0070673_1000069308 309
396 3300005365 Ga0070688_100000687 Ga0070688_1000006878 309
397 3300005367 Ga0070667_100109669 Ga0070667_1001096694 309
398 3300005457 Ga0070662_100114618 Ga0070662_1001146181 309
399 3300005459 Ga0068867_100161277 Ga0068867_1001612772 309
400 3300005539 Ga0068853_100035993 Ga0068853_1000359932 309
401 3300005543 Ga0070672_100031816 Ga0070672_1000318165 309
402 3300005564 Ga0070664_100070880 Ga0070664_1000708804 309
403 3300005564 Ga0070664_100218172 Ga0070664_1002181722 309
404 3300005577 Ga0068857_100403430 Ga0068857_1004034302 309
405 3300005617 Ga0068859_100010347 Ga0068859_1000103478 309
406 3300005841 Ga0068863_100008194 Ga0068863_1000081949 309
407 3300005843 Ga0068860_100573171 Ga0068860_1005731711 309
408 3300005844 Ga0068862_100003547 Ga0068862_1000035473 309
409 3300006237 Ga0097621_100000063 Ga0097621_10000006348 309
410 3300006358 Ga0068871_100000251 Ga0068871_1000002519 309
411 3300006847 Ga0075431_100036042 Ga0075431_1000360422 309
412 3300006881 Ga0068865_100093559 Ga0068865_1000935592 309
413 3300006881 Ga0068865_100216827 Ga0068865_1002168272 309
414 3300006931 Ga0097620_100010347 Ga0097620_1000103478 309
415 3300009011 Ga0105251_10149762 Ga0105251_101497621 309
416 3300009094 Ga0111539_10006834 Ga0111539_1000683413 309
417 3300009094 Ga0111539_10032122 Ga0111539_100321227 309
418 3300009177 Ga0105248_10055021 Ga0105248_100550212 309
419 3300009553 Ga0105249_10014173 Ga0105249_100141732 309
420 3300010375 Ga0105239_10523822 Ga0105239_105238222 309
421 3300013297 Ga0157378_10014604 Ga0157378_100146047 309
422 3300013306 Ga0163162_10000158 Ga0163162_100001586 309
423 3300013306 Ga0163162_10032632 Ga0163162_100326324 309
424 3300013307 Ga0157372_10113417 Ga0157372_101134172 309
425 3300013308 Ga0157375_10000228 Ga0157375_100002286 309
426 3300013308 Ga0157375_10034238 Ga0157375_100342382 309
427 3300013308 Ga0157375_10113504 Ga0157375_101135043 309
428 3300014326 Ga0157380_10000252 Ga0157380_1000025227 309
429 3300014745 Ga0157377_10000289 Ga0157377_1000028923 309
430 3300014745 Ga0157377_10206829 Ga0157377_102068291 309
431 3300014968 Ga0157379_10001931 Ga0157379_100019315 309
432 3300014969 Ga0157376_10000439 Ga0157376_1000043923 309
433 3300017792 Ga0163161_10002200 Ga0163161_1000220014 309
434 3300025923 Ga0207681_10002677 Ga0207681_100026777 309
435 3300025925 Ga0207650_10055745 Ga0207650_100557453 309
436 3300025925 Ga0207650_10072482 Ga0207650_100724824 309
437 3300025926 Ga0207659_10017243 Ga0207659_100172434 309
438 3300025931 Ga0207644_10011499 Ga0207644_100114994 309
439 3300025933 Ga0207706_10019199 Ga0207706_100191997 309
440 3300025936 Ga0207670_10009484 Ga0207670_100094844 309
441 3300025938 Ga0207704_10327731 Ga0207704_103277311 309
442 3300025940 Ga0207691_10064380 Ga0207691_100643802 309
443 3300025941 Ga0207711_10112234 Ga0207711_101122342 309
444 3300025945 Ga0207679_10265258 Ga0207679_102652582 309
445 3300025961 Ga0207712_10032957 Ga0207712_100329574 309
446 3300025972 Ga0207668_10090972 Ga0207668_100909721 309
447 3300026089 Ga0207648_10394065 Ga0207648_103940652 309
448 3300026095 Ga0207676_10041652 Ga0207676_100416522 309
449 3300026116 Ga0207674_10011898 Ga0207674_100118986 309
450 3300026116 Ga0207674_10307711 Ga0207674_103077111 309
451 3300026118 Ga0207675_100000386 Ga0207675_1000003867 309
452 3300026142 Ga0207698_10044432 Ga0207698_100444324 309
453 3300027876 Ga0209974_10061366 Ga0209974_100613661 309
454 3300028380 Ga0268265_10007727 Ga0268265_100077277 309
455 3300028381 Ga0268264_10463746 Ga0268264_104637462 309
456 3300031507 Ga0307509_10065959 Ga0307509_100659594 309
457 3300031507 Ga0307509_10116023 Ga0307509_101160232 309
458 3300031548 Ga0307408_100034355 Ga0307408_1000343553 309
459 3300031995 Ga0307409_100499783 Ga0307409_1004997832 309
460 3300032005 Ga0307411_10393172 Ga0307411_103931721 309
461 3300041512 Ga0451853_1924967 Ga0451853_1924967_1178_2113 309
462 3300042007 Ga0439449_0028544 Ga0439449_0028544_423_1358 309
463 3300042014 Ga0439457_007434 Ga0439457_007434_331_1266 309
464 3300044658 Ga0466972_0000013 Ga0466972_0000013_4388_5323 309
465 3300044712 Ga0453684_0196748 Ga0453684_0196748_1151_2101 309
466 3300044842 Ga0466957_0005877 Ga0466957_0005877_4637_5674 309
467 3300044842 Ga0466957_0041275 Ga0466957_0041275_128_1105 309
468 3300048903 Ga0496100_0088291 Ga0496100_0088291_13_954 309
469 3300048909 Ga0496106_0214042 Ga0496106_0214042_387_1328 309
470 3300049570 Ga0501033_0114448 Ga0501033_0114448_902_1846 309
471 3300049571 Ga0501034_0198120 Ga0501034_0198120_688_1632 309
472 3300049574 Ga0501038_0012074 Ga0501038_0012074_2930_3874 309
473 3300049579 Ga0501043_0054946 Ga0501043_0054946_1364_2308 309
474 3300049581 Ga0501047_0096415 Ga0501047_0096415_1163_2107 309
475 3300049581 Ga0501047_0111446 Ga0501047_0111446_1439_2380 309
476 3300049705 Ga0501225_0008587 Ga0501225_0008587_944_1882 309
477 3300049705 Ga0501225_0009684 Ga0501225_0009684_1222_2166 309
478 3300050510 nmdc:mga06r32_46433_c1 nmdc:mga06r32_46433_c1_2482_3420 309
479 3300050511 nmdc:mga08y16_12116_c1 nmdc:mga08y16_12116_c1_2916_3860 309
480 3300053086 Ga0500578_0000150 Ga0500578_0000150_65336_66271 309
481 3300053086 Ga0500578_0010134 Ga0500578_0010134_2394_3353 309
482 3300053090 Ga0500646_0003524 Ga0500646_0003524_2832_3791 309
483 3300053092 Ga0500583_0000144 Ga0500583_0000144_4154_5101 309
484 3300053092 Ga0500583_0000785 Ga0500583_0000785_7812_8753 309
485 3300053146 Ga0500588_0067629 Ga0500588_0067629_66_1016 309
486 3300053156 Ga0500622_0000337 Ga0500622_0000337_33049_33981 309
487 3300053156 Ga0500622_0059202 Ga0500622_0059202_672_1607 309
488 3300053177 Ga0500636_0058789 Ga0500636_0058789_15_998 309
489 3300009094 Ga0111539_10260807 Ga0111539_102608073 310
490 3300014326 Ga0157380_10496555 Ga0157380_104965551 310
491 3300050493 nmdc:mga0k408_51648_c1 nmdc:mga0k408_51648_c1_1063_2043 310
492 3300050511 nmdc:mga08y16_567117_c1 nmdc:mga08y16_567117_c1_65_1006 310
493 3300005331 Ga0070670_100091083 Ga0070670_1000910833 311
494 3300005338 Ga0068868_100001540 Ga0068868_10000154012 311
495 3300005364 Ga0070673_100041630 Ga0070673_1000416305 311
496 3300005367 Ga0070667_100047282 Ga0070667_1000472823 311
497 3300005617 Ga0068859_100014457 Ga0068859_1000144575 311
498 3300005841 Ga0068863_100002125 Ga0068863_10000212513 311
499 3300005843 Ga0068860_100020290 Ga0068860_1000202902 311
500 3300006931 Ga0097620_100014457 Ga0097620_1000144576 311
501 3300009094 Ga0111539_10532279 Ga0111539_105322792 311
502 3300013297 Ga0157378_10027501 Ga0157378_100275012 311
503 3300013308 Ga0157375_10240628 Ga0157375_102406282 311
504 3300014326 Ga0157380_10396635 Ga0157380_103966352 311
505 3300025925 Ga0207650_10049518 Ga0207650_100495182 311
506 3300026023 Ga0207677_10007101 Ga0207677_100071015 311
507 3300026088 Ga0207641_10008689 Ga0207641_100086898 311
508 3300028381 Ga0268264_10173325 Ga0268264_101733252 311
509 3300005331 Ga0070670_100253266 Ga0070670_1002532661 313
510 3300005334 Ga0068869_100009985 Ga0068869_1000099854 313
511 3300005335 Ga0070666_10000028 Ga0070666_1000002840 313
512 3300005355 Ga0070671_100096968 Ga0070671_1000969682 313
513 3300005367 Ga0070667_100045885 Ga0070667_1000458855 313
514 3300005616 Ga0068852_100004976 Ga0068852_1000049766 313
515 3300005617 Ga0068859_100000012 Ga0068859_100000012222 313
516 3300005618 Ga0068864_100192521 Ga0068864_1001925212 313
517 3300005841 Ga0068863_100009422 Ga0068863_10000942210 313
518 3300005843 Ga0068860_100015531 Ga0068860_1000155315 313
519 3300005843 Ga0068860_100020230 Ga0068860_1000202302 313
520 3300006358 Ga0068871_100003922 Ga0068871_1000039228 313
521 3300006931 Ga0097620_100000012 Ga0097620_100000012222 313
522 3300009101 Ga0105247_10008343 Ga0105247_100083437 313
523 3300009174 Ga0105241_10000619 Ga0105241_100006199 313
524 3300009545 Ga0105237_10007560 Ga0105237_1000756010 313
525 3300009553 Ga0105249_10022623 Ga0105249_100226233 313
526 3300011119 Ga0105246_10016670 Ga0105246_100166705 313
527 3300011119 Ga0105246_10138938 Ga0105246_101389382 313
528 3300013297 Ga0157378_10062812 Ga0157378_100628124 313
529 3300013297 Ga0157378_10213153 Ga0157378_102131532 313
530 3300013306 Ga0163162_10000634 Ga0163162_100006342 313
531 3300013306 Ga0163162_10281540 Ga0163162_102815402 313
532 3300014325 Ga0163163_10220404 Ga0163163_102204042 313
533 3300014969 Ga0157376_10064270 Ga0157376_100642702 313
534 3300014969 Ga0157376_10083973 Ga0157376_100839732 313
535 3300025893 Ga0207682_10126321 Ga0207682_101263211 313
536 3300025899 Ga0207642_10031151 Ga0207642_100311513 313
537 3300025900 Ga0207710_10004222 Ga0207710_100042227 313
538 3300025903 Ga0207680_10000181 Ga0207680_1000018127 313
539 3300025911 Ga0207654_10000479 Ga0207654_100004798 313
540 3300025914 Ga0207671_10005924 Ga0207671_100059245 313
541 3300025925 Ga0207650_10223872 Ga0207650_102238721 313
542 3300025938 Ga0207704_10114916 Ga0207704_101149161 313
543 3300025942 Ga0207689_10001630 Ga0207689_1000163016 313
544 3300025942 Ga0207689_10167468 Ga0207689_101674682 313
545 3300025961 Ga0207712_10010175 Ga0207712_100101753 313
546 3300025986 Ga0207658_10036058 Ga0207658_100360582 313
547 3300026035 Ga0207703_10028673 Ga0207703_100286734 313
548 3300026088 Ga0207641_10000152 Ga0207641_1000015217 313
549 3300026089 Ga0207648_10020145 Ga0207648_100201455 313
550 3300026089 Ga0207648_10288670 Ga0207648_102886702 313
551 3300026095 Ga0207676_10090400 Ga0207676_100904002 313
552 3300031507 Ga0307509_10222477 Ga0307509_102224772 313
553 3300005356 Ga0070674_100076273 Ga0070674_1000762731 315
554 3300009147 Ga0114129_10015943 Ga0114129_100159433 315
555 3300042876 Ga0451577_0003916 Ga0451577_0003916_6964_7929 315
556 3300050507 nmdc:mga05p37_81860_c1 nmdc:mga05p37_81860_c1_1491_2498 315
557 3300010375 Ga0105239_10010863 Ga0105239_100108637 316
558 3300013307 Ga0157372_10370771 Ga0157372_103707712 316
559 3300044735 Ga0466968_0155307 Ga0466968_0155307_60_1034 316
560 3300049581 Ga0501047_0219628 Ga0501047_0219628_530_1513 317
561 3300005327 Ga0070658_10122131 Ga0070658_101221312 318
562 3300013297 Ga0157378_10090003 Ga0157378_100900034 318
563 3300005290 Ga0065712_10120338 Ga0065712_101203382 321
564 3300005329 Ga0070683_100013449 Ga0070683_1000134496 321
565 3300005331 Ga0070670_100075792 Ga0070670_1000757924 321
566 3300005331 Ga0070670_100181776 Ga0070670_1001817762 321
567 3300005340 Ga0070689_100004391 Ga0070689_1000043914 321
568 3300005340 Ga0070689_100011247 Ga0070689_1000112478 321
569 3300005354 Ga0070675_100172804 Ga0070675_1001728042 321
570 3300005364 Ga0070673_100127065 Ga0070673_1001270652 321
571 3300005455 Ga0070663_100241962 Ga0070663_1002419622 321
572 3300005457 Ga0070662_100058746 Ga0070662_1000587463 321
573 3300005466 Ga0070685_10005886 Ga0070685_100058865 321
574 3300005535 Ga0070684_100003664 Ga0070684_1000036643 321
575 3300005535 Ga0070684_100426108 Ga0070684_1004261081 321
576 3300005539 Ga0068853_100128855 Ga0068853_1001288551 321
577 3300005564 Ga0070664_100075700 Ga0070664_1000757003 321
578 3300005577 Ga0068857_100256662 Ga0068857_1002566622 321
579 3300005617 Ga0068859_100014474 Ga0068859_10001447411 321
580 3300005618 Ga0068864_100007320 Ga0068864_10000732010 321
581 3300005618 Ga0068864_100070017 Ga0068864_1000700172 321
582 3300005842 Ga0068858_100086356 Ga0068858_1000863562 321
583 3300005843 Ga0068860_100167093 Ga0068860_1001670932 321
584 3300006237 Ga0097621_100172927 Ga0097621_1001729272 321
585 3300006931 Ga0097620_100014474 Ga0097620_1000144742 321
586 3300009177 Ga0105248_10529940 Ga0105248_105299402 321
587 3300009177 Ga0105248_10602106 Ga0105248_106021062 321
588 3300010375 Ga0105239_10452514 Ga0105239_104525142 321
589 3300013102 Ga0157371_10196342 Ga0157371_101963422 321
590 3300013296 Ga0157374_10017139 Ga0157374_100171392 321
591 3300013297 Ga0157378_10103832 Ga0157378_101038323 321
592 3300013306 Ga0163162_10027000 Ga0163162_100270002 321
593 3300013308 Ga0157375_10465340 Ga0157375_104653402 321
594 3300014745 Ga0157377_10093190 Ga0157377_100931902 321
595 3300014968 Ga0157379_10144753 Ga0157379_101447532 321
596 3300025904 Ga0207647_10170208 Ga0207647_101702082 321
597 3300025920 Ga0207649_10079779 Ga0207649_100797793 321
598 3300025925 Ga0207650_10182982 Ga0207650_101829822 321
599 3300025926 Ga0207659_10123525 Ga0207659_101235252 321
600 3300025933 Ga0207706_10030375 Ga0207706_100303755 321
601 3300025933 Ga0207706_10119172 Ga0207706_101191721 321
602 3300025938 Ga0207704_10358185 Ga0207704_103581851 321
603 3300025940 Ga0207691_10052281 Ga0207691_100522813 321
604 3300025941 Ga0207711_10304036 Ga0207711_103040362 321
605 3300025942 Ga0207689_10004925 Ga0207689_100049254 321
606 3300025945 Ga0207679_10069732 Ga0207679_100697322 321
607 3300025961 Ga0207712_10195536 Ga0207712_101955362 321
608 3300025986 Ga0207658_10137081 Ga0207658_101370812 321
609 3300026041 Ga0207639_10376460 Ga0207639_103764602 321
610 3300026095 Ga0207676_10012515 Ga0207676_100125158 321
611 3300026095 Ga0207676_10040485 Ga0207676_100404855 321
612 3300036401 Ga0373937_0007249 Ga0373937_0007249_7276_8280 321
613 3300046535 Ga0495586_0025349 Ga0495586_0025349_196_1200 321
614 3300046642 Ga0495634_0054074 Ga0495634_0054074_335_1339 321
615 3300047444 Ga0495675_0139085 Ga0495675_0139085_295_1299 321
616 3300001979 JGI24740J21852_10029687 JGI24740J21852_100296872 324
617 3300003354 JGI25160J50197_1000890 JGI25160J50197_100089012 324
618 3300009545 Ga0105237_10009852 Ga0105237_100098523 324
619 3300010375 Ga0105239_10015270 Ga0105239_100152703 324
620 3300013307 Ga0157372_10079493 Ga0157372_100794934 324
621 3300025302 Ga0207426_1000192 Ga0207426_100019293 324

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ek9-assembly1.cif.gz_A crystal structure of the class a carbapenemase crh-1 in complex with avibactam at 1.4 angstrom resolution 0.7261 275 318
5gla-assembly2.cif.gz_B crystal structure of the class a beta-lactamase penl-ttr10 containing 10 residues insertion in omega-loop 0.6859 272 321
6w2z-assembly1.cif.gz_A crystal structure of the beta lactamase class a penp from bacillus subtilis in the complex with the non-beta- lactam beta-lactamase inhibitor avibactam 0.6691 271 321
5ghz-assembly2.cif.gz_A "crystal structure of beta-lactamase penp mutant-e166h in complex with cephaloridine as ""pre-deacylation"" intermediate" 0.6662 271 318
5zfl-assembly2.cif.gz_B crystal structure of beta-lactamase penp mutant e166y 0.6656 271 318
ID Description Score Start End Superfamily
1s2eB03 Mainly Beta;Sandwich;Immunoglobulin-like;4-oxalocrotonate tautomerase-like 0.6666 82 131 2.60.40.1680
2v20A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.6307 271 318 3.40.710.10
5hx9A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.5959 279 318 3.40.710.10
1bsgA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.5904 277 318 3.40.710.10
2j7vB01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.5824 279 318 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A5P2G4W1-F1-model_v4 Uncharacterized protein 0.9822 32 322
AF-A0A3S0FUU5-F1-model_v4 deleted 0.981 35 323
AF-A0A352CGW2-F1-model_v4 Outer membrane lipoprotein-sorting protein 0.9735 47 323
AF-A0A3D1RCJ2-F1-model_v4 DUF3108 domain-containing protein 0.9713 34 323
AF-A0A5B8VQE6-F1-model_v4 DUF4138 domain-containing protein 0.9697 54 323

Feature Viewer

pLDDT pTM Quality
82.37 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map