F470019

General Info

Members Datasets Scaffolds Average Seq Length
621 319 1242 120

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1210291|Ga0436365_1210291_358_795
Length 145
Sequence LIEHDLFGTPLHIFPDLALARKSEIIMYDHIGIKVGNLDAAVRFYNAALAPLGFVLCSKDENGAGFGPRGEPALWLYLHKGLKSTGAHIAFRAPDHAAIGKFHAEGLKAGGRDNGAAGHRHDYSPTYYAAFLLDPDGNNVEAVCT

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
174 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
303 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
304 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
305 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
306 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
307 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
308 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
311 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
312 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
313 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
314 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
315 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
316 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
317 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 0
Rhizoplane 4.67
Rhizosphere 84.06
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1210291 3300039437 Bacteria 1054
2 CNXas_1013313 3300000545 Bacteria 588
3 JGI25404J52841_10104965 3300003659 Bacteria 593
4 Ga0070676_10258019 3300005328 Archaea 1166
5 Ga0070683_100007874 3300005329 Bacteria 9027
6 Ga0070683_100322451 3300005329 Bacteria 1470
7 Ga0070683_100464552 3300005329 Bacteria 1208
8 Ga0070690_100000520 3300005330 Bacteria 19295
9 Ga0068869_100001979 3300005334 Bacteria 12300
10 Ga0068869_100057606 3300005334 Bacteria 2837
11 Ga0070680_100012823 3300005336 Bacteria 6519
12 Ga0070680_100072385 3300005336 Bacteria 2833
13 Ga0070680_100117172 3300005336 Bacteria 2221
14 Ga0070680_100164470 3300005336 Bacteria 1865
15 Ga0070682_100005808 3300005337 Bacteria 6891
16 Ga0068868_100365991 3300005338 Bacteria 1238
17 Ga0068868_101711386 3300005338 Archaea 593
18 Ga0070689_100008610 3300005340 Bacteria 7194
19 Ga0070689_100424748 3300005340 Bacteria 1127
20 Ga0070691_10035318 3300005341 Bacteria 2353
21 Ga0070691_10451536 3300005341 Bacteria 734
22 Ga0070687_101344923 3300005343 Unclassified 532
23 Ga0070692_10117639 3300005345 Bacteria 1478
24 Ga0070669_101467261 3300005353 Unclassified 593
25 Ga0070675_102081881 3300005354 Bacteria 523
26 Ga0070674_100055925 3300005356 Bacteria 2735
27 Ga0070709_10045495 3300005434 Bacteria 2724
28 Ga0070709_10054145 3300005434 Bacteria 2528
29 Ga0070709_10058827 3300005434 Bacteria 2439
30 Ga0070709_10159822 3300005434 Bacteria 1565
31 Ga0070709_10551570 3300005434 Bacteria 882
32 Ga0070709_10657670 3300005434 Bacteria 812
33 Ga0070714_100020976 3300005435 Bacteria 5342
34 Ga0070714_100045350 3300005435 Bacteria 3726
35 Ga0070714_100352922 3300005435 Bacteria 1382
36 Ga0070714_100440313 3300005435 Bacteria 1237
37 Ga0070713_100008786 3300005436 Bacteria 7189
38 Ga0070713_100034323 3300005436 Bacteria 4074
39 Ga0070713_100099921 3300005436 Bacteria 2511
40 Ga0070710_10017401 3300005437 Bacteria 3677
41 Ga0070710_10053580 3300005437 Bacteria 2273
42 Ga0070710_10094198 3300005437 Bacteria 1772
43 Ga0070710_10249718 3300005437 Bacteria 1140
44 Ga0070701_10382420 3300005438 Unclassified 887
45 Ga0070711_100009819 3300005439 Bacteria 5902
46 Ga0070711_100025299 3300005439 Bacteria 3882
47 Ga0070711_100039443 3300005439 Bacteria 3181
48 Ga0070700_100001891 3300005441 Bacteria 10585
49 Ga0070694_100253682 3300005444 Bacteria 1332
50 Ga0070708_100077284 3300005445 Bacteria 3008
51 Ga0070678_100011776 3300005456 Bacteria 5410
52 Ga0070678_100060009 3300005456 Bacteria 2798
53 Ga0070681_10006383 3300005458 Bacteria 11463
54 Ga0070681_10053156 3300005458 Bacteria 4036
55 Ga0068867_100012320 3300005459 Bacteria 6049
56 Ga0068867_100102051 3300005459 Bacteria 2192
57 Ga0068867_100713321 3300005459 Bacteria 886
58 Ga0070698_100109783 3300005471 Bacteria 2725
59 Ga0070679_100010254 3300005530 Bacteria 8883
60 Ga0070679_100725836 3300005530 Archaea 936
61 Ga0070684_100005660 3300005535 Bacteria 9599
62 Ga0070684_100132082 3300005535 Bacteria 2252
63 Ga0070684_100962883 3300005535 Bacteria 800
64 Ga0070697_100282310 3300005536 Bacteria 1425
65 Ga0068853_100256634 3300005539 Bacteria 1606
66 Ga0068853_100264298 3300005539 Bacteria 1583
67 Ga0068853_101031919 3300005539 Bacteria 792
68 Ga0068853_102154130 3300005539 Bacteria 541
69 Ga0070672_100106235 3300005543 Bacteria 2284
70 Ga0070686_100000809 3300005544 Bacteria 18125
71 Ga0070686_101265270 3300005544 Bacteria 615
72 Ga0070686_101808715 3300005544 Bacteria 520
73 Ga0070696_100007810 3300005546 Bacteria 7141
74 Ga0070693_100001065 3300005547 Bacteria 12260
75 Ga0070665_100206658 3300005548 Bacteria 1964
76 Ga0070665_100700332 3300005548 Bacteria 1026
77 Ga0070665_102149040 3300005548 Bacteria 562
78 Ga0070704_100022030 3300005549 Bacteria 4140
79 Ga0070704_101404219 3300005549 Bacteria 641
80 Ga0068855_100182911 3300005563 Bacteria 2369
81 Ga0068855_102178721 3300005563 Bacteria 557
82 Ga0068857_100378652 3300005577 Bacteria 1314
83 Ga0068857_100889102 3300005577 Bacteria 854
84 Ga0068857_101226828 3300005577 Bacteria 727
85 Ga0068854_100386628 3300005578 Bacteria 1154
86 Ga0068854_100499849 3300005578 Unclassified 1024
87 Ga0068854_100546570 3300005578 Bacteria 982
88 Ga0068854_101037198 3300005578 Bacteria 728
89 Ga0068856_100335471 3300005614 Bacteria 1530
90 Ga0068856_102717536 3300005614 Bacteria 500
91 Ga0070702_100000187 3300005615 Bacteria 20119
92 Ga0068852_100546428 3300005616 Unclassified 1158
93 Ga0068859_100004925 3300005617 Bacteria 13579
94 Ga0068859_100015117 3300005617 Bacteria 7745
95 Ga0068864_100879621 3300005618 Bacteria 884
96 Ga0068866_10003262 3300005718 Bacteria 6679
97 Ga0068866_10159391 3300005718 Bacteria 1314
98 Ga0068866_10659748 3300005718 Bacteria 713
99 Ga0068861_100094471 3300005719 Bacteria 2366
100 Ga0068861_100130853 3300005719 Bacteria 2037
101 Ga0068861_100430406 3300005719 Bacteria 1178
102 Ga0068861_100657555 3300005719 Unclassified 969
103 Ga0068870_10107271 3300005840 Bacteria 1589
104 Ga0068870_10220321 3300005840 Bacteria 1161
105 Ga0068863_100018212 3300005841 Bacteria 6725
106 Ga0068863_100025663 3300005841 Bacteria 5620
107 Ga0068863_100067577 3300005841 Bacteria 3381
108 Ga0068858_100202971 3300005842 Bacteria 1875
109 Ga0068860_100069604 3300005843 Bacteria 3345
110 Ga0068860_100095360 3300005843 Bacteria 2836
111 Ga0068860_100179268 3300005843 Bacteria 2048
112 Ga0068860_100250064 3300005843 Bacteria 1726
113 Ga0068862_100358362 3300005844 Bacteria 1355
114 Ga0081455_10053285 3300005937 Bacteria 3456
115 Ga0081540_1047428 3300005983 Bacteria 2161
116 Ga0070717_10018039 3300006028 Bacteria 5505
117 Ga0070717_10040252 3300006028 Bacteria 3806
118 Ga0070717_10365234 3300006028 Bacteria 1293
119 Ga0070717_10718654 3300006028 Bacteria 908
120 Ga0070715_10004259 3300006163 Bacteria 4670
121 Ga0070715_10158294 3300006163 Bacteria 1117
122 Ga0070715_10784110 3300006163 Bacteria 577
123 Ga0070716_100092037 3300006173 Bacteria 1838
124 Ga0070716_100207090 3300006173 Bacteria 1308
125 Ga0070716_100310627 3300006173 Bacteria 1100
126 Ga0070716_100469751 3300006173 Bacteria 921
127 Ga0070712_100135313 3300006175 Bacteria 1873
128 Ga0070712_100307527 3300006175 Bacteria 1285
129 Ga0070712_100749737 3300006175 Bacteria 835
130 Ga0097621_100011876 3300006237 Bacteria 6439
131 Ga0097621_100087358 3300006237 Bacteria 2603
132 Ga0097621_100462293 3300006237 Bacteria 1145
133 Ga0097621_100654713 3300006237 Bacteria 964
134 Ga0068871_100005584 3300006358 Bacteria 8817
135 Ga0068871_100010987 3300006358 Bacteria 6632
136 Ga0068871_101425885 3300006358 Bacteria 653
137 Ga0075428_100000800 3300006844 Bacteria 32816
138 Ga0075428_100595940 3300006844 Bacteria 1180
139 Ga0075430_100421563 3300006846 Unclassified 1101
140 Ga0075434_100021715 3300006871 Bacteria 6243
141 Ga0075434_100192900 3300006871 Bacteria 2058
142 Ga0075434_101923748 3300006871 Bacteria 597
143 Ga0075429_100566451 3300006880 Unclassified 995
144 Ga0075429_100738205 3300006880 Unclassified 862
145 Ga0068865_100000472 3300006881 Bacteria 22488
146 Ga0068865_100584574 3300006881 Bacteria 942
147 Ga0075436_100063046 3300006914 Bacteria 2562
148 Ga0075436_100558055 3300006914 Bacteria 841
149 Ga0097620_100004925 3300006931 Bacteria 13579
150 Ga0097620_100015118 3300006931 Bacteria 7745
151 Ga0075435_100078640 3300007076 Bacteria 2705
152 Ga0075435_101841999 3300007076 Bacteria 531
153 Ga0099794_10006878 3300007265 Bacteria 4635
154 Ga0099794_10383745 3300007265 Bacteria 733
155 Ga0099795_10146301 3300007788 Bacteria 964
156 Ga0105240_10157251 3300009093 Bacteria 2702
157 Ga0105240_10364267 3300009093 Bacteria 1636
158 Ga0105240_10740235 3300009093 Bacteria 1070
159 Ga0111539_10138859 3300009094 Bacteria 2846
160 Ga0111539_10153000 3300009094 Bacteria 2700
161 Ga0105245_10010755 3300009098 Bacteria 7962
162 Ga0105245_10085386 3300009098 Bacteria 2893
163 Ga0105245_10307133 3300009098 Bacteria 1558
164 Ga0105245_10479935 3300009098 Bacteria 1256
165 Ga0105247_10016547 3300009101 Bacteria 4421
166 Ga0105247_10069422 3300009101 Bacteria 2199
167 Ga0114129_10176040 3300009147 Bacteria 2914
168 Ga0114129_10586488 3300009147 Bacteria 1446
169 Ga0105243_10003964 3300009148 Bacteria 11809
170 Ga0105243_10705626 3300009148 Bacteria 984
171 Ga0105241_10070774 3300009174 Bacteria 2707
172 Ga0105241_10144240 3300009174 Bacteria 1942
173 Ga0105241_10314374 3300009174 Bacteria 1348
174 Ga0105241_10586983 3300009174 Bacteria 1005
175 Ga0105241_10877955 3300009174 Bacteria 831
176 Ga0105242_10015993 3300009176 Bacteria 5831
177 Ga0105242_10900480 3300009176 Bacteria 885
178 Ga0105242_11556875 3300009176 Bacteria 693
179 Ga0105242_12356419 3300009176 Unclassified 579
180 Ga0105248_10056592 3300009177 Bacteria 4399
181 Ga0105248_10194476 3300009177 Bacteria 2285
182 Ga0105248_11222396 3300009177 Bacteria 850
183 Ga0105237_10018218 3300009545 Bacteria 7266
184 Ga0105237_10179345 3300009545 Bacteria 2118
185 Ga0105237_12626599 3300009545 Bacteria 514
186 Ga0105238_10122043 3300009551 Bacteria 2585
187 Ga0105238_10133587 3300009551 Bacteria 2459
188 Ga0105238_10206116 3300009551 Bacteria 1942
189 Ga0105238_10233336 3300009551 Unclassified 1816
190 Ga0105238_10465576 3300009551 Bacteria 1262
191 Ga0105238_10670914 3300009551 Bacteria 1048
192 Ga0105238_10817753 3300009551 Bacteria 948
193 Ga0105249_10038619 3300009553 Bacteria 4332
194 Ga0105249_13447426 3300009553 Unclassified 509
195 Ga0105239_10025278 3300010375 Bacteria 6539
196 Ga0105239_10106728 3300010375 Bacteria 3102
197 Ga0105239_10128586 3300010375 Bacteria 2816
198 Ga0105239_10144971 3300010375 Bacteria 2648
199 Ga0105239_11056568 3300010375 Bacteria 934
200 Ga0105239_11443857 3300010375 Bacteria 794
201 Ga0105246_10042499 3300011119 Bacteria 3079
202 Ga0105246_10723434 3300011119 Bacteria 875
203 Ga0105246_11078949 3300011119 Bacteria 732
204 Ga0105246_12274572 3300011119 Bacteria 529
205 Ga0157370_10079771 3300013104 Bacteria 3082
206 Ga0157370_10789468 3300013104 Bacteria 864
207 Ga0157370_11852195 3300013104 Bacteria 541
208 Ga0157369_10011139 3300013105 Bacteria 10224
209 Ga0157369_10040500 3300013105 Bacteria 5085
210 Ga0157369_10077837 3300013105 Bacteria 3554
211 Ga0157369_10434092 3300013105 Bacteria 1361
212 Ga0157369_11285932 3300013105 Bacteria 746
213 Ga0157374_10042167 3300013296 Bacteria 4209
214 Ga0157374_10127074 3300013296 Bacteria 2465
215 Ga0157374_10199680 3300013296 Bacteria 1958
216 Ga0157378_10008257 3300013297 Bacteria 9077
217 Ga0157378_10312586 3300013297 Bacteria 1524
218 Ga0157378_10403649 3300013297 Bacteria 1347
219 Ga0163162_10059776 3300013306 Bacteria 3844
220 Ga0163162_10308380 3300013306 Bacteria 1715
221 Ga0163162_12120030 3300013306 Bacteria 645
222 Ga0157372_10082060 3300013307 Bacteria 3649
223 Ga0157372_10095562 3300013307 Bacteria 3386
224 Ga0157372_10437522 3300013307 Bacteria 1524
225 Ga0157372_11071195 3300013307 Bacteria 933
226 Ga0157372_11287152 3300013307 Bacteria 844
227 Ga0157375_10010533 3300013308 Bacteria 8140
228 Ga0157375_10029287 3300013308 Bacteria 5176
229 Ga0163163_10025688 3300014325 Bacteria 5616
230 Ga0163163_10069915 3300014325 Bacteria 3495
231 Ga0163163_12166550 3300014325 Bacteria 615
232 Ga0157380_10002026 3300014326 Bacteria 13526
233 Ga0157380_10133821 3300014326 Bacteria 2119
234 Ga0157379_10041137 3300014968 Bacteria 4126
235 Ga0157379_10051283 3300014968 Bacteria 3686
236 Ga0157376_10012486 3300014969 Bacteria 6307
237 Ga0206354_10065062 3300020081 Bacteria 709
238 Ga0213874_10260639 3300021377 Bacteria 642
239 Ga0213875_10096129 3300021388 Bacteria 1382
240 Ga0209677_112180 3300025253 Bacteria 1293
241 Ga0209233_1013063 3300025261 Bacteria 2384
242 Ga0207653_10386110 3300025885 Unclassified 548
243 Ga0207692_10000982 3300025898 Bacteria 10396
244 Ga0207692_10320168 3300025898 Bacteria 949
245 Ga0207642_10009463 3300025899 Bacteria 3391
246 Ga0207642_10080821 3300025899 Bacteria 1578
247 Ga0207642_10082145 3300025899 Bacteria 1568
248 Ga0207710_10055854 3300025900 Bacteria 1781
249 Ga0207680_10577869 3300025903 Unclassified 803
250 Ga0207647_10083566 3300025904 Bacteria 1912
251 Ga0207685_10012114 3300025905 Bacteria 2620
252 Ga0207685_10012295 3300025905 Bacteria 2607
253 Ga0207699_10014409 3300025906 Bacteria 4075
254 Ga0207699_10015197 3300025906 Bacteria 3994
255 Ga0207699_10048790 3300025906 Bacteria 2488
256 Ga0207699_10091990 3300025906 Bacteria 1906
257 Ga0207645_10180703 3300025907 Bacteria 1384
258 Ga0207643_10108472 3300025908 Bacteria 1634
259 Ga0207643_10355555 3300025908 Unclassified 920
260 Ga0207684_10071103 3300025910 Bacteria 2957
261 Ga0207684_10206664 3300025910 Bacteria 1694
262 Ga0207654_10076191 3300025911 Bacteria 2007
263 Ga0207654_10309268 3300025911 Bacteria 1077
264 Ga0207654_10453512 3300025911 Bacteria 899
265 Ga0207654_11171238 3300025911 Bacteria 560
266 Ga0207654_11283305 3300025911 Bacteria 534
267 Ga0207707_10000712 3300025912 Bacteria 33048
268 Ga0207707_10107916 3300025912 Bacteria 2434
269 Ga0207707_10125433 3300025912 Bacteria 2245
270 Ga0207695_10111118 3300025913 Bacteria 2720
271 Ga0207695_10505153 3300025913 Bacteria 1091
272 Ga0207671_10082204 3300025914 Bacteria 2417
273 Ga0207671_10123062 3300025914 Bacteria 1984
274 Ga0207693_10012383 3300025915 Bacteria 6890
275 Ga0207693_10024727 3300025915 Bacteria 4763
276 Ga0207693_10300022 3300025915 Bacteria 1258
277 Ga0207663_10005664 3300025916 Bacteria 6316
278 Ga0207663_10039548 3300025916 Bacteria 2858
279 Ga0207663_10045464 3300025916 Bacteria 2701
280 Ga0207663_10138222 3300025916 Bacteria 1694
281 Ga0207660_10154698 3300025917 Bacteria 1765
282 Ga0207660_10302969 3300025917 Bacteria 1273
283 Ga0207660_10600663 3300025917 Bacteria 896
284 Ga0207660_11626303 3300025917 Bacteria 520
285 Ga0207662_10081952 3300025918 Bacteria 1970
286 Ga0207662_10978225 3300025918 Bacteria 600
287 Ga0207652_10006317 3300025921 Bacteria 9570
288 Ga0207652_10278947 3300025921 Bacteria 1507
289 Ga0207652_10658161 3300025921 Archaea 936
290 Ga0207694_10042484 3300025924 Bacteria 3506
291 Ga0207694_10254716 3300025924 Bacteria 1437
292 Ga0207694_10996040 3300025924 Bacteria 709
293 Ga0207687_10008733 3300025927 Bacteria 6620
294 Ga0207687_10269127 3300025927 Bacteria 1361
295 Ga0207687_10330977 3300025927 Bacteria 1235
296 Ga0207700_10056048 3300025928 Bacteria 2965
297 Ga0207700_10152638 3300025928 Bacteria 1910
298 Ga0207700_10182456 3300025928 Bacteria 1758
299 Ga0207700_10264874 3300025928 Bacteria 1473
300 Ga0207700_10529539 3300025928 Bacteria 1044
301 Ga0207664_10023025 3300025929 Bacteria 4662
302 Ga0207664_10085237 3300025929 Bacteria 2578
303 Ga0207664_10921452 3300025929 Bacteria 784
304 Ga0207664_10944169 3300025929 Bacteria 774
305 Ga0207664_11029066 3300025929 Bacteria 738
306 Ga0207644_10858948 3300025931 Bacteria 760
307 Ga0207706_10299796 3300025933 Unclassified 1400
308 Ga0207686_10019826 3300025934 Bacteria 3832
309 Ga0207686_10643017 3300025934 Unclassified 838
310 Ga0207709_10003691 3300025935 Bacteria 9013
311 Ga0207709_10090521 3300025935 Bacteria 1998
312 Ga0207709_10246574 3300025935 Bacteria 1302
313 Ga0207670_10564696 3300025936 Archaea 931
314 Ga0207670_11050723 3300025936 Bacteria 686
315 Ga0207669_10154753 3300025937 Bacteria 1611
316 Ga0207704_10003752 3300025938 Bacteria 6915
317 Ga0207704_11577598 3300025938 Bacteria 564
318 Ga0207665_10005299 3300025939 Bacteria 8618
319 Ga0207665_10012384 3300025939 Bacteria 5603
320 Ga0207665_10060939 3300025939 Bacteria 2556
321 Ga0207665_10520158 3300025939 Bacteria 921
322 Ga0207691_10118995 3300025940 Bacteria 2343
323 Ga0207711_10850230 3300025941 Archaea 849
324 Ga0207711_11044996 3300025941 Bacteria 757
325 Ga0207711_11210487 3300025941 Bacteria 697
326 Ga0207689_10000764 3300025942 Bacteria 30878
327 Ga0207689_10000778 3300025942 Bacteria 30607
328 Ga0207661_10007684 3300025944 Bacteria 7671
329 Ga0207661_10027631 3300025944 Bacteria 4336
330 Ga0207667_10151928 3300025949 Bacteria 2383
331 Ga0207712_10940543 3300025961 Bacteria 765
332 Ga0207668_11456936 3300025972 Unclassified 618
333 Ga0207640_10438949 3300025981 Bacteria 1073
334 Ga0207658_10765561 3300025986 Bacteria 875
335 Ga0207677_10423492 3300026023 Archaea 1134
336 Ga0207703_10014255 3300026035 Bacteria 6199
337 Ga0207703_10132019 3300026035 Bacteria 2158
338 Ga0207639_10183417 3300026041 Bacteria 1782
339 Ga0207639_10223351 3300026041 Bacteria 1628
340 Ga0207639_10343259 3300026041 Bacteria 1332
341 Ga0207639_10855254 3300026041 Unclassified 849
342 Ga0207639_11195844 3300026041 Bacteria 713
343 Ga0207708_10000350 3300026075 Bacteria 36165
344 Ga0207708_10886572 3300026075 Bacteria 772
345 Ga0207702_10328975 3300026078 Bacteria 1457
346 Ga0207641_10018929 3300026088 Bacteria 5649
347 Ga0207641_10073364 3300026088 Bacteria 2949
348 Ga0207648_10000730 3300026089 Bacteria 36815
349 Ga0207648_10122537 3300026089 Bacteria 2286
350 Ga0207648_10354134 3300026089 Bacteria 1324
351 Ga0207676_10538343 3300026095 Bacteria 1114
352 Ga0207674_10080874 3300026116 Bacteria 3252
353 Ga0207674_10250082 3300026116 Bacteria 1720
354 Ga0207674_10474711 3300026116 Bacteria 1209
355 Ga0207674_10573726 3300026116 Bacteria 1090
356 Ga0207674_10783349 3300026116 Bacteria 920
357 Ga0207675_100000407 3300026118 Bacteria 41288
358 Ga0207675_100109499 3300026118 Bacteria 2606
359 Ga0207675_100773886 3300026118 Bacteria 972
360 Ga0207683_10043680 3300026121 Bacteria 3917
361 Ga0207683_10049466 3300026121 Bacteria 3680
362 Ga0207698_10668249 3300026142 Bacteria 1031
363 Ga0207698_10981997 3300026142 Bacteria 855
364 Ga0209179_1121038 3300027512 Bacteria 584
365 Ga0209588_1002800 3300027671 Bacteria 4774
366 Ga0207428_10508609 3300027907 Bacteria 874
367 Ga0268266_10152394 3300028379 Bacteria 2085
368 Ga0268266_10276006 3300028379 Unclassified 1562
369 Ga0268266_11922888 3300028379 Bacteria 565
370 Ga0268265_10020069 3300028380 Unclassified 4659
371 Ga0268265_10137388 3300028380 Bacteria 2041
372 Ga0268264_10044738 3300028381 Bacteria 3673
373 Ga0268264_10091516 3300028381 Bacteria 2624
374 Ga0268264_10296808 3300028381 Bacteria 1520
375 Ga0268264_11132453 3300028381 Bacteria 791
376 Ga0307511_10099969 3300030521 Bacteria 1911
377 Ga0307509_10136507 3300031507 Bacteria 2397
378 Ga0307509_10440846 3300031507 Bacteria 998
379 Ga0307508_10000046 3300031616 Bacteria 139709
380 Ga0307508_10030615 3300031616 Bacteria 4864
381 Ga0307508_10235815 3300031616 Bacteria 1427
382 Ga0307508_10362271 3300031616 Bacteria 1041
383 Ga0307516_10019968 3300031730 Bacteria 6926
384 Ga0307516_10064332 3300031730 Bacteria 3547
385 Ga0307516_10180582 3300031730 Bacteria 1844
386 Ga0307405_11025879 3300031731 Bacteria 705
387 Ga0307412_10209279 3300031911 Bacteria 1487
388 Ga0307416_100154972 3300032002 Bacteria 2108
389 Ga0307411_11675639 3300032005 Bacteria 588
390 Ga0307507_10059519 3300033179 Bacteria 3575
391 Ga0307507_10221272 3300033179 Bacteria 1272
392 Ga0307510_10227846 3300033180 Bacteria 1369
393 Ga0307510_10303796 3300033180 Bacteria 1057
394 Ga0316212_1060804 3300033547 Bacteria 544
395 Ga0373958_0140369 3300034819 Bacteria 598
396 Ga0373926_0031180 3300035083 Bacteria 1879
397 Ga0373934_0065100 3300035086 Bacteria 1455
398 Ga0373944_0000134 3300035089 Bacteria 14160
399 Ga0373952_0198133 3300035092 Bacteria 587
400 Ga0373936_0006476 3300035113 Bacteria 4417
401 Ga0373939_0119887 3300035114 Unclassified 927
402 Ga0373945_0016493 3300035116 Bacteria 2492
403 Ga0373945_0025832 3300035116 Bacteria 2043
404 Ga0373945_0145758 3300035116 Bacteria 957
405 Ga0373953_0023099 3300035117 Bacteria 2352
406 Ga0373953_0398609 3300035117 Bacteria 606
407 Ga0373957_0110514 3300035120 Bacteria 1107
408 Ga0373943_0055907 3300035170 Bacteria 1956
409 Ga0373943_0062572 3300035170 Bacteria 1863
410 Ga0373943_0114748 3300035170 Bacteria 1425
411 Ga0373946_0127794 3300035171 Bacteria 1166
412 Ga0373955_0043129 3300035172 Bacteria 2425
413 Ga0373924_0040407 3300035410 Bacteria 1909
414 Ga0373931_0041176 3300035691 Bacteria 2426
415 Ga0373935_0003204 3300035692 Bacteria 9445
416 Ga0373935_0051160 3300035692 Bacteria 2623
417 Ga0373927_0030091 3300035695 Bacteria 3542
418 Ga0373927_0030687 3300035695 Bacteria 3506
419 Ga0373927_0154566 3300035695 Bacteria 1502
420 Ga0373927_0895994 3300035695 Bacteria 585
421 Ga0373933_0000498 3300035724 Bacteria 24445
422 Ga0373933_0452847 3300035724 Bacteria 839
423 Ga0373933_0736688 3300035724 Bacteria 648
424 Ga0373947_0076225 3300035725 Bacteria 2066
425 Ga0373947_0171339 3300035725 Bacteria 1408
426 Ga0373947_0302324 3300035725 Bacteria 1067
427 Ga0373947_0589761 3300035725 Bacteria 757
428 Ga0373937_0047523 3300036401 Bacteria 3927
429 Ga0373937_0087773 3300036401 Bacteria 2879
430 Ga0373937_0091001 3300036401 Bacteria 2826
431 Ga0372808_037409 3300036459 Bacteria 696
432 Ga0373925_0062940 3300037068 Bacteria 2790
433 Ga0373925_0192844 3300037068 Bacteria 1617
434 Ga0373925_0806441 3300037068 Bacteria 774
435 Ga0373925_0975212 3300037068 Bacteria 698
436 Ga0395899_0122532 3300037312 Bacteria 1861
437 Ga0395899_0879130 3300037312 Bacteria 548
438 Ga0395900_0117233 3300037418 Bacteria 2732
439 Ga0395898_0034349 3300037466 Bacteria 5055
440 Ga0436364_1394792 3300037853 Bacteria 1732
441 Ga0395901_0084822 3300038443 Bacteria 3311
442 Ga0436365_1029628 3300039437 Bacteria 1436
443 Ga0436365_1534544 3300039437 Bacteria 1214
444 Ga0436365_1701929 3300039437 Bacteria 1530
445 Ga0436365_1814703 3300039437 Bacteria 754
446 Ga0436360_1250359 3300039438 Bacteria 1285
447 Ga0436363_0170348 3300039450 Bacteria 1191
448 Ga0436363_0516386 3300039450 Bacteria 1157
449 Ga0436363_1381581 3300039450 Bacteria 9461
450 Ga0439458_0045286 3300042157 Bacteria 1076
451 Ga0466969_0234190 3300044656 Bacteria 834
452 Ga0466965_0015874 3300044683 Bacteria 3577
453 Ga0466966_0004344 3300044684 Bacteria 9346
454 Ga0466963_0430908 3300044694 Bacteria 930
455 Ga0466964_0001005 3300044706 Bacteria 9360
456 Ga0466964_0181144 3300044706 Bacteria 999
457 Ga0466971_0457304 3300044719 Bacteria 626
458 Ga0466968_0606584 3300044735 Bacteria 553
459 Ga0466970_0015120 3300044765 Bacteria 3969
460 Ga0466970_0165851 3300044765 Bacteria 1223
461 Ga0466957_0132884 3300044842 Bacteria 1596
462 Ga0466957_1253077 3300044842 Unclassified 537
463 Ga0466959_0009218 3300045049 Bacteria 7011
464 Ga0466959_0064415 3300045049 Bacteria 2661
465 Ga0451576_0001512 3300045051 Bacteria 39177
466 Ga0466967_0038196 3300045976 Bacteria 4116
467 Ga0466967_0355919 3300045976 Bacteria 1418
468 Ga0466967_0782004 3300045976 Bacteria 947
469 Ga0466967_1009713 3300045976 Bacteria 828
470 Ga0495603_0006373 3300046455 Bacteria 7059
471 Ga0495629_0278935 3300046459 Bacteria 1147
472 Ga0495641_0148029 3300046461 Bacteria 1049
473 Ga0495651_0620420 3300046462 Bacteria 680
474 Ga0495653_0456466 3300046463 Bacteria 803
475 Ga0495580_0013387 3300046472 Bacteria 6262
476 Ga0495580_0145868 3300046472 Bacteria 1640
477 Ga0495582_0024443 3300046473 Bacteria 3306
478 Ga0495639_0042736 3300046475 Bacteria 2045
479 Ga0495662_0098581 3300046476 Bacteria 1429
480 Ga0495664_0011282 3300046477 Bacteria 5035
481 Ga0495664_0471835 3300046477 Bacteria 750
482 Ga0495594_0471145 3300046499 Bacteria 714
483 Ga0495594_0543525 3300046499 Bacteria 659
484 Ga0495606_0170539 3300046507 Bacteria 1263
485 Ga0495628_0876025 3300046516 Bacteria 624
486 Ga0495630_0110486 3300046517 Bacteria 2082
487 Ga0495666_0076961 3300046526 Bacteria 1581
488 Ga0495666_0113208 3300046526 Bacteria 1274
489 Ga0495652_0841350 3300046529 Bacteria 608
490 Ga0495665_0010436 3300046531 Bacteria 5026
491 Ga0495665_0172681 3300046531 Bacteria 1125
492 Ga0495665_0214122 3300046531 Bacteria 997
493 Ga0495640_0037112 3300046533 Bacteria 3440
494 Ga0495640_0273233 3300046533 Bacteria 1054
495 Ga0495586_0118334 3300046535 Bacteria 1479
496 Ga0495587_0102570 3300046536 Bacteria 1647
497 Ga0495598_0003082 3300046537 Bacteria 3507
498 Ga0495621_0526024 3300046539 Bacteria 512
499 Ga0495645_0257933 3300046543 Bacteria 1156
500 Ga0495622_0014208 3300046557 Bacteria 3698
501 Ga0495659_0536871 3300046664 Bacteria 515
502 Ga0495588_0111332 3300046674 Bacteria 1442
503 Ga0495599_0108834 3300046678 Bacteria 1727
504 Ga0495623_0290156 3300046679 Bacteria 907
505 Ga0495647_0006138 3300046681 Bacteria 3963
506 Ga0495647_0039186 3300046681 Bacteria 1795
507 Ga0495658_0327819 3300046683 Bacteria 971
508 Ga0495613_0223551 3300046689 Bacteria 1321
509 Ga0495613_0356528 3300046689 Bacteria 1004
510 Ga0495624_0107380 3300046690 Bacteria 1717
511 Ga0495649_0378587 3300046694 Bacteria 712
512 Ga0495600_0389260 3300046809 Bacteria 869
513 Ga0495581_0037182 3300047315 Bacteria 2816
514 Ga0495674_0062725 3300047319 Bacteria 3235
515 Ga0495684_0003117 3300047471 Bacteria 13012
516 Ga0495593_0040381 3300047673 Bacteria 2512
517 Ga0495602_1014646 3300048088 Bacteria 547
518 Ga0496100_0381707 3300048903 Bacteria 1070
519 Ga0496100_0864873 3300048903 Bacteria 709
520 Ga0496102_0239285 3300048905 Bacteria 1712
521 Ga0496103_0734978 3300048906 Bacteria 625
522 Ga0496104_0001065 3300048907 Bacteria 23417
523 Ga0496104_0854493 3300048907 Bacteria 815
524 Ga0496104_0858939 3300048907 Bacteria 813
525 Ga0496105_0046874 3300048908 Bacteria 3567
526 Ga0496106_0000545 3300048909 Bacteria 26754
527 Ga0496106_0345405 3300048909 Bacteria 1195
528 Ga0496107_0063981 3300048910 Bacteria 2666
529 Ga0496107_0065815 3300048910 Bacteria 2628
530 Ga0496108_0174088 3300048911 Bacteria 1862
531 Ga0496108_0228397 3300048911 Bacteria 1618
532 Ga0496109_0199262 3300048912 Bacteria 1882
533 Ga0496110_0091506 3300048913 Bacteria 2721
534 Ga0496110_0603307 3300048913 Bacteria 996
535 Ga0496111_0014832 3300048914 Bacteria 5334
536 Ga0496111_0216907 3300048914 Bacteria 1421
537 Ga0496112_0048014 3300048915 Bacteria 4187
538 Ga0496112_0258541 3300048915 Bacteria 1691
539 Ga0496112_0321231 3300048915 Bacteria 1492
540 Ga0496113_0211772 3300048916 Bacteria 1543
541 Ga0496114_0388452 3300048917 Bacteria 1236
542 Ga0496115_0006510 3300048918 Bacteria 8561
543 Ga0496115_0562940 3300048918 Bacteria 910
544 Ga0496115_0903133 3300048918 Bacteria 681
545 Ga0496115_0931989 3300048918 Bacteria 668
546 Ga0496115_1439093 3300048918 Bacteria 507
547 Ga0496116_0268580 3300048919 Bacteria 835
548 Ga0496117_0058855 3300048920 Bacteria 2659
549 Ga0496118_0004149 3300048921 Bacteria 17505
550 Ga0496121_0000261 3300048924 Bacteria 110085
551 Ga0496121_0044163 3300048924 Bacteria 3849
552 Ga0496121_0101886 3300048924 Bacteria 2213
553 Ga0496121_0315306 3300048924 Bacteria 1055
554 Ga0496122_0249224 3300048925 Bacteria 995
555 Ga0496124_0001094 3300048927 Bacteria 42597
556 Ga0496125_0000420 3300048928 Bacteria 78930
557 Ga0496125_0028406 3300048928 Bacteria 5053
558 Ga0496126_0027647 3300048929 Bacteria 5414
559 Ga0496126_0049881 3300048929 Bacteria 3819
560 Ga0496126_0093537 3300048929 Bacteria 2639
561 Ga0496126_0149982 3300048929 Bacteria 1999
562 Ga0496126_0232444 3300048929 Bacteria 1544
563 Ga0501031_0964801 3300049568 Bacteria 545
564 Ga0501032_0372292 3300049569 Bacteria 919
565 Ga0501034_0076041 3300049571 Bacteria 3365
566 Ga0501042_0222072 3300049578 Bacteria 1363
567 Ga0501047_0048501 3300049581 Bacteria 4101
568 Ga0501068_0377006 3300049584 Bacteria 913
569 Ga0501070_0075665 3300049586 Bacteria 2787
570 Ga0501073_0042882 3300049589 Bacteria 3192
571 Ga0501073_0292324 3300049589 Bacteria 1124
572 Ga0501074_0117107 3300049590 Bacteria 1906
573 Ga0501080_0027647 3300049742 Bacteria 5274
574 Ga0501080_1711401 3300049742 Bacteria 530
575 Ga0501035_0530948 3300049822 Bacteria 966
576 Ga0501044_0114392 3300049823 Bacteria 2704
577 nmdc:mga05p37_691481_c1 3300050507 Bacteria 1135
578 nmdc:mga09592_246702_c1 3300050508 Bacteria 1548
579 nmdc:mga09592_95012_c1 3300050508 Bacteria 2550
580 nmdc:mga0qj67_970529_c1 3300050509 Unclassified 668
581 nmdc:mga06r32_1301777_c1 3300050510 Unclassified 671
582 nmdc:mga06r32_572040_c1 3300050510 Bacteria 1103
583 nmdc:mga08y16_118006_c1 3300050511 Bacteria 2761
584 nmdc:mga08y16_131598_c1 3300050511 Bacteria 2601
585 nmdc:mga0n895_12052_c1 3300050512 Bacteria 7739
586 nmdc:mga0n895_1527958_c1 3300050512 Bacteria 633
587 nmdc:mga0n895_208763_c1 3300050512 Bacteria 1983
588 nmdc:mga0rr50_723496_c1 3300050513 Bacteria 849
589 nmdc:mga08x19_278791_c1 3300050514 Bacteria 1158
590 nmdc:mga08x19_531121_c1 3300050514 Bacteria 832
591 Ga0495601_0137030 3300053077 Bacteria 1596
592 Ga0495612_0061731 3300053078 Bacteria 1553
593 Ga0500635_0013257 3300053080 Bacteria 2390
594 Ga0500635_0099553 3300053080 Bacteria 1067
595 Ga0495619_0626515 3300053085 Bacteria 735
596 Ga0500578_0432559 3300053086 Bacteria 752
597 Ga0500644_0031754 3300053088 Bacteria 1682
598 Ga0500647_0282064 3300053091 Bacteria 717
599 Ga0500647_0426831 3300053091 Bacteria 530
600 Ga0500651_0255272 3300053093 Bacteria 1018
601 Ga0500651_0435231 3300053093 Bacteria 732
602 Ga0500566_0000095 3300053094 Bacteria 44474
603 Ga0500566_0180716 3300053094 Bacteria 1082
604 Ga0500640_080304 3300053095 Bacteria 1384
605 Ga0500614_021055 3300053123 Bacteria 1510
606 Ga0500559_0304301 3300053136 Bacteria 748
607 Ga0500603_007331 3300053150 Bacteria 2419
608 Ga0500603_038658 3300053150 Bacteria 1264
609 Ga0500622_0078590 3300053156 Bacteria 1655
610 Ga0500638_089832 3300053162 Bacteria 1448
611 Ga0500639_130729 3300053163 Bacteria 1190
612 Ga0500636_0078558 3300053177 Bacteria 1904
613 Ga0500636_0122416 3300053177 Bacteria 1458
614 Ga0500636_0177283 3300053177 Bacteria 1147
615 Ga0500636_0187613 3300053177 Bacteria 1104
616 Ga0500576_123767 3300053725 Bacteria 1014
617 Ga0500657_094341 3300053728 Bacteria 1251
618 Ga0500596_004897 3300053735 Bacteria 2412
619 Ga0501084_0603275 3300054114 Bacteria 928
620 Ga0466962_0075784 3300061719 Bacteria 1607
621 Ga0466962_0569838 3300061719 Bacteria 576
622 Ga0436365_1210291
623 CNXas_1013313
624 JGI25404J52841_10104965
625 Ga0070676_10258019
626 Ga0070683_100007874
627 Ga0070683_100322451
628 Ga0070683_100464552
629 Ga0070690_100000520
630 Ga0068869_100001979
631 Ga0068869_100057606
632 Ga0070680_100012823
633 Ga0070680_100072385
634 Ga0070680_100117172
635 Ga0070680_100164470
636 Ga0070682_100005808
637 Ga0068868_100365991
638 Ga0068868_101711386
639 Ga0070689_100008610
640 Ga0070689_100424748
641 Ga0070691_10035318
642 Ga0070691_10451536
643 Ga0070687_101344923
644 Ga0070692_10117639
645 Ga0070669_101467261
646 Ga0070675_102081881
647 Ga0070674_100055925
648 Ga0070709_10045495
649 Ga0070709_10054145
650 Ga0070709_10058827
651 Ga0070709_10159822
652 Ga0070709_10551570
653 Ga0070709_10657670
654 Ga0070714_100020976
655 Ga0070714_100045350
656 Ga0070714_100352922
657 Ga0070714_100440313
658 Ga0070713_100008786
659 Ga0070713_100034323
660 Ga0070713_100099921
661 Ga0070710_10017401
662 Ga0070710_10053580
663 Ga0070710_10094198
664 Ga0070710_10249718
665 Ga0070701_10382420
666 Ga0070711_100009819
667 Ga0070711_100025299
668 Ga0070711_100039443
669 Ga0070700_100001891
670 Ga0070694_100253682
671 Ga0070708_100077284
672 Ga0070678_100011776
673 Ga0070678_100060009
674 Ga0070681_10006383
675 Ga0070681_10053156
676 Ga0068867_100012320
677 Ga0068867_100102051
678 Ga0068867_100713321
679 Ga0070698_100109783
680 Ga0070679_100010254
681 Ga0070679_100725836
682 Ga0070684_100005660
683 Ga0070684_100132082
684 Ga0070684_100962883
685 Ga0070697_100282310
686 Ga0068853_100256634
687 Ga0068853_100264298
688 Ga0068853_101031919
689 Ga0068853_102154130
690 Ga0070672_100106235
691 Ga0070686_100000809
692 Ga0070686_101265270
693 Ga0070686_101808715
694 Ga0070696_100007810
695 Ga0070693_100001065
696 Ga0070665_100206658
697 Ga0070665_100700332
698 Ga0070665_102149040
699 Ga0070704_100022030
700 Ga0070704_101404219
701 Ga0068855_100182911
702 Ga0068855_102178721
703 Ga0068857_100378652
704 Ga0068857_100889102
705 Ga0068857_101226828
706 Ga0068854_100386628
707 Ga0068854_100499849
708 Ga0068854_100546570
709 Ga0068854_101037198
710 Ga0068856_100335471
711 Ga0068856_102717536
712 Ga0070702_100000187
713 Ga0068852_100546428
714 Ga0068859_100004925
715 Ga0068859_100015117
716 Ga0068864_100879621
717 Ga0068866_10003262
718 Ga0068866_10159391
719 Ga0068866_10659748
720 Ga0068861_100094471
721 Ga0068861_100130853
722 Ga0068861_100430406
723 Ga0068861_100657555
724 Ga0068870_10107271
725 Ga0068870_10220321
726 Ga0068863_100018212
727 Ga0068863_100025663
728 Ga0068863_100067577
729 Ga0068858_100202971
730 Ga0068860_100069604
731 Ga0068860_100095360
732 Ga0068860_100179268
733 Ga0068860_100250064
734 Ga0068862_100358362
735 Ga0081455_10053285
736 Ga0081540_1047428
737 Ga0070717_10018039
738 Ga0070717_10040252
739 Ga0070717_10365234
740 Ga0070717_10718654
741 Ga0070715_10004259
742 Ga0070715_10158294
743 Ga0070715_10784110
744 Ga0070716_100092037
745 Ga0070716_100207090
746 Ga0070716_100310627
747 Ga0070716_100469751
748 Ga0070712_100135313
749 Ga0070712_100307527
750 Ga0070712_100749737
751 Ga0097621_100011876
752 Ga0097621_100087358
753 Ga0097621_100462293
754 Ga0097621_100654713
755 Ga0068871_100005584
756 Ga0068871_100010987
757 Ga0068871_101425885
758 Ga0075428_100000800
759 Ga0075428_100595940
760 Ga0075430_100421563
761 Ga0075434_100021715
762 Ga0075434_100192900
763 Ga0075434_101923748
764 Ga0075429_100566451
765 Ga0075429_100738205
766 Ga0068865_100000472
767 Ga0068865_100584574
768 Ga0075436_100063046
769 Ga0075436_100558055
770 Ga0097620_100004925
771 Ga0097620_100015118
772 Ga0075435_100078640
773 Ga0075435_101841999
774 Ga0099794_10006878
775 Ga0099794_10383745
776 Ga0099795_10146301
777 Ga0105240_10157251
778 Ga0105240_10364267
779 Ga0105240_10740235
780 Ga0111539_10138859
781 Ga0111539_10153000
782 Ga0105245_10010755
783 Ga0105245_10085386
784 Ga0105245_10307133
785 Ga0105245_10479935
786 Ga0105247_10016547
787 Ga0105247_10069422
788 Ga0114129_10176040
789 Ga0114129_10586488
790 Ga0105243_10003964
791 Ga0105243_10705626
792 Ga0105241_10070774
793 Ga0105241_10144240
794 Ga0105241_10314374
795 Ga0105241_10586983
796 Ga0105241_10877955
797 Ga0105242_10015993
798 Ga0105242_10900480
799 Ga0105242_11556875
800 Ga0105242_12356419
801 Ga0105248_10056592
802 Ga0105248_10194476
803 Ga0105248_11222396
804 Ga0105237_10018218
805 Ga0105237_10179345
806 Ga0105237_12626599
807 Ga0105238_10122043
808 Ga0105238_10133587
809 Ga0105238_10206116
810 Ga0105238_10233336
811 Ga0105238_10465576
812 Ga0105238_10670914
813 Ga0105238_10817753
814 Ga0105249_10038619
815 Ga0105249_13447426
816 Ga0105239_10025278
817 Ga0105239_10106728
818 Ga0105239_10128586
819 Ga0105239_10144971
820 Ga0105239_11056568
821 Ga0105239_11443857
822 Ga0105246_10042499
823 Ga0105246_10723434
824 Ga0105246_11078949
825 Ga0105246_12274572
826 Ga0157370_10079771
827 Ga0157370_10789468
828 Ga0157370_11852195
829 Ga0157369_10011139
830 Ga0157369_10040500
831 Ga0157369_10077837
832 Ga0157369_10434092
833 Ga0157369_11285932
834 Ga0157374_10042167
835 Ga0157374_10127074
836 Ga0157374_10199680
837 Ga0157378_10008257
838 Ga0157378_10312586
839 Ga0157378_10403649
840 Ga0163162_10059776
841 Ga0163162_10308380
842 Ga0163162_12120030
843 Ga0157372_10082060
844 Ga0157372_10095562
845 Ga0157372_10437522
846 Ga0157372_11071195
847 Ga0157372_11287152
848 Ga0157375_10010533
849 Ga0157375_10029287
850 Ga0163163_10025688
851 Ga0163163_10069915
852 Ga0163163_12166550
853 Ga0157380_10002026
854 Ga0157380_10133821
855 Ga0157379_10041137
856 Ga0157379_10051283
857 Ga0157376_10012486
858 Ga0206354_10065062
859 Ga0213874_10260639
860 Ga0213875_10096129
861 Ga0209677_112180
862 Ga0209233_1013063
863 Ga0207653_10386110
864 Ga0207692_10000982
865 Ga0207692_10320168
866 Ga0207642_10009463
867 Ga0207642_10080821
868 Ga0207642_10082145
869 Ga0207710_10055854
870 Ga0207680_10577869
871 Ga0207647_10083566
872 Ga0207685_10012114
873 Ga0207685_10012295
874 Ga0207699_10014409
875 Ga0207699_10015197
876 Ga0207699_10048790
877 Ga0207699_10091990
878 Ga0207645_10180703
879 Ga0207643_10108472
880 Ga0207643_10355555
881 Ga0207684_10071103
882 Ga0207684_10206664
883 Ga0207654_10076191
884 Ga0207654_10309268
885 Ga0207654_10453512
886 Ga0207654_11171238
887 Ga0207654_11283305
888 Ga0207707_10000712
889 Ga0207707_10107916
890 Ga0207707_10125433
891 Ga0207695_10111118
892 Ga0207695_10505153
893 Ga0207671_10082204
894 Ga0207671_10123062
895 Ga0207693_10012383
896 Ga0207693_10024727
897 Ga0207693_10300022
898 Ga0207663_10005664
899 Ga0207663_10039548
900 Ga0207663_10045464
901 Ga0207663_10138222
902 Ga0207660_10154698
903 Ga0207660_10302969
904 Ga0207660_10600663
905 Ga0207660_11626303
906 Ga0207662_10081952
907 Ga0207662_10978225
908 Ga0207652_10006317
909 Ga0207652_10278947
910 Ga0207652_10658161
911 Ga0207694_10042484
912 Ga0207694_10254716
913 Ga0207694_10996040
914 Ga0207687_10008733
915 Ga0207687_10269127
916 Ga0207687_10330977
917 Ga0207700_10056048
918 Ga0207700_10152638
919 Ga0207700_10182456
920 Ga0207700_10264874
921 Ga0207700_10529539
922 Ga0207664_10023025
923 Ga0207664_10085237
924 Ga0207664_10921452
925 Ga0207664_10944169
926 Ga0207664_11029066
927 Ga0207644_10858948
928 Ga0207706_10299796
929 Ga0207686_10019826
930 Ga0207686_10643017
931 Ga0207709_10003691
932 Ga0207709_10090521
933 Ga0207709_10246574
934 Ga0207670_10564696
935 Ga0207670_11050723
936 Ga0207669_10154753
937 Ga0207704_10003752
938 Ga0207704_11577598
939 Ga0207665_10005299
940 Ga0207665_10012384
941 Ga0207665_10060939
942 Ga0207665_10520158
943 Ga0207691_10118995
944 Ga0207711_10850230
945 Ga0207711_11044996
946 Ga0207711_11210487
947 Ga0207689_10000764
948 Ga0207689_10000778
949 Ga0207661_10007684
950 Ga0207661_10027631
951 Ga0207667_10151928
952 Ga0207712_10940543
953 Ga0207668_11456936
954 Ga0207640_10438949
955 Ga0207658_10765561
956 Ga0207677_10423492
957 Ga0207703_10014255
958 Ga0207703_10132019
959 Ga0207639_10183417
960 Ga0207639_10223351
961 Ga0207639_10343259
962 Ga0207639_10855254
963 Ga0207639_11195844
964 Ga0207708_10000350
965 Ga0207708_10886572
966 Ga0207702_10328975
967 Ga0207641_10018929
968 Ga0207641_10073364
969 Ga0207648_10000730
970 Ga0207648_10122537
971 Ga0207648_10354134
972 Ga0207676_10538343
973 Ga0207674_10080874
974 Ga0207674_10250082
975 Ga0207674_10474711
976 Ga0207674_10573726
977 Ga0207674_10783349
978 Ga0207675_100000407
979 Ga0207675_100109499
980 Ga0207675_100773886
981 Ga0207683_10043680
982 Ga0207683_10049466
983 Ga0207698_10668249
984 Ga0207698_10981997
985 Ga0209179_1121038
986 Ga0209588_1002800
987 Ga0207428_10508609
988 Ga0268266_10152394
989 Ga0268266_10276006
990 Ga0268266_11922888
991 Ga0268265_10020069
992 Ga0268265_10137388
993 Ga0268264_10044738
994 Ga0268264_10091516
995 Ga0268264_10296808
996 Ga0268264_11132453
997 Ga0307511_10099969
998 Ga0307509_10136507
999 Ga0307509_10440846
1000 Ga0307508_10000046
1001 Ga0307508_10030615
1002 Ga0307508_10235815
1003 Ga0307508_10362271
1004 Ga0307516_10019968
1005 Ga0307516_10064332
1006 Ga0307516_10180582
1007 Ga0307405_11025879
1008 Ga0307412_10209279
1009 Ga0307416_100154972
1010 Ga0307411_11675639
1011 Ga0307507_10059519
1012 Ga0307507_10221272
1013 Ga0307510_10227846
1014 Ga0307510_10303796
1015 Ga0316212_1060804
1016 Ga0373958_0140369
1017 Ga0373926_0031180
1018 Ga0373934_0065100
1019 Ga0373944_0000134
1020 Ga0373952_0198133
1021 Ga0373936_0006476
1022 Ga0373939_0119887
1023 Ga0373945_0016493
1024 Ga0373945_0025832
1025 Ga0373945_0145758
1026 Ga0373953_0023099
1027 Ga0373953_0398609
1028 Ga0373957_0110514
1029 Ga0373943_0055907
1030 Ga0373943_0062572
1031 Ga0373943_0114748
1032 Ga0373946_0127794
1033 Ga0373955_0043129
1034 Ga0373924_0040407
1035 Ga0373931_0041176
1036 Ga0373935_0003204
1037 Ga0373935_0051160
1038 Ga0373927_0030091
1039 Ga0373927_0030687
1040 Ga0373927_0154566
1041 Ga0373927_0895994
1042 Ga0373933_0000498
1043 Ga0373933_0452847
1044 Ga0373933_0736688
1045 Ga0373947_0076225
1046 Ga0373947_0171339
1047 Ga0373947_0302324
1048 Ga0373947_0589761
1049 Ga0373937_0047523
1050 Ga0373937_0087773
1051 Ga0373937_0091001
1052 Ga0372808_037409
1053 Ga0373925_0062940
1054 Ga0373925_0192844
1055 Ga0373925_0806441
1056 Ga0373925_0975212
1057 Ga0395899_0122532
1058 Ga0395899_0879130
1059 Ga0395900_0117233
1060 Ga0395898_0034349
1061 Ga0436364_1394792
1062 Ga0395901_0084822
1063 Ga0436365_1029628
1064 Ga0436365_1534544
1065 Ga0436365_1701929
1066 Ga0436365_1814703
1067 Ga0436360_1250359
1068 Ga0436363_0170348
1069 Ga0436363_0516386
1070 Ga0436363_1381581
1071 Ga0439458_0045286
1072 Ga0466969_0234190
1073 Ga0466965_0015874
1074 Ga0466966_0004344
1075 Ga0466963_0430908
1076 Ga0466964_0001005
1077 Ga0466964_0181144
1078 Ga0466971_0457304
1079 Ga0466968_0606584
1080 Ga0466970_0015120
1081 Ga0466970_0165851
1082 Ga0466957_0132884
1083 Ga0466957_1253077
1084 Ga0466959_0009218
1085 Ga0466959_0064415
1086 Ga0451576_0001512
1087 Ga0466967_0038196
1088 Ga0466967_0355919
1089 Ga0466967_0782004
1090 Ga0466967_1009713
1091 Ga0495603_0006373
1092 Ga0495629_0278935
1093 Ga0495641_0148029
1094 Ga0495651_0620420
1095 Ga0495653_0456466
1096 Ga0495580_0013387
1097 Ga0495580_0145868
1098 Ga0495582_0024443
1099 Ga0495639_0042736
1100 Ga0495662_0098581
1101 Ga0495664_0011282
1102 Ga0495664_0471835
1103 Ga0495594_0471145
1104 Ga0495594_0543525
1105 Ga0495606_0170539
1106 Ga0495628_0876025
1107 Ga0495630_0110486
1108 Ga0495666_0076961
1109 Ga0495666_0113208
1110 Ga0495652_0841350
1111 Ga0495665_0010436
1112 Ga0495665_0172681
1113 Ga0495665_0214122
1114 Ga0495640_0037112
1115 Ga0495640_0273233
1116 Ga0495586_0118334
1117 Ga0495587_0102570
1118 Ga0495598_0003082
1119 Ga0495621_0526024
1120 Ga0495645_0257933
1121 Ga0495622_0014208
1122 Ga0495659_0536871
1123 Ga0495588_0111332
1124 Ga0495599_0108834
1125 Ga0495623_0290156
1126 Ga0495647_0006138
1127 Ga0495647_0039186
1128 Ga0495658_0327819
1129 Ga0495613_0223551
1130 Ga0495613_0356528
1131 Ga0495624_0107380
1132 Ga0495649_0378587
1133 Ga0495600_0389260
1134 Ga0495581_0037182
1135 Ga0495674_0062725
1136 Ga0495684_0003117
1137 Ga0495593_0040381
1138 Ga0495602_1014646
1139 Ga0496100_0381707
1140 Ga0496100_0864873
1141 Ga0496102_0239285
1142 Ga0496103_0734978
1143 Ga0496104_0001065
1144 Ga0496104_0854493
1145 Ga0496104_0858939
1146 Ga0496105_0046874
1147 Ga0496106_0000545
1148 Ga0496106_0345405
1149 Ga0496107_0063981
1150 Ga0496107_0065815
1151 Ga0496108_0174088
1152 Ga0496108_0228397
1153 Ga0496109_0199262
1154 Ga0496110_0091506
1155 Ga0496110_0603307
1156 Ga0496111_0014832
1157 Ga0496111_0216907
1158 Ga0496112_0048014
1159 Ga0496112_0258541
1160 Ga0496112_0321231
1161 Ga0496113_0211772
1162 Ga0496114_0388452
1163 Ga0496115_0006510
1164 Ga0496115_0562940
1165 Ga0496115_0903133
1166 Ga0496115_0931989
1167 Ga0496115_1439093
1168 Ga0496116_0268580
1169 Ga0496117_0058855
1170 Ga0496118_0004149
1171 Ga0496121_0000261
1172 Ga0496121_0044163
1173 Ga0496121_0101886
1174 Ga0496121_0315306
1175 Ga0496122_0249224
1176 Ga0496124_0001094
1177 Ga0496125_0000420
1178 Ga0496125_0028406
1179 Ga0496126_0027647
1180 Ga0496126_0049881
1181 Ga0496126_0093537
1182 Ga0496126_0149982
1183 Ga0496126_0232444
1184 Ga0501031_0964801
1185 Ga0501032_0372292
1186 Ga0501034_0076041
1187 Ga0501042_0222072
1188 Ga0501047_0048501
1189 Ga0501068_0377006
1190 Ga0501070_0075665
1191 Ga0501073_0042882
1192 Ga0501073_0292324
1193 Ga0501074_0117107
1194 Ga0501080_0027647
1195 Ga0501080_1711401
1196 Ga0501035_0530948
1197 Ga0501044_0114392
1198 nmdc:mga05p37_691481_c1
1199 nmdc:mga09592_246702_c1
1200 nmdc:mga09592_95012_c1
1201 nmdc:mga0qj67_970529_c1
1202 nmdc:mga06r32_1301777_c1
1203 nmdc:mga06r32_572040_c1
1204 nmdc:mga08y16_118006_c1
1205 nmdc:mga08y16_131598_c1
1206 nmdc:mga0n895_12052_c1
1207 nmdc:mga0n895_1527958_c1
1208 nmdc:mga0n895_208763_c1
1209 nmdc:mga0rr50_723496_c1
1210 nmdc:mga08x19_278791_c1
1211 nmdc:mga08x19_531121_c1
1212 Ga0495601_0137030
1213 Ga0495612_0061731
1214 Ga0500635_0013257
1215 Ga0500635_0099553
1216 Ga0495619_0626515
1217 Ga0500578_0432559
1218 Ga0500644_0031754
1219 Ga0500647_0282064
1220 Ga0500647_0426831
1221 Ga0500651_0255272
1222 Ga0500651_0435231
1223 Ga0500566_0000095
1224 Ga0500566_0180716
1225 Ga0500640_080304
1226 Ga0500614_021055
1227 Ga0500559_0304301
1228 Ga0500603_007331
1229 Ga0500603_038658
1230 Ga0500622_0078590
1231 Ga0500638_089832
1232 Ga0500639_130729
1233 Ga0500636_0078558
1234 Ga0500636_0122416
1235 Ga0500636_0177283
1236 Ga0500636_0187613
1237 Ga0500576_123767
1238 Ga0500657_094341
1239 Ga0500596_004897
1240 Ga0501084_0603275
1241 Ga0466962_0075784
1242 Ga0466962_0569838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

142

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9318 1 121
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9245 1 121
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.89 1 119
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8694 1 119
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.866 1 119
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9318 1 121 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9245 1 121 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8954 63 119 3.30.720.110
af_Q8IK86_519_679_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8869 62 85 3.40.50.300
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8596 61 119 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2V1CTG9-F1-model_v4 VOC domain-containing protein 1.004 63 119
AF-M5CMF1-F1-model_v4 deleted 1.001 62 121
AF-A0A436RGB7-F1-model_v4 VOC family protein 1 63 121
AF-A0A2J9SIR7-F1-model_v4 deleted 0.9965 62 121
AF-A0A0E1X199-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9961 61 121 GO:0051213

Map