F469833
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 619 | 267 | 619 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10089120|Ga0307406_100891202 |
| Length | 282 |
| Sequence | MAQGASPGTSGSGALARGLASALRCTTLARRSALVTARVAVLSDVHGNATALDAVRKEIRREKPDAVIVAGDLVLNGPQPAEALDGVRELEAEGAVVVQGNTDVAVADFDYTAAFPWLTDGVPDAFRAAAEWANDELGDDRLAWIRRLPSERRLLLDDTMVLACHASPGSQTQGFDQALDASVVLERVSRTDARVICCGHTHLPDVRDLGWKVIVNDGSAGYVFDGDPTASWALVTIDDDVVSAEIRRVEFDTMAVSNAISARGLPGDVYRAATVRTGKLVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 140 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 141 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 142 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 144 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 150 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 160 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 169 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 171 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 178 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 179 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 180 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 181 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 182 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 183 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 184 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 185 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 186 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 220 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 264 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 265 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 9.37 |
| Rhizosphere | 89.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10085238 | 3300003323 | Bacteria | 2553 |
| 2 | Ga0070676_10057451 | 3300005328 | Bacteria | 2303 |
| 3 | Ga0070676_10178133 | 3300005328 | Bacteria | 1380 |
| 4 | Ga0070683_100059475 | 3300005329 | Bacteria | 3550 |
| 5 | Ga0068869_100026718 | 3300005334 | Bacteria | 4019 |
| 6 | Ga0068869_100290295 | 3300005334 | Bacteria | 1318 |
| 7 | Ga0068869_100393423 | 3300005334 | Unclassified | 1138 |
| 8 | Ga0070680_100000017 | 3300005336 | Bacteria | 89028 |
| 9 | Ga0070680_100245671 | 3300005336 | Bacteria | 1513 |
| 10 | Ga0070680_100260497 | 3300005336 | Unclassified | 1467 |
| 11 | Ga0070682_100059049 | 3300005337 | Bacteria | 2421 |
| 12 | Ga0070682_100176443 | 3300005337 | Bacteria | 1489 |
| 13 | Ga0070660_100028487 | 3300005339 | Bacteria | 4180 |
| 14 | Ga0070689_100008190 | 3300005340 | Bacteria | 7347 |
| 15 | Ga0070687_100016213 | 3300005343 | Bacteria | 3391 |
| 16 | Ga0070687_100021735 | 3300005343 | Bacteria | 3021 |
| 17 | Ga0070687_100314176 | 3300005343 | Unclassified | 999 |
| 18 | Ga0070661_100286533 | 3300005344 | Bacteria | 1279 |
| 19 | Ga0070692_10022870 | 3300005345 | Bacteria | 3058 |
| 20 | Ga0070692_10239418 | 3300005345 | Unclassified | 1081 |
| 21 | Ga0070669_100108690 | 3300005353 | Bacteria | 2102 |
| 22 | Ga0070675_100509041 | 3300005354 | Bacteria | 1085 |
| 23 | Ga0070671_100354117 | 3300005355 | Bacteria | 1253 |
| 24 | Ga0070671_100359176 | 3300005355 | Bacteria | 1244 |
| 25 | Ga0070674_100011524 | 3300005356 | Bacteria | 5387 |
| 26 | Ga0070674_100043227 | 3300005356 | Bacteria | 3064 |
| 27 | Ga0070673_100046216 | 3300005364 | Bacteria | 3380 |
| 28 | Ga0070659_100001254 | 3300005366 | Bacteria | 18424 |
| 29 | Ga0070659_100517941 | 3300005366 | Bacteria | 1018 |
| 30 | Ga0070667_100116907 | 3300005367 | Unclassified | 2316 |
| 31 | Ga0070667_100507541 | 3300005367 | Bacteria | 1106 |
| 32 | Ga0070703_10069007 | 3300005406 | Unclassified | 1176 |
| 33 | Ga0070710_10045553 | 3300005437 | Bacteria | 2439 |
| 34 | Ga0070701_10005841 | 3300005438 | Bacteria | 5128 |
| 35 | Ga0070705_100076888 | 3300005440 | Bacteria | 2037 |
| 36 | Ga0070705_100093910 | 3300005440 | Bacteria | 1877 |
| 37 | Ga0070705_100113057 | 3300005440 | Bacteria | 1739 |
| 38 | Ga0070700_100011673 | 3300005441 | Bacteria | 4873 |
| 39 | Ga0070700_100016631 | 3300005441 | Bacteria | 4194 |
| 40 | Ga0070694_100007643 | 3300005444 | Bacteria | 6597 |
| 41 | Ga0070694_100146795 | 3300005444 | Bacteria | 1719 |
| 42 | Ga0070694_100161800 | 3300005444 | Bacteria | 1643 |
| 43 | Ga0070694_100185351 | 3300005444 | Bacteria | 1542 |
| 44 | Ga0070694_100247692 | 3300005444 | Bacteria | 1347 |
| 45 | Ga0070708_100004866 | 3300005445 | Bacteria | 10605 |
| 46 | Ga0070708_100005521 | 3300005445 | Bacteria | 10023 |
| 47 | Ga0070708_100005677 | 3300005445 | Bacteria | 9897 |
| 48 | Ga0070708_100070232 | 3300005445 | Bacteria | 3150 |
| 49 | Ga0070708_100109168 | 3300005445 | Bacteria | 2541 |
| 50 | Ga0070708_100209369 | 3300005445 | Bacteria | 1827 |
| 51 | Ga0070708_100368043 | 3300005445 | Bacteria | 1355 |
| 52 | Ga0070708_100368550 | 3300005445 | Unclassified | 1354 |
| 53 | Ga0070662_100123093 | 3300005457 | Bacteria | 1990 |
| 54 | Ga0070662_100267132 | 3300005457 | Unclassified | 1380 |
| 55 | Ga0070662_100382500 | 3300005457 | Unclassified | 1159 |
| 56 | Ga0070662_100494152 | 3300005457 | Bacteria | 1020 |
| 57 | Ga0070681_10144683 | 3300005458 | Bacteria | 2307 |
| 58 | Ga0070681_10234517 | 3300005458 | Bacteria | 1749 |
| 59 | Ga0070681_10551696 | 3300005458 | Bacteria | 1066 |
| 60 | Ga0068867_100021085 | 3300005459 | Bacteria | 4647 |
| 61 | Ga0068867_100095244 | 3300005459 | Bacteria | 2265 |
| 62 | Ga0070685_10001599 | 3300005466 | Bacteria | 11940 |
| 63 | Ga0070706_100003060 | 3300005467 | Bacteria | 16555 |
| 64 | Ga0070706_100006194 | 3300005467 | Bacteria | 11319 |
| 65 | Ga0070706_100007252 | 3300005467 | Bacteria | 10413 |
| 66 | Ga0070706_100017669 | 3300005467 | Bacteria | 6582 |
| 67 | Ga0070706_100102428 | 3300005467 | Bacteria | 2661 |
| 68 | Ga0070706_100155512 | 3300005467 | Bacteria | 2135 |
| 69 | Ga0070706_100308048 | 3300005467 | Bacteria | 1477 |
| 70 | Ga0070707_100000801 | 3300005468 | Bacteria | 31024 |
| 71 | Ga0070707_100003407 | 3300005468 | Bacteria | 15021 |
| 72 | Ga0070707_100011540 | 3300005468 | Bacteria | 8238 |
| 73 | Ga0070707_100017426 | 3300005468 | Bacteria | 6752 |
| 74 | Ga0070707_100093270 | 3300005468 | Bacteria | 2915 |
| 75 | Ga0070707_100119668 | 3300005468 | Bacteria | 2556 |
| 76 | Ga0070707_100689554 | 3300005468 | Bacteria | 984 |
| 77 | Ga0070698_100016493 | 3300005471 | Bacteria | 7795 |
| 78 | Ga0070698_100033589 | 3300005471 | Bacteria | 5314 |
| 79 | Ga0070698_100133443 | 3300005471 | Bacteria | 2437 |
| 80 | Ga0070698_100211164 | 3300005471 | Unclassified | 1876 |
| 81 | Ga0070698_100225429 | 3300005471 | Bacteria | 1807 |
| 82 | Ga0070699_100002964 | 3300005518 | Bacteria | 15086 |
| 83 | Ga0070699_100013871 | 3300005518 | Bacteria | 6931 |
| 84 | Ga0070699_100019715 | 3300005518 | Bacteria | 5812 |
| 85 | Ga0070699_100030402 | 3300005518 | Bacteria | 4662 |
| 86 | Ga0070699_100089605 | 3300005518 | Bacteria | 2688 |
| 87 | Ga0070699_100389430 | 3300005518 | Bacteria | 1259 |
| 88 | Ga0070679_100250578 | 3300005530 | Bacteria | 1727 |
| 89 | Ga0070684_100020234 | 3300005535 | Bacteria | 5520 |
| 90 | Ga0070697_100027553 | 3300005536 | Bacteria | 4546 |
| 91 | Ga0070697_100031377 | 3300005536 | Bacteria | 4275 |
| 92 | Ga0070697_100045945 | 3300005536 | Bacteria | 3539 |
| 93 | Ga0070697_100216313 | 3300005536 | Bacteria | 1632 |
| 94 | Ga0070697_100445520 | 3300005536 | Bacteria | 1127 |
| 95 | Ga0070672_100037813 | 3300005543 | Bacteria | 3684 |
| 96 | Ga0070686_100004260 | 3300005544 | Bacteria | 7886 |
| 97 | Ga0070686_100354965 | 3300005544 | Bacteria | 1103 |
| 98 | Ga0070686_100646678 | 3300005544 | Unclassified | 838 |
| 99 | Ga0070695_100008654 | 3300005545 | Bacteria | 6046 |
| 100 | Ga0070695_100158627 | 3300005545 | Bacteria | 1586 |
| 101 | Ga0070695_100176591 | 3300005545 | Unclassified | 1510 |
| 102 | Ga0070695_100272252 | 3300005545 | Bacteria | 1241 |
| 103 | Ga0070696_100007567 | 3300005546 | Bacteria | 7264 |
| 104 | Ga0070696_100011346 | 3300005546 | Bacteria | 5965 |
| 105 | Ga0070696_100015083 | 3300005546 | Bacteria | 5188 |
| 106 | Ga0070696_100023149 | 3300005546 | Bacteria | 4222 |
| 107 | Ga0070696_100048724 | 3300005546 | Bacteria | 2941 |
| 108 | Ga0070696_100179323 | 3300005546 | Bacteria | 1571 |
| 109 | Ga0070696_100361259 | 3300005546 | Unclassified | 1127 |
| 110 | Ga0070693_100023998 | 3300005547 | Bacteria | 3266 |
| 111 | Ga0070693_100241681 | 3300005547 | Bacteria | 1193 |
| 112 | Ga0070665_100165311 | 3300005548 | Archaea | 2215 |
| 113 | Ga0070704_100049997 | 3300005549 | Bacteria | 2936 |
| 114 | Ga0070704_100050388 | 3300005549 | Bacteria | 2926 |
| 115 | Ga0070704_100164392 | 3300005549 | Bacteria | 1758 |
| 116 | Ga0070704_100625062 | 3300005549 | Bacteria | 949 |
| 117 | Ga0068855_100263284 | 3300005563 | Bacteria | 1920 |
| 118 | Ga0070664_100037315 | 3300005564 | Bacteria | 4085 |
| 119 | Ga0068857_100063492 | 3300005577 | Bacteria | 3283 |
| 120 | Ga0068857_100504187 | 3300005577 | Unclassified | 1136 |
| 121 | Ga0068857_100626438 | 3300005577 | Bacteria | 1018 |
| 122 | Ga0068854_100059036 | 3300005578 | Bacteria | 2771 |
| 123 | Ga0068854_100445922 | 3300005578 | Bacteria | 1080 |
| 124 | Ga0070702_100003455 | 3300005615 | Bacteria | 7069 |
| 125 | Ga0068859_100021864 | 3300005617 | Bacteria | 6415 |
| 126 | Ga0068864_100004764 | 3300005618 | Bacteria | 11117 |
| 127 | Ga0068864_100014338 | 3300005618 | Bacteria | 6583 |
| 128 | Ga0068864_100192010 | 3300005618 | Bacteria | 1873 |
| 129 | Ga0068866_10053430 | 3300005718 | Bacteria | 2065 |
| 130 | Ga0068861_100127663 | 3300005719 | Bacteria | 2060 |
| 131 | Ga0068861_100158652 | 3300005719 | Bacteria | 1864 |
| 132 | Ga0068861_100388444 | 3300005719 | Bacteria | 1235 |
| 133 | Ga0068861_100525228 | 3300005719 | Bacteria | 1074 |
| 134 | Ga0068861_100692070 | 3300005719 | Unclassified | 946 |
| 135 | Ga0068870_10074470 | 3300005840 | Bacteria | 1860 |
| 136 | Ga0068863_100017340 | 3300005841 | Bacteria | 6905 |
| 137 | Ga0068863_100807831 | 3300005841 | Bacteria | 936 |
| 138 | Ga0068858_100027875 | 3300005842 | Bacteria | 5248 |
| 139 | Ga0068858_100428803 | 3300005842 | Bacteria | 1272 |
| 140 | Ga0068860_100025839 | 3300005843 | Bacteria | 5664 |
| 141 | Ga0068860_100243166 | 3300005843 | Bacteria | 1751 |
| 142 | Ga0068860_100460906 | 3300005843 | Unclassified | 1265 |
| 143 | Ga0068862_100149931 | 3300005844 | Bacteria | 2075 |
| 144 | Ga0068862_100282746 | 3300005844 | Bacteria | 1521 |
| 145 | Ga0081455_10157510 | 3300005937 | Bacteria | 1744 |
| 146 | Ga0081539_10002426 | 3300005985 | Bacteria | 26337 |
| 147 | Ga0081539_10007841 | 3300005985 | Bacteria | 9540 |
| 148 | Ga0075365_10070077 | 3300006038 | Bacteria | 2357 |
| 149 | Ga0075432_10036019 | 3300006058 | Bacteria | 1720 |
| 150 | Ga0070716_100217590 | 3300006173 | Bacteria | 1281 |
| 151 | Ga0068871_100740335 | 3300006358 | Bacteria | 903 |
| 152 | Ga0075428_100027425 | 3300006844 | Bacteria | 6303 |
| 153 | Ga0075428_100035631 | 3300006844 | Bacteria | 5485 |
| 154 | Ga0075433_10049991 | 3300006852 | Bacteria | 3639 |
| 155 | Ga0075433_10235102 | 3300006852 | Bacteria | 1627 |
| 156 | Ga0075434_100083149 | 3300006871 | Bacteria | 3199 |
| 157 | Ga0075434_100098838 | 3300006871 | Bacteria | 2923 |
| 158 | Ga0075434_100301940 | 3300006871 | Bacteria | 1621 |
| 159 | Ga0075434_100425794 | 3300006871 | Unclassified | 1349 |
| 160 | Ga0068865_100020409 | 3300006881 | Bacteria | 4295 |
| 161 | Ga0097620_100021863 | 3300006931 | Bacteria | 6415 |
| 162 | Ga0075435_100218131 | 3300007076 | Unclassified | 1619 |
| 163 | Ga0075435_100302508 | 3300007076 | Unclassified | 1368 |
| 164 | Ga0111539_10004889 | 3300009094 | Bacteria | 17446 |
| 165 | Ga0111539_10308924 | 3300009094 | Unclassified | 1840 |
| 166 | Ga0111539_10396684 | 3300009094 | Bacteria | 1607 |
| 167 | Ga0111539_10526823 | 3300009094 | Bacteria | 1377 |
| 168 | Ga0105245_10029313 | 3300009098 | Bacteria | 4861 |
| 169 | Ga0105245_10040835 | 3300009098 | Bacteria | 4134 |
| 170 | Ga0105245_10114566 | 3300009098 | Bacteria | 2511 |
| 171 | Ga0105245_10121887 | 3300009098 | Bacteria | 2437 |
| 172 | Ga0105245_10320671 | 3300009098 | Bacteria | 1526 |
| 173 | Ga0105245_10609428 | 3300009098 | Unclassified | 1119 |
| 174 | Ga0105247_10514383 | 3300009101 | Bacteria | 874 |
| 175 | Ga0114129_10159335 | 3300009147 | Bacteria | 3085 |
| 176 | Ga0114129_10221665 | 3300009147 | Bacteria | 2551 |
| 177 | Ga0114129_10221849 | 3300009147 | Bacteria | 2550 |
| 178 | Ga0114129_10401639 | 3300009147 | Bacteria | 1806 |
| 179 | Ga0114129_10519277 | 3300009147 | Unclassified | 1553 |
| 180 | Ga0105243_10003260 | 3300009148 | Bacteria | 13210 |
| 181 | Ga0105243_10137149 | 3300009148 | Bacteria | 2083 |
| 182 | Ga0105243_10215588 | 3300009148 | Bacteria | 1693 |
| 183 | Ga0105243_10323800 | 3300009148 | Bacteria | 1406 |
| 184 | Ga0105243_10411104 | 3300009148 | Bacteria | 1259 |
| 185 | Ga0105242_10097352 | 3300009176 | Bacteria | 2487 |
| 186 | Ga0105242_10228881 | 3300009176 | Bacteria | 1665 |
| 187 | Ga0105242_10482369 | 3300009176 | Bacteria | 1175 |
| 188 | Ga0105248_10015938 | 3300009177 | Bacteria | 8277 |
| 189 | Ga0105237_10240695 | 3300009545 | Bacteria | 1811 |
| 190 | Ga0105249_10003293 | 3300009553 | Bacteria | 13999 |
| 191 | Ga0105249_10041803 | 3300009553 | Bacteria | 4168 |
| 192 | Ga0105239_10531452 | 3300010375 | Unclassified | 1338 |
| 193 | Ga0105246_10007352 | 3300011119 | Bacteria | 6749 |
| 194 | Ga0105246_10080470 | 3300011119 | Bacteria | 2319 |
| 195 | Ga0105246_10358750 | 3300011119 | Bacteria | 1197 |
| 196 | Ga0157374_10200263 | 3300013296 | Bacteria | 1955 |
| 197 | Ga0157374_10377875 | 3300013296 | Unclassified | 1411 |
| 198 | Ga0157374_11195941 | 3300013296 | Unclassified | 781 |
| 199 | Ga0157378_10023119 | 3300013297 | Bacteria | 5470 |
| 200 | Ga0157378_10038091 | 3300013297 | Bacteria | 4260 |
| 201 | Ga0163162_10353198 | 3300013306 | Bacteria | 1603 |
| 202 | Ga0157375_10040061 | 3300013308 | Bacteria | 4513 |
| 203 | Ga0163163_10001601 | 3300014325 | Bacteria | 19022 |
| 204 | Ga0163163_10034936 | 3300014325 | Bacteria | 4873 |
| 205 | Ga0163163_10090013 | 3300014325 | Bacteria | 3082 |
| 206 | Ga0163163_10388244 | 3300014325 | Archaea | 1454 |
| 207 | Ga0163163_10463491 | 3300014325 | Bacteria | 1328 |
| 208 | Ga0163163_10944872 | 3300014325 | Unclassified | 925 |
| 209 | Ga0157380_10015679 | 3300014326 | Bacteria | 5571 |
| 210 | Ga0157380_10060361 | 3300014326 | Bacteria | 3030 |
| 211 | Ga0157380_10110099 | 3300014326 | Bacteria | 2312 |
| 212 | Ga0157380_10266662 | 3300014326 | Bacteria | 1558 |
| 213 | Ga0157380_10659157 | 3300014326 | Bacteria | 1045 |
| 214 | Ga0182008_10137899 | 3300014497 | Bacteria | 1219 |
| 215 | Ga0182008_10143276 | 3300014497 | Unclassified | 1196 |
| 216 | Ga0157377_10150081 | 3300014745 | Bacteria | 1440 |
| 217 | Ga0157379_10016312 | 3300014968 | Bacteria | 6534 |
| 218 | Ga0157379_10056856 | 3300014968 | Bacteria | 3496 |
| 219 | Ga0157379_10262858 | 3300014968 | Bacteria | 1568 |
| 220 | Ga0157379_10532750 | 3300014968 | Bacteria | 1091 |
| 221 | Ga0157376_10498166 | 3300014969 | Bacteria | 1197 |
| 222 | Ga0163161_10018664 | 3300017792 | Bacteria | 4862 |
| 223 | Ga0207653_10075184 | 3300025885 | Unclassified | 1160 |
| 224 | Ga0207692_10094986 | 3300025898 | Bacteria | 1625 |
| 225 | Ga0207642_10015491 | 3300025899 | Bacteria | 2843 |
| 226 | Ga0207688_10011966 | 3300025901 | Bacteria | 4721 |
| 227 | Ga0207688_10017254 | 3300025901 | Bacteria | 3922 |
| 228 | Ga0207645_10079127 | 3300025907 | Bacteria | 2107 |
| 229 | Ga0207643_10053164 | 3300025908 | Bacteria | 2301 |
| 230 | Ga0207684_10002333 | 3300025910 | Bacteria | 19236 |
| 231 | Ga0207684_10024521 | 3300025910 | Bacteria | 5142 |
| 232 | Ga0207684_10028026 | 3300025910 | Bacteria | 4798 |
| 233 | Ga0207684_10110452 | 3300025910 | Bacteria | 2353 |
| 234 | Ga0207707_10194055 | 3300025912 | Bacteria | 1771 |
| 235 | Ga0207671_10224882 | 3300025914 | Bacteria | 1471 |
| 236 | Ga0207660_10000002 | 3300025917 | Bacteria | 883566 |
| 237 | Ga0207660_10179408 | 3300025917 | Bacteria | 1644 |
| 238 | Ga0207660_10241022 | 3300025917 | Bacteria | 1424 |
| 239 | Ga0207660_10280305 | 3300025917 | Bacteria | 1323 |
| 240 | Ga0207662_10000529 | 3300025918 | Bacteria | 16963 |
| 241 | Ga0207662_10015221 | 3300025918 | Bacteria | 4326 |
| 242 | Ga0207649_10066170 | 3300025920 | Bacteria | 2290 |
| 243 | Ga0207649_10129535 | 3300025920 | Bacteria | 1712 |
| 244 | Ga0207652_10253379 | 3300025921 | Bacteria | 1587 |
| 245 | Ga0207646_10000242 | 3300025922 | Bacteria | 74986 |
| 246 | Ga0207646_10001771 | 3300025922 | Bacteria | 26150 |
| 247 | Ga0207646_10002780 | 3300025922 | Bacteria | 20440 |
| 248 | Ga0207646_10051567 | 3300025922 | Bacteria | 3681 |
| 249 | Ga0207646_10067562 | 3300025922 | Bacteria | 3191 |
| 250 | Ga0207646_10104516 | 3300025922 | Bacteria | 2540 |
| 251 | Ga0207646_10298562 | 3300025922 | Bacteria | 1455 |
| 252 | Ga0207681_10397759 | 3300025923 | Bacteria | 1112 |
| 253 | Ga0207687_10002819 | 3300025927 | Bacteria | 11786 |
| 254 | Ga0207687_10080859 | 3300025927 | Bacteria | 2347 |
| 255 | Ga0207687_10337703 | 3300025927 | Bacteria | 1224 |
| 256 | Ga0207690_10027392 | 3300025932 | Bacteria | 3601 |
| 257 | Ga0207690_10365367 | 3300025932 | Bacteria | 1144 |
| 258 | Ga0207706_10219201 | 3300025933 | Archaea | 1666 |
| 259 | Ga0207706_10310939 | 3300025933 | Bacteria | 1372 |
| 260 | Ga0207706_10474706 | 3300025933 | Unclassified | 1081 |
| 261 | Ga0207706_10575193 | 3300025933 | Unclassified | 969 |
| 262 | Ga0207709_10070615 | 3300025935 | Bacteria | 2215 |
| 263 | Ga0207670_10023513 | 3300025936 | Bacteria | 3837 |
| 264 | Ga0207669_10115832 | 3300025937 | Bacteria | 1807 |
| 265 | Ga0207669_10210909 | 3300025937 | Bacteria | 1418 |
| 266 | Ga0207704_10033692 | 3300025938 | Bacteria | 2916 |
| 267 | Ga0207665_10350384 | 3300025939 | Bacteria | 1114 |
| 268 | Ga0207691_10052756 | 3300025940 | Bacteria | 3713 |
| 269 | Ga0207711_10036437 | 3300025941 | Bacteria | 4174 |
| 270 | Ga0207711_10248815 | 3300025941 | Bacteria | 1632 |
| 271 | Ga0207711_10410255 | 3300025941 | Unclassified | 1259 |
| 272 | Ga0207689_10095526 | 3300025942 | Bacteria | 2441 |
| 273 | Ga0207689_10113348 | 3300025942 | Bacteria | 2229 |
| 274 | Ga0207689_10277739 | 3300025942 | Bacteria | 1387 |
| 275 | Ga0207661_10223944 | 3300025944 | Bacteria | 1663 |
| 276 | Ga0207679_10121656 | 3300025945 | Bacteria | 2079 |
| 277 | Ga0207667_10460639 | 3300025949 | Bacteria | 1291 |
| 278 | Ga0207712_10030826 | 3300025961 | Bacteria | 3608 |
| 279 | Ga0207712_10152994 | 3300025961 | Bacteria | 1784 |
| 280 | Ga0207668_10378201 | 3300025972 | Bacteria | 1191 |
| 281 | Ga0207640_10118211 | 3300025981 | Bacteria | 1893 |
| 282 | Ga0207658_10659487 | 3300025986 | Bacteria | 944 |
| 283 | Ga0207639_10355397 | 3300026041 | Bacteria | 1310 |
| 284 | Ga0207678_10005302 | 3300026067 | Bacteria | 11544 |
| 285 | Ga0207678_10381249 | 3300026067 | Bacteria | 1219 |
| 286 | Ga0207708_10004427 | 3300026075 | Bacteria | 10354 |
| 287 | Ga0207708_10030098 | 3300026075 | Bacteria | 4118 |
| 288 | Ga0207708_10067135 | 3300026075 | Bacteria | 2743 |
| 289 | Ga0207708_10111719 | 3300026075 | Bacteria | 2122 |
| 290 | Ga0207641_10236758 | 3300026088 | Unclassified | 1699 |
| 291 | Ga0207641_10358419 | 3300026088 | Bacteria | 1392 |
| 292 | Ga0207648_10015157 | 3300026089 | Bacteria | 7095 |
| 293 | Ga0207648_10236883 | 3300026089 | Bacteria | 1624 |
| 294 | Ga0207676_10121903 | 3300026095 | Bacteria | 2200 |
| 295 | Ga0207674_10005296 | 3300026116 | Bacteria | 15344 |
| 296 | Ga0207675_100017272 | 3300026118 | Bacteria | 6737 |
| 297 | Ga0207675_100079669 | 3300026118 | Bacteria | 3070 |
| 298 | Ga0207675_100342177 | 3300026118 | Bacteria | 1464 |
| 299 | Ga0207675_100560518 | 3300026118 | Unclassified | 1142 |
| 300 | Ga0207683_10023294 | 3300026121 | Bacteria | 5325 |
| 301 | Ga0207683_10283820 | 3300026121 | Bacteria | 1513 |
| 302 | Ga0207683_10284381 | 3300026121 | Bacteria | 1512 |
| 303 | Ga0207698_10118044 | 3300026142 | Bacteria | 2239 |
| 304 | Ga0207698_10182010 | 3300026142 | Bacteria | 1862 |
| 305 | Ga0209983_1020749 | 3300027665 | Unclassified | 1371 |
| 306 | Ga0268266_10139868 | 3300028379 | Archaea | 2172 |
| 307 | Ga0268266_10333738 | 3300028379 | Bacteria | 1422 |
| 308 | Ga0268265_10093106 | 3300028380 | Bacteria | 2414 |
| 309 | Ga0268265_10424478 | 3300028380 | Bacteria | 1235 |
| 310 | Ga0268265_10541615 | 3300028380 | Unclassified | 1104 |
| 311 | Ga0268264_10071403 | 3300028381 | Bacteria | 2942 |
| 312 | Ga0268264_10173127 | 3300028381 | Bacteria | 1954 |
| 313 | Ga0268264_10196675 | 3300028381 | Bacteria | 1841 |
| 314 | Ga0265337_1012246 | 3300028556 | Bacteria | 2923 |
| 315 | Ga0265326_10011919 | 3300028558 | Bacteria | 2558 |
| 316 | Ga0265326_10019353 | 3300028558 | Bacteria | 1957 |
| 317 | Ga0265319_1011171 | 3300028563 | Bacteria | 3696 |
| 318 | Ga0265319_1040373 | 3300028563 | Bacteria | 1578 |
| 319 | Ga0265319_1080330 | 3300028563 | Bacteria | 1036 |
| 320 | Ga0265334_10005048 | 3300028573 | Bacteria | 5791 |
| 321 | Ga0265334_10005311 | 3300028573 | Bacteria | 5631 |
| 322 | Ga0265334_10013793 | 3300028573 | Bacteria | 3377 |
| 323 | Ga0265334_10016047 | 3300028573 | Bacteria | 3101 |
| 324 | Ga0265318_10050579 | 3300028577 | Bacteria | 1561 |
| 325 | Ga0265322_10001920 | 3300028654 | Bacteria | 6581 |
| 326 | Ga0265338_10044626 | 3300028800 | Bacteria | 4089 |
| 327 | Ga0265338_10117028 | 3300028800 | Unclassified | 2134 |
| 328 | Ga0265338_10269109 | 3300028800 | Bacteria | 1249 |
| 329 | Ga0265338_10409044 | 3300028800 | Bacteria | 966 |
| 330 | Ga0265324_10003860 | 3300029957 | Bacteria | 6992 |
| 331 | Ga0265332_10017091 | 3300031238 | Bacteria | 3200 |
| 332 | Ga0265320_10004319 | 3300031240 | Bacteria | 9335 |
| 333 | Ga0265320_10006704 | 3300031240 | Bacteria | 7235 |
| 334 | Ga0265320_10034647 | 3300031240 | Bacteria | 2566 |
| 335 | Ga0265320_10165017 | 3300031240 | Bacteria | 996 |
| 336 | Ga0265325_10026920 | 3300031241 | Bacteria | 3111 |
| 337 | Ga0265325_10064884 | 3300031241 | Bacteria | 1845 |
| 338 | Ga0265325_10070821 | 3300031241 | Bacteria | 1751 |
| 339 | Ga0265325_10133967 | 3300031241 | Bacteria | 1184 |
| 340 | Ga0265325_10189040 | 3300031241 | Bacteria | 955 |
| 341 | Ga0265329_10004814 | 3300031242 | Bacteria | 5545 |
| 342 | Ga0265329_10006530 | 3300031242 | Bacteria | 4616 |
| 343 | Ga0265329_10042087 | 3300031242 | Unclassified | 1464 |
| 344 | Ga0265329_10095915 | 3300031242 | Unclassified | 943 |
| 345 | Ga0265340_10007157 | 3300031247 | Bacteria | 6077 |
| 346 | Ga0265340_10065163 | 3300031247 | Bacteria | 1735 |
| 347 | Ga0265339_10049559 | 3300031249 | Bacteria | 2299 |
| 348 | Ga0265339_10196504 | 3300031249 | Bacteria | 997 |
| 349 | Ga0265331_10025696 | 3300031250 | Bacteria | 2969 |
| 350 | Ga0265316_10002667 | 3300031344 | Bacteria | 18375 |
| 351 | Ga0265316_10026393 | 3300031344 | Bacteria | 4833 |
| 352 | Ga0265316_10064015 | 3300031344 | Bacteria | 2849 |
| 353 | Ga0265316_10071911 | 3300031344 | Bacteria | 2665 |
| 354 | Ga0265316_10273366 | 3300031344 | Bacteria | 1236 |
| 355 | Ga0307408_100443910 | 3300031548 | Bacteria | 1124 |
| 356 | Ga0265313_10047487 | 3300031595 | Bacteria | 2077 |
| 357 | Ga0265313_10118922 | 3300031595 | Bacteria | 1154 |
| 358 | Ga0265314_10009807 | 3300031711 | Bacteria | 8042 |
| 359 | Ga0265342_10119607 | 3300031712 | Bacteria | 1484 |
| 360 | Ga0316576_10003347 | 3300031727 | Bacteria | 9376 |
| 361 | Ga0316578_10038766 | 3300031728 | Bacteria | 2750 |
| 362 | Ga0316578_10148365 | 3300031728 | Bacteria | 1413 |
| 363 | Ga0307413_10042574 | 3300031824 | Bacteria | 2670 |
| 364 | Ga0307406_10089120 | 3300031901 | Bacteria | 2072 |
| 365 | Ga0307412_10073249 | 3300031911 | Bacteria | 2343 |
| 366 | Ga0307409_100330011 | 3300031995 | Bacteria | 1431 |
| 367 | Ga0307416_100001530 | 3300032002 | Bacteria | 12643 |
| 368 | Ga0307416_100042420 | 3300032002 | Bacteria | 3551 |
| 369 | Ga0307411_10075676 | 3300032005 | Bacteria | 2299 |
| 370 | Ga0307411_10137607 | 3300032005 | Unclassified | 1796 |
| 371 | Ga0307415_100004758 | 3300032126 | Bacteria | 7106 |
| 372 | Ga0316583_10024660 | 3300032133 | Bacteria | 2148 |
| 373 | Ga0373943_0097971 | 3300035170 | Bacteria | 1529 |
| 374 | Ga0316574_0056841 | 3300035398 | Bacteria | 2448 |
| 375 | Ga0316574_0129354 | 3300035398 | Unclassified | 1624 |
| 376 | Ga0316574_0155703 | 3300035398 | Bacteria | 1472 |
| 377 | Ga0373931_0017708 | 3300035691 | Bacteria | 3529 |
| 378 | Ga0373931_0292643 | 3300035691 | Bacteria | 1003 |
| 379 | Ga0373947_0121441 | 3300035725 | Unclassified | 1660 |
| 380 | Ga0373937_0074732 | 3300036401 | Bacteria | 3128 |
| 381 | Ga0373937_0108546 | 3300036401 | Bacteria | 2581 |
| 382 | Ga0316584_0051705 | 3300036712 | Bacteria | 3073 |
| 383 | Ga0316584_0299814 | 3300036712 | Bacteria | 1164 |
| 384 | Ga0373925_0432076 | 3300037068 | Bacteria | 1077 |
| 385 | Ga0373925_0716030 | 3300037068 | Bacteria | 825 |
| 386 | Ga0436365_1187677 | 3300039437 | Bacteria | 3178 |
| 387 | Ga0439466_0025622 | 3300041411 | Bacteria | 2058 |
| 388 | Ga0451833_0052944 | 3300041491 | Bacteria | 723 |
| 389 | Ga0451835_0571311 | 3300041492 | Bacteria | 875 |
| 390 | Ga0451853_3294679 | 3300041512 | Bacteria | 1143 |
| 391 | Ga0439452_052774 | 3300042010 | Bacteria | 927 |
| 392 | Ga0450910_001576 | 3300042147 | Bacteria | 2904 |
| 393 | Ga0439446_0006670 | 3300042156 | Bacteria | 3019 |
| 394 | Ga0451577_0067962 | 3300042876 | Bacteria | 3179 |
| 395 | Ga0453683_0018350 | 3300044673 | Bacteria | 4492 |
| 396 | Ga0453684_0195068 | 3300044712 | Bacteria | 2366 |
| 397 | Ga0451576_0259412 | 3300045051 | Bacteria | 1816 |
| 398 | Ga0451576_0296374 | 3300045051 | Bacteria | 1691 |
| 399 | Ga0495653_0116138 | 3300046463 | Bacteria | 1914 |
| 400 | Ga0495582_0144782 | 3300046473 | Unclassified | 1348 |
| 401 | Ga0495594_0390767 | 3300046499 | Unclassified | 792 |
| 402 | Ga0495608_0075608 | 3300046511 | Bacteria | 2195 |
| 403 | Ga0495618_0028799 | 3300046514 | Bacteria | 3462 |
| 404 | Ga0495630_0139549 | 3300046517 | Unclassified | 1843 |
| 405 | Ga0495630_0317841 | 3300046517 | Bacteria | 1190 |
| 406 | Ga0495640_0027262 | 3300046533 | Bacteria | 4122 |
| 407 | Ga0495645_0021864 | 3300046543 | Bacteria | 4626 |
| 408 | Ga0495667_0135306 | 3300046559 | Bacteria | 1589 |
| 409 | Ga0495634_0048693 | 3300046642 | Bacteria | 2852 |
| 410 | Ga0495634_0090953 | 3300046642 | Bacteria | 1982 |
| 411 | Ga0495599_0176410 | 3300046678 | Unclassified | 1318 |
| 412 | Ga0495624_0240882 | 3300046690 | Bacteria | 1095 |
| 413 | Ga0495674_0212310 | 3300047319 | Bacteria | 1603 |
| 414 | Ga0495674_0644344 | 3300047319 | Bacteria | 836 |
| 415 | Ga0495676_0135233 | 3300047321 | Bacteria | 1774 |
| 416 | Ga0495676_0156564 | 3300047321 | Bacteria | 1616 |
| 417 | Ga0495676_0178840 | 3300047321 | Bacteria | 1488 |
| 418 | Ga0495680_0242704 | 3300047322 | Bacteria | 1279 |
| 419 | Ga0495684_0026185 | 3300047471 | Bacteria | 4481 |
| 420 | Ga0495602_0174476 | 3300048088 | Bacteria | 1665 |
| 421 | Ga0496100_0130501 | 3300048903 | Bacteria | 1769 |
| 422 | Ga0496100_0445528 | 3300048903 | Bacteria | 992 |
| 423 | Ga0496101_0045212 | 3300048904 | Bacteria | 3153 |
| 424 | Ga0496102_0020554 | 3300048905 | Bacteria | 5834 |
| 425 | Ga0496102_0177775 | 3300048905 | Bacteria | 2004 |
| 426 | Ga0496102_0367705 | 3300048905 | Unclassified | 1354 |
| 427 | Ga0496102_0513196 | 3300048905 | Bacteria | 1121 |
| 428 | Ga0496103_0038350 | 3300048906 | Bacteria | 2939 |
| 429 | Ga0496103_0078846 | 3300048906 | Bacteria | 2069 |
| 430 | Ga0496103_0114077 | 3300048906 | Bacteria | 1718 |
| 431 | Ga0496103_0152571 | 3300048906 | Bacteria | 1480 |
| 432 | Ga0496104_0004073 | 3300048907 | Bacteria | 12678 |
| 433 | Ga0496104_0113611 | 3300048907 | Bacteria | 2597 |
| 434 | Ga0496105_0114493 | 3300048908 | Bacteria | 2224 |
| 435 | Ga0496105_0165233 | 3300048908 | Bacteria | 1816 |
| 436 | Ga0496105_0262741 | 3300048908 | Bacteria | 1396 |
| 437 | Ga0496105_0408695 | 3300048908 | Bacteria | 1076 |
| 438 | Ga0496105_0638715 | 3300048908 | Bacteria | 822 |
| 439 | Ga0496106_0025010 | 3300048909 | Bacteria | 4442 |
| 440 | Ga0496106_0081043 | 3300048909 | Bacteria | 2493 |
| 441 | Ga0496106_0106501 | 3300048909 | Bacteria | 2179 |
| 442 | Ga0496107_0094341 | 3300048910 | Bacteria | 2189 |
| 443 | Ga0496107_0254001 | 3300048910 | Bacteria | 1308 |
| 444 | Ga0496108_0194693 | 3300048911 | Bacteria | 1758 |
| 445 | Ga0496108_0202834 | 3300048911 | Archaea | 1721 |
| 446 | Ga0496108_0376659 | 3300048911 | Bacteria | 1239 |
| 447 | Ga0496108_0727419 | 3300048911 | Bacteria | 859 |
| 448 | Ga0496109_0031655 | 3300048912 | Bacteria | 4750 |
| 449 | Ga0496109_0045957 | 3300048912 | Bacteria | 3964 |
| 450 | Ga0496109_0149928 | 3300048912 | Bacteria | 2183 |
| 451 | Ga0496109_0152001 | 3300048912 | Bacteria | 2167 |
| 452 | Ga0496109_0153238 | 3300048912 | Bacteria | 2158 |
| 453 | Ga0496109_0191236 | 3300048912 | Bacteria | 1923 |
| 454 | Ga0496110_0020398 | 3300048913 | Bacteria | 5597 |
| 455 | Ga0496110_0023514 | 3300048913 | Bacteria | 5243 |
| 456 | Ga0496110_0094608 | 3300048913 | Bacteria | 2675 |
| 457 | Ga0496110_0133093 | 3300048913 | Bacteria | 2246 |
| 458 | Ga0496110_0150850 | 3300048913 | Bacteria | 2105 |
| 459 | Ga0496110_0709662 | 3300048913 | Bacteria | 908 |
| 460 | Ga0496111_0035164 | 3300048914 | Bacteria | 3579 |
| 461 | Ga0496111_0043839 | 3300048914 | Bacteria | 3216 |
| 462 | Ga0496111_0098152 | 3300048914 | Bacteria | 2151 |
| 463 | Ga0496111_0189387 | 3300048914 | Bacteria | 1529 |
| 464 | Ga0496112_0000001 | 3300048915 | Bacteria | 1346031 |
| 465 | Ga0496112_0036152 | 3300048915 | Bacteria | 4816 |
| 466 | Ga0496112_0080161 | 3300048915 | Bacteria | 3228 |
| 467 | Ga0496112_0279205 | 3300048915 | Unclassified | 1618 |
| 468 | Ga0496112_0304593 | 3300048915 | Bacteria | 1539 |
| 469 | Ga0496113_0046786 | 3300048916 | Bacteria | 3213 |
| 470 | Ga0496113_0097754 | 3300048916 | Bacteria | 2272 |
| 471 | Ga0496113_0107300 | 3300048916 | Bacteria | 2170 |
| 472 | Ga0496113_0128619 | 3300048916 | Bacteria | 1985 |
| 473 | Ga0496113_0278639 | 3300048916 | Unclassified | 1337 |
| 474 | Ga0496113_0360335 | 3300048916 | Bacteria | 1167 |
| 475 | Ga0496113_0456483 | 3300048916 | Bacteria | 1027 |
| 476 | Ga0496114_0069221 | 3300048917 | Bacteria | 2963 |
| 477 | Ga0496114_0119383 | 3300048917 | Bacteria | 2267 |
| 478 | Ga0496114_0376805 | 3300048917 | Bacteria | 1256 |
| 479 | Ga0501031_0053617 | 3300049568 | Bacteria | 2628 |
| 480 | Ga0501031_0103539 | 3300049568 | Bacteria | 1857 |
| 481 | Ga0501032_0091059 | 3300049569 | Bacteria | 2024 |
| 482 | Ga0501032_0324184 | 3300049569 | Bacteria | 994 |
| 483 | Ga0501033_0105662 | 3300049570 | Bacteria | 2052 |
| 484 | Ga0501036_0041243 | 3300049572 | Bacteria | 3905 |
| 485 | Ga0501036_0162363 | 3300049572 | Bacteria | 1883 |
| 486 | Ga0501036_0578170 | 3300049572 | Bacteria | 933 |
| 487 | Ga0501038_0034784 | 3300049574 | Bacteria | 4427 |
| 488 | Ga0501038_0110908 | 3300049574 | Bacteria | 2273 |
| 489 | Ga0501039_0019044 | 3300049575 | Bacteria | 5267 |
| 490 | Ga0501039_0033529 | 3300049575 | Bacteria | 3960 |
| 491 | Ga0501039_0137521 | 3300049575 | Bacteria | 1918 |
| 492 | Ga0501039_0232787 | 3300049575 | Bacteria | 1448 |
| 493 | Ga0501039_0516080 | 3300049575 | Bacteria | 938 |
| 494 | Ga0501039_0552635 | 3300049575 | Unclassified | 903 |
| 495 | Ga0501040_0004634 | 3300049576 | Bacteria | 8922 |
| 496 | Ga0501040_0016358 | 3300049576 | Bacteria | 4909 |
| 497 | Ga0501040_0092571 | 3300049576 | Bacteria | 2102 |
| 498 | Ga0501040_0104469 | 3300049576 | Bacteria | 1978 |
| 499 | Ga0501040_0194440 | 3300049576 | Bacteria | 1440 |
| 500 | Ga0501041_0009827 | 3300049577 | Bacteria | 5632 |
| 501 | Ga0501041_0050100 | 3300049577 | Bacteria | 2545 |
| 502 | Ga0501041_0056691 | 3300049577 | Bacteria | 2395 |
| 503 | Ga0501041_0058167 | 3300049577 | Bacteria | 2364 |
| 504 | Ga0501041_0467534 | 3300049577 | Bacteria | 801 |
| 505 | Ga0501042_0035112 | 3300049578 | Bacteria | 3557 |
| 506 | Ga0501042_0072313 | 3300049578 | Bacteria | 2467 |
| 507 | Ga0501043_0042893 | 3300049579 | Bacteria | 3556 |
| 508 | Ga0501046_0046011 | 3300049580 | Bacteria | 3464 |
| 509 | Ga0501046_0269924 | 3300049580 | Bacteria | 1248 |
| 510 | Ga0501046_0362404 | 3300049580 | Bacteria | 1051 |
| 511 | Ga0501048_0025817 | 3300049582 | Bacteria | 4280 |
| 512 | Ga0501048_0097641 | 3300049582 | Bacteria | 2072 |
| 513 | Ga0501067_0034172 | 3300049583 | Bacteria | 2821 |
| 514 | Ga0501067_0053969 | 3300049583 | Bacteria | 2227 |
| 515 | Ga0501067_0113076 | 3300049583 | Bacteria | 1510 |
| 516 | Ga0501068_0019660 | 3300049584 | Bacteria | 3925 |
| 517 | Ga0501068_0047355 | 3300049584 | Bacteria | 2594 |
| 518 | Ga0501068_0443742 | 3300049584 | Bacteria | 839 |
| 519 | Ga0501069_0032879 | 3300049585 | Bacteria | 2855 |
| 520 | Ga0501069_0239288 | 3300049585 | Bacteria | 1058 |
| 521 | Ga0501070_0020428 | 3300049586 | Bacteria | 5555 |
| 522 | Ga0501071_0028451 | 3300049587 | Bacteria | 3940 |
| 523 | Ga0501071_0171981 | 3300049587 | Bacteria | 1621 |
| 524 | Ga0501071_0191313 | 3300049587 | Bacteria | 1535 |
| 525 | Ga0501071_0225308 | 3300049587 | Bacteria | 1412 |
| 526 | Ga0501071_0444381 | 3300049587 | Bacteria | 992 |
| 527 | Ga0501071_0658300 | 3300049587 | Bacteria | 806 |
| 528 | Ga0501071_0734626 | 3300049587 | Bacteria | 760 |
| 529 | Ga0501072_0026651 | 3300049588 | Bacteria | 4506 |
| 530 | Ga0501072_0056727 | 3300049588 | Bacteria | 3086 |
| 531 | Ga0501072_0070912 | 3300049588 | Bacteria | 2752 |
| 532 | Ga0501072_0296997 | 3300049588 | Unclassified | 1284 |
| 533 | Ga0501073_0086292 | 3300049589 | Bacteria | 2183 |
| 534 | Ga0501074_0032079 | 3300049590 | Bacteria | 3808 |
| 535 | Ga0501075_0016498 | 3300049591 | Bacteria | 5321 |
| 536 | Ga0501075_0100704 | 3300049591 | Bacteria | 2194 |
| 537 | Ga0501075_0129528 | 3300049591 | Bacteria | 1922 |
| 538 | Ga0501075_0355531 | 3300049591 | Bacteria | 1116 |
| 539 | Ga0501076_0017957 | 3300049592 | Bacteria | 5381 |
| 540 | Ga0501076_0020719 | 3300049592 | Bacteria | 5034 |
| 541 | Ga0501076_0041412 | 3300049592 | Bacteria | 3624 |
| 542 | Ga0501076_0071535 | 3300049592 | Bacteria | 2775 |
| 543 | Ga0501076_0115936 | 3300049592 | Bacteria | 2167 |
| 544 | Ga0501076_0133749 | 3300049592 | Unclassified | 2012 |
| 545 | Ga0501077_0011899 | 3300049593 | Bacteria | 5443 |
| 546 | Ga0501077_0130262 | 3300049593 | Unclassified | 1595 |
| 547 | Ga0501079_0012810 | 3300049741 | Bacteria | 6402 |
| 548 | Ga0501079_0025725 | 3300049741 | Bacteria | 4513 |
| 549 | Ga0501079_0193100 | 3300049741 | Bacteria | 1589 |
| 550 | Ga0501079_0216089 | 3300049741 | Bacteria | 1498 |
| 551 | Ga0501079_0413531 | 3300049741 | Bacteria | 1058 |
| 552 | Ga0501079_0461999 | 3300049741 | Bacteria | 997 |
| 553 | Ga0501080_0024726 | 3300049742 | Bacteria | 5570 |
| 554 | Ga0501080_0030769 | 3300049742 | Bacteria | 5001 |
| 555 | Ga0501080_0058497 | 3300049742 | Bacteria | 3588 |
| 556 | Ga0501080_0153340 | 3300049742 | Bacteria | 2129 |
| 557 | Ga0501080_0170393 | 3300049742 | Bacteria | 2008 |
| 558 | Ga0501081_0041445 | 3300049743 | Bacteria | 3153 |
| 559 | Ga0501081_0049914 | 3300049743 | Bacteria | 2882 |
| 560 | Ga0501081_0104642 | 3300049743 | Bacteria | 2004 |
| 561 | Ga0501083_0026740 | 3300049744 | Bacteria | 3986 |
| 562 | Ga0501035_0064880 | 3300049822 | Bacteria | 3244 |
| 563 | Ga0501035_0100151 | 3300049822 | Bacteria | 2544 |
| 564 | Ga0501035_0309690 | 3300049822 | Bacteria | 1329 |
| 565 | Ga0501044_0082695 | 3300049823 | Bacteria | 3248 |
| 566 | Ga0501045_0005766 | 3300049824 | Bacteria | 8568 |
| 567 | Ga0501045_0019048 | 3300049824 | Bacteria | 4888 |
| 568 | Ga0501045_0021477 | 3300049824 | Bacteria | 4617 |
| 569 | Ga0501045_0110611 | 3300049824 | Bacteria | 2037 |
| 570 | Ga0501045_0181971 | 3300049824 | Bacteria | 1566 |
| 571 | Ga0501045_0266678 | 3300049824 | Unclassified | 1275 |
| 572 | Ga0501045_0341010 | 3300049824 | Archaea | 1115 |
| 573 | nmdc:mga0yw44_319676_c1 | 3300050492 | Bacteria | 1042 |
| 574 | nmdc:mga05p37_1824_c1 | 3300050507 | Bacteria | 24835 |
| 575 | nmdc:mga05p37_313751_c1 | 3300050507 | Bacteria | 1858 |
| 576 | nmdc:mga05p37_448416_c1 | 3300050507 | Bacteria | 1494 |
| 577 | nmdc:mga05p37_45265_c1 | 3300050507 | Bacteria | 5414 |
| 578 | nmdc:mga09592_13035_c1 | 3300050508 | Bacteria | 6785 |
| 579 | nmdc:mga08y16_67995_c1 | 3300050511 | Bacteria | 3716 |
| 580 | nmdc:mga08y16_683861_c1 | 3300050511 | Bacteria | 1027 |
| 581 | nmdc:mga0n895_166620_c1 | 3300050512 | Bacteria | 2235 |
| 582 | nmdc:mga0n895_241712_c1 | 3300050512 | Bacteria | 1832 |
| 583 | nmdc:mga0n895_266720_c1 | 3300050512 | Bacteria | 1737 |
| 584 | nmdc:mga0rr50_766828_c1 | 3300050513 | Bacteria | 823 |
| 585 | nmdc:mga08x19_487740_c1 | 3300050514 | Bacteria | 869 |
| 586 | nmdc:mga08x19_75829_c1 | 3300050514 | Bacteria | 2199 |
| 587 | nmdc:mga0a205_541757_c1 | 3300050515 | Bacteria | 1019 |
| 588 | nmdc:mga0a205_83865_c1 | 3300050515 | Bacteria | 3078 |
| 589 | nmdc:mga0a205_94332_c1 | 3300050515 | Bacteria | 2891 |
| 590 | Ga0495601_0005211 | 3300053077 | Bacteria | 7561 |
| 591 | Ga0495601_0024952 | 3300053077 | Bacteria | 3683 |
| 592 | Ga0495601_0123988 | 3300053077 | Unclassified | 1680 |
| 593 | Ga0495612_0000150 | 3300053078 | Bacteria | 29314 |
| 594 | Ga0495612_0043109 | 3300053078 | Bacteria | 1843 |
| 595 | Ga0495595_0087071 | 3300053084 | Bacteria | 1495 |
| 596 | Ga0495619_0005278 | 3300053085 | Bacteria | 8186 |
| 597 | Ga0495619_0310142 | 3300053085 | Bacteria | 1093 |
| 598 | Ga0501084_0016215 | 3300054114 | Bacteria | 6187 |
| 599 | Ga0501084_0024232 | 3300054114 | Bacteria | 5061 |
| 600 | Ga0501084_0040751 | 3300054114 | Bacteria | 3885 |
| 601 | Ga0501084_0071518 | 3300054114 | Bacteria | 2905 |
| 602 | Ga0501084_0097079 | 3300054114 | Bacteria | 2474 |
| 603 | Ga0501084_0156225 | 3300054114 | Archaea | 1924 |
| 604 | Ga0501084_0157114 | 3300054114 | Bacteria | 1918 |
| 605 | Ga0501084_0240792 | 3300054114 | Bacteria | 1527 |
| 606 | Ga0590071_019603 | 3300059421 | Unclassified | 1592 |
| 607 | Ga0590074_012454 | 3300059423 | Bacteria | 1431 |
| 608 | Ga0590075_002711 | 3300059424 | Bacteria | 4236 |
| 609 | Ga0501082_0020148 | 3300060353 | Bacteria | 5748 |
| 610 | Ga0501082_0042207 | 3300060353 | Bacteria | 3932 |
| 611 | Ga0501082_0137041 | 3300060353 | Bacteria | 2124 |
| 612 | Ga0501082_0227519 | 3300060353 | Bacteria | 1623 |
| 613 | Ga0501082_0301046 | 3300060353 | Bacteria | 1396 |
| 614 | Ga0501082_0796716 | 3300060353 | Bacteria | 827 |
| 615 | Ga0530510_0000395 | 3300061734 | Bacteria | 28388 |
| 616 | Ga0530510_0014862 | 3300061734 | Bacteria | 5497 |
| 617 | Ga0530510_0028455 | 3300061734 | Bacteria | 4007 |
| 618 | Ga0530510_0082913 | 3300061734 | Bacteria | 2335 |
| 619 | Ga0530510_0088669 | 3300061734 | Bacteria | 2255 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300011119 | Ga0105246_10358750 | Ga0105246_103587502 | 199 |
| 2 | 3300041491 | Ga0451833_0052944 | Ga0451833_0052944_22_633 | 199 |
| 3 | 3300048916 | Ga0496113_0097754 | Ga0496113_0097754_1635_2246 | 199 |
| 4 | 3300050507 | nmdc:mga05p37_313751_c1 | nmdc:mga05p37_313751_c1_858_1604 | 203 |
| 5 | 3300050515 | nmdc:mga0a205_541757_c1 | nmdc:mga0a205_541757_c1_127_873 | 204 |
| 6 | 3300041411 | Ga0439466_0025622 | Ga0439466_0025622_622_1368 | 206 |
| 7 | 3300049579 | Ga0501043_0042893 | Ga0501043_0042893_1791_2537 | 211 |
| 8 | 3300046499 | Ga0495594_0390767 | Ga0495594_0390767_15_671 | 214 |
| 9 | 3300049587 | Ga0501071_0734626 | Ga0501071_0734626_81_731 | 215 |
| 10 | 3300049568 | Ga0501031_0103539 | Ga0501031_0103539_1040_1786 | 218 |
| 11 | 3300049570 | Ga0501033_0105662 | Ga0501033_0105662_130_876 | 218 |
| 12 | 3300049572 | Ga0501036_0041243 | Ga0501036_0041243_1531_2277 | 218 |
| 13 | 3300049574 | Ga0501038_0034784 | Ga0501038_0034784_2258_3004 | 218 |
| 14 | 3300049575 | Ga0501039_0137521 | Ga0501039_0137521_1092_1838 | 218 |
| 15 | 3300049576 | Ga0501040_0016358 | Ga0501040_0016358_3725_4471 | 218 |
| 16 | 3300049577 | Ga0501041_0009827 | Ga0501041_0009827_2250_2996 | 218 |
| 17 | 3300049578 | Ga0501042_0072313 | Ga0501042_0072313_767_1513 | 218 |
| 18 | 3300049582 | Ga0501048_0097641 | Ga0501048_0097641_1165_1911 | 218 |
| 19 | 3300049586 | Ga0501070_0020428 | Ga0501070_0020428_1557_2303 | 218 |
| 20 | 3300049587 | Ga0501071_0171981 | Ga0501071_0171981_676_1422 | 218 |
| 21 | 3300049588 | Ga0501072_0026651 | Ga0501072_0026651_767_1513 | 218 |
| 22 | 3300049589 | Ga0501073_0086292 | Ga0501073_0086292_333_1079 | 218 |
| 23 | 3300049592 | Ga0501076_0020719 | Ga0501076_0020719_2788_3534 | 218 |
| 24 | 3300049741 | Ga0501079_0012810 | Ga0501079_0012810_1424_2170 | 218 |
| 25 | 3300049742 | Ga0501080_0030769 | Ga0501080_0030769_333_1079 | 218 |
| 26 | 3300049743 | Ga0501081_0041445 | Ga0501081_0041445_1616_2362 | 218 |
| 27 | 3300049744 | Ga0501083_0026740 | Ga0501083_0026740_720_1466 | 218 |
| 28 | 3300049822 | Ga0501035_0064880 | Ga0501035_0064880_2161_2907 | 218 |
| 29 | 3300049823 | Ga0501044_0082695 | Ga0501044_0082695_1118_1864 | 218 |
| 30 | 3300049824 | Ga0501045_0021477 | Ga0501045_0021477_2371_3117 | 218 |
| 31 | 3300054114 | Ga0501084_0040751 | Ga0501084_0040751_1689_2435 | 218 |
| 32 | 3300060353 | Ga0501082_0042207 | Ga0501082_0042207_1496_2242 | 218 |
| 33 | 3300061734 | Ga0530510_0028455 | Ga0530510_0028455_3025_3771 | 218 |
| 34 | 3300050514 | nmdc:mga08x19_75829_c1 | nmdc:mga08x19_75829_c1_640_1392 | 222 |
| 35 | 3300061734 | Ga0530510_0082913 | Ga0530510_0082913_70_816 | 223 |
| 36 | 3300049577 | Ga0501041_0467534 | Ga0501041_0467534_12_758 | 224 |
| 37 | 3300049742 | Ga0501080_0058497 | Ga0501080_0058497_2699_3445 | 224 |
| 38 | 3300049576 | Ga0501040_0104469 | Ga0501040_0104469_913_1659 | 225 |
| 39 | 3300049580 | Ga0501046_0046011 | Ga0501046_0046011_1058_1804 | 225 |
| 40 | 3300049587 | Ga0501071_0444381 | Ga0501071_0444381_104_850 | 225 |
| 41 | 3300054114 | Ga0501084_0024232 | Ga0501084_0024232_2615_3361 | 225 |
| 42 | 3300026075 | Ga0207708_10111719 | Ga0207708_101117192 | 226 |
| 43 | 3300049583 | Ga0501067_0053969 | Ga0501067_0053969_735_1424 | 228 |
| 44 | 3300009147 | Ga0114129_10401639 | Ga0114129_104016391 | 229 |
| 45 | 3300025922 | Ga0207646_10298562 | Ga0207646_102985622 | 234 |
| 46 | 3300014969 | Ga0157376_10498166 | Ga0157376_104981662 | 235 |
| 47 | 3300048088 | Ga0495602_0174476 | Ga0495602_0174476_792_1538 | 235 |
| 48 | 3300048914 | Ga0496111_0098152 | Ga0496111_0098152_1237_1983 | 237 |
| 49 | 3300005356 | Ga0070674_100043227 | Ga0070674_1000432273 | 238 |
| 50 | 3300005546 | Ga0070696_100023149 | Ga0070696_1000231492 | 238 |
| 51 | 3300005577 | Ga0068857_100626438 | Ga0068857_1006264382 | 238 |
| 52 | 3300005719 | Ga0068861_100525228 | Ga0068861_1005252282 | 238 |
| 53 | 3300006852 | Ga0075433_10049991 | Ga0075433_100499912 | 238 |
| 54 | 3300006871 | Ga0075434_100425794 | Ga0075434_1004257942 | 238 |
| 55 | 3300007076 | Ga0075435_100302508 | Ga0075435_1003025082 | 238 |
| 56 | 3300009176 | Ga0105242_10482369 | Ga0105242_104823692 | 238 |
| 57 | 3300011119 | Ga0105246_10007352 | Ga0105246_100073527 | 238 |
| 58 | 3300014326 | Ga0157380_10060361 | Ga0157380_100603612 | 238 |
| 59 | 3300017792 | Ga0163161_10018664 | Ga0163161_100186642 | 238 |
| 60 | 3300025922 | Ga0207646_10051567 | Ga0207646_100515673 | 238 |
| 61 | 3300025938 | Ga0207704_10033692 | Ga0207704_100336923 | 238 |
| 62 | 3300025939 | Ga0207665_10350384 | Ga0207665_103503842 | 238 |
| 63 | 3300035170 | Ga0373943_0097971 | Ga0373943_0097971_168_914 | 238 |
| 64 | 3300035725 | Ga0373947_0121441 | Ga0373947_0121441_794_1540 | 238 |
| 65 | 3300037068 | Ga0373925_0432076 | Ga0373925_0432076_160_906 | 238 |
| 66 | 3300047321 | Ga0495676_0156564 | Ga0495676_0156564_235_981 | 238 |
| 67 | 3300048905 | Ga0496102_0367705 | Ga0496102_0367705_594_1340 | 238 |
| 68 | 3300048908 | Ga0496105_0114493 | Ga0496105_0114493_1238_1984 | 238 |
| 69 | 3300048908 | Ga0496105_0638715 | Ga0496105_0638715_26_772 | 238 |
| 70 | 3300048911 | Ga0496108_0727419 | Ga0496108_0727419_67_813 | 238 |
| 71 | 3300048912 | Ga0496109_0152001 | Ga0496109_0152001_1325_2071 | 238 |
| 72 | 3300048913 | Ga0496110_0133093 | Ga0496110_0133093_832_1578 | 238 |
| 73 | 3300048915 | Ga0496112_0080161 | Ga0496112_0080161_606_1352 | 238 |
| 74 | 3300048916 | Ga0496113_0128619 | Ga0496113_0128619_538_1284 | 238 |
| 75 | 3300048917 | Ga0496114_0376805 | Ga0496114_0376805_395_1141 | 238 |
| 76 | 3300050512 | nmdc:mga0n895_166620_c1 | nmdc:mga0n895_166620_c1_387_1157 | 238 |
| 77 | 3300050515 | nmdc:mga0a205_83865_c1 | nmdc:mga0a205_83865_c1_1400_2170 | 238 |
| 78 | 3300005367 | Ga0070667_100507541 | Ga0070667_1005075411 | 240 |
| 79 | 3300013296 | Ga0157374_10377875 | Ga0157374_103778752 | 240 |
| 80 | 3300014968 | Ga0157379_10262858 | Ga0157379_102628582 | 240 |
| 81 | 3300048911 | Ga0496108_0376659 | Ga0496108_0376659_316_1062 | 240 |
| 82 | 3300048913 | Ga0496110_0150850 | Ga0496110_0150850_1053_1799 | 240 |
| 83 | 3300048916 | Ga0496113_0107300 | Ga0496113_0107300_286_1032 | 240 |
| 84 | 3300005471 | Ga0070698_100211164 | Ga0070698_1002111642 | 241 |
| 85 | 3300005406 | Ga0070703_10069007 | Ga0070703_100690072 | 242 |
| 86 | 3300005467 | Ga0070706_100017669 | Ga0070706_1000176695 | 242 |
| 87 | 3300005468 | Ga0070707_100011540 | Ga0070707_10001154010 | 242 |
| 88 | 3300005471 | Ga0070698_100033589 | Ga0070698_1000335895 | 242 |
| 89 | 3300005549 | Ga0070704_100049997 | Ga0070704_1000499973 | 242 |
| 90 | 3300006844 | Ga0075428_100027425 | Ga0075428_1000274252 | 242 |
| 91 | 3300009148 | Ga0105243_10137149 | Ga0105243_101371493 | 242 |
| 92 | 3300009176 | Ga0105242_10228881 | Ga0105242_102288812 | 242 |
| 93 | 3300025885 | Ga0207653_10075184 | Ga0207653_100751842 | 242 |
| 94 | 3300025910 | Ga0207684_10028026 | Ga0207684_100280263 | 242 |
| 95 | 3300025922 | Ga0207646_10067562 | Ga0207646_100675621 | 242 |
| 96 | 3300048905 | Ga0496102_0177775 | Ga0496102_0177775_45_773 | 242 |
| 97 | 3300048906 | Ga0496103_0038350 | Ga0496103_0038350_1255_1983 | 242 |
| 98 | 3300048909 | Ga0496106_0081043 | Ga0496106_0081043_457_1185 | 242 |
| 99 | 3300048910 | Ga0496107_0254001 | Ga0496107_0254001_388_1116 | 242 |
| 100 | 3300006871 | Ga0075434_100301940 | Ga0075434_1003019402 | 243 |
| 101 | 3300048915 | Ga0496112_0000001 | Ga0496112_0000001_213726_214475 | 243 |
| 102 | 3300048916 | Ga0496113_0278639 | Ga0496113_0278639_252_1001 | 243 |
| 103 | 3300050514 | nmdc:mga08x19_487740_c1 | nmdc:mga08x19_487740_c1_47_859 | 243 |
| 104 | 3300005545 | Ga0070695_100272252 | Ga0070695_1002722521 | 244 |
| 105 | 3300046514 | Ga0495618_0028799 | Ga0495618_0028799_645_1436 | 245 |
| 106 | 3300053078 | Ga0495612_0043109 | Ga0495612_0043109_777_1568 | 245 |
| 107 | 3300005840 | Ga0068870_10074470 | Ga0068870_100744702 | 246 |
| 108 | 3300005842 | Ga0068858_100428803 | Ga0068858_1004288032 | 246 |
| 109 | 3300005985 | Ga0081539_10002426 | Ga0081539_1000242617 | 246 |
| 110 | 3300046473 | Ga0495582_0144782 | Ga0495582_0144782_510_1253 | 246 |
| 111 | 3300046517 | Ga0495630_0139549 | Ga0495630_0139549_904_1647 | 246 |
| 112 | 3300047321 | Ga0495676_0178840 | Ga0495676_0178840_13_756 | 246 |
| 113 | 3300049575 | Ga0501039_0232787 | Ga0501039_0232787_46_789 | 246 |
| 114 | 3300049587 | Ga0501071_0191313 | Ga0501071_0191313_136_879 | 246 |
| 115 | 3300049591 | Ga0501075_0129528 | Ga0501075_0129528_1060_1803 | 246 |
| 116 | 3300049741 | Ga0501079_0413531 | Ga0501079_0413531_301_1044 | 246 |
| 117 | 3300049824 | Ga0501045_0181971 | Ga0501045_0181971_788_1531 | 246 |
| 118 | 3300053077 | Ga0495601_0123988 | Ga0495601_0123988_203_946 | 246 |
| 119 | 3300005328 | Ga0070676_10057451 | Ga0070676_100574512 | 247 |
| 120 | 3300005329 | Ga0070683_100059475 | Ga0070683_1000594753 | 247 |
| 121 | 3300005334 | Ga0068869_100026718 | Ga0068869_1000267183 | 247 |
| 122 | 3300005334 | Ga0068869_100393423 | Ga0068869_1003934232 | 247 |
| 123 | 3300005336 | Ga0070680_100245671 | Ga0070680_1002456712 | 247 |
| 124 | 3300005336 | Ga0070680_100260497 | Ga0070680_1002604972 | 247 |
| 125 | 3300005337 | Ga0070682_100059049 | Ga0070682_1000590493 | 247 |
| 126 | 3300005337 | Ga0070682_100176443 | Ga0070682_1001764432 | 247 |
| 127 | 3300005339 | Ga0070660_100028487 | Ga0070660_1000284874 | 247 |
| 128 | 3300005340 | Ga0070689_100008190 | Ga0070689_1000081903 | 247 |
| 129 | 3300005343 | Ga0070687_100016213 | Ga0070687_1000162134 | 247 |
| 130 | 3300005345 | Ga0070692_10239418 | Ga0070692_102394181 | 247 |
| 131 | 3300005353 | Ga0070669_100108690 | Ga0070669_1001086903 | 247 |
| 132 | 3300005355 | Ga0070671_100354117 | Ga0070671_1003541172 | 247 |
| 133 | 3300005356 | Ga0070674_100011524 | Ga0070674_1000115245 | 247 |
| 134 | 3300005364 | Ga0070673_100046216 | Ga0070673_1000462164 | 247 |
| 135 | 3300005366 | Ga0070659_100001254 | Ga0070659_10000125418 | 247 |
| 136 | 3300005366 | Ga0070659_100517941 | Ga0070659_1005179412 | 247 |
| 137 | 3300005437 | Ga0070710_10045553 | Ga0070710_100455532 | 247 |
| 138 | 3300005438 | Ga0070701_10005841 | Ga0070701_100058415 | 247 |
| 139 | 3300005440 | Ga0070705_100076888 | Ga0070705_1000768882 | 247 |
| 140 | 3300005441 | Ga0070700_100011673 | Ga0070700_1000116733 | 247 |
| 141 | 3300005441 | Ga0070700_100016631 | Ga0070700_1000166314 | 247 |
| 142 | 3300005444 | Ga0070694_100146795 | Ga0070694_1001467952 | 247 |
| 143 | 3300005444 | Ga0070694_100247692 | Ga0070694_1002476921 | 247 |
| 144 | 3300005445 | Ga0070708_100368550 | Ga0070708_1003685501 | 247 |
| 145 | 3300005457 | Ga0070662_100123093 | Ga0070662_1001230932 | 247 |
| 146 | 3300005457 | Ga0070662_100267132 | Ga0070662_1002671322 | 247 |
| 147 | 3300005458 | Ga0070681_10234517 | Ga0070681_102345172 | 247 |
| 148 | 3300005458 | Ga0070681_10551696 | Ga0070681_105516962 | 247 |
| 149 | 3300005459 | Ga0068867_100021085 | Ga0068867_1000210854 | 247 |
| 150 | 3300005459 | Ga0068867_100095244 | Ga0068867_1000952442 | 247 |
| 151 | 3300005466 | Ga0070685_10001599 | Ga0070685_100015996 | 247 |
| 152 | 3300005468 | Ga0070707_100017426 | Ga0070707_1000174265 | 247 |
| 153 | 3300005468 | Ga0070707_100093270 | Ga0070707_1000932702 | 247 |
| 154 | 3300005468 | Ga0070707_100689554 | Ga0070707_1006895542 | 247 |
| 155 | 3300005471 | Ga0070698_100016493 | Ga0070698_1000164938 | 247 |
| 156 | 3300005471 | Ga0070698_100133443 | Ga0070698_1001334433 | 247 |
| 157 | 3300005518 | Ga0070699_100013871 | Ga0070699_1000138712 | 247 |
| 158 | 3300005518 | Ga0070699_100019715 | Ga0070699_1000197154 | 247 |
| 159 | 3300005518 | Ga0070699_100389430 | Ga0070699_1003894302 | 247 |
| 160 | 3300005536 | Ga0070697_100027553 | Ga0070697_1000275534 | 247 |
| 161 | 3300005536 | Ga0070697_100045945 | Ga0070697_1000459454 | 247 |
| 162 | 3300005543 | Ga0070672_100037813 | Ga0070672_1000378132 | 247 |
| 163 | 3300005544 | Ga0070686_100004260 | Ga0070686_1000042604 | 247 |
| 164 | 3300005544 | Ga0070686_100646678 | Ga0070686_1006466781 | 247 |
| 165 | 3300005545 | Ga0070695_100176591 | Ga0070695_1001765912 | 247 |
| 166 | 3300005546 | Ga0070696_100011346 | Ga0070696_1000113463 | 247 |
| 167 | 3300005546 | Ga0070696_100361259 | Ga0070696_1003612592 | 247 |
| 168 | 3300005547 | Ga0070693_100023998 | Ga0070693_1000239984 | 247 |
| 169 | 3300005548 | Ga0070665_100165311 | Ga0070665_1001653112 | 247 |
| 170 | 3300005549 | Ga0070704_100625062 | Ga0070704_1006250622 | 247 |
| 171 | 3300005564 | Ga0070664_100037315 | Ga0070664_1000373151 | 247 |
| 172 | 3300005577 | Ga0068857_100063492 | Ga0068857_1000634923 | 247 |
| 173 | 3300005577 | Ga0068857_100504187 | Ga0068857_1005041872 | 247 |
| 174 | 3300005578 | Ga0068854_100059036 | Ga0068854_1000590362 | 247 |
| 175 | 3300005578 | Ga0068854_100445922 | Ga0068854_1004459222 | 247 |
| 176 | 3300005615 | Ga0070702_100003455 | Ga0070702_1000034552 | 247 |
| 177 | 3300005617 | Ga0068859_100021864 | Ga0068859_1000218646 | 247 |
| 178 | 3300005618 | Ga0068864_100014338 | Ga0068864_1000143385 | 247 |
| 179 | 3300005718 | Ga0068866_10053430 | Ga0068866_100534303 | 247 |
| 180 | 3300005719 | Ga0068861_100127663 | Ga0068861_1001276632 | 247 |
| 181 | 3300005719 | Ga0068861_100158652 | Ga0068861_1001586522 | 247 |
| 182 | 3300005719 | Ga0068861_100692070 | Ga0068861_1006920701 | 247 |
| 183 | 3300005842 | Ga0068858_100027875 | Ga0068858_1000278753 | 247 |
| 184 | 3300005844 | Ga0068862_100149931 | Ga0068862_1001499313 | 247 |
| 185 | 3300005937 | Ga0081455_10157510 | Ga0081455_101575102 | 247 |
| 186 | 3300006038 | Ga0075365_10070077 | Ga0075365_100700773 | 247 |
| 187 | 3300006058 | Ga0075432_10036019 | Ga0075432_100360192 | 247 |
| 188 | 3300006844 | Ga0075428_100035631 | Ga0075428_1000356312 | 247 |
| 189 | 3300006852 | Ga0075433_10235102 | Ga0075433_102351022 | 247 |
| 190 | 3300006871 | Ga0075434_100083149 | Ga0075434_1000831494 | 247 |
| 191 | 3300006871 | Ga0075434_100098838 | Ga0075434_1000988382 | 247 |
| 192 | 3300006881 | Ga0068865_100020409 | Ga0068865_1000204095 | 247 |
| 193 | 3300006931 | Ga0097620_100021863 | Ga0097620_1000218632 | 247 |
| 194 | 3300007076 | Ga0075435_100218131 | Ga0075435_1002181312 | 247 |
| 195 | 3300009094 | Ga0111539_10004889 | Ga0111539_1000488910 | 247 |
| 196 | 3300009094 | Ga0111539_10308924 | Ga0111539_103089242 | 247 |
| 197 | 3300009094 | Ga0111539_10396684 | Ga0111539_103966842 | 247 |
| 198 | 3300009098 | Ga0105245_10029313 | Ga0105245_100293133 | 247 |
| 199 | 3300009098 | Ga0105245_10114566 | Ga0105245_101145662 | 247 |
| 200 | 3300009098 | Ga0105245_10121887 | Ga0105245_101218873 | 247 |
| 201 | 3300009098 | Ga0105245_10609428 | Ga0105245_106094282 | 247 |
| 202 | 3300009147 | Ga0114129_10159335 | Ga0114129_101593353 | 247 |
| 203 | 3300009147 | Ga0114129_10221665 | Ga0114129_102216653 | 247 |
| 204 | 3300009147 | Ga0114129_10221849 | Ga0114129_102218493 | 247 |
| 205 | 3300009147 | Ga0114129_10519277 | Ga0114129_105192772 | 247 |
| 206 | 3300009148 | Ga0105243_10003260 | Ga0105243_100032607 | 247 |
| 207 | 3300009148 | Ga0105243_10215588 | Ga0105243_102155883 | 247 |
| 208 | 3300009176 | Ga0105242_10097352 | Ga0105242_100973523 | 247 |
| 209 | 3300009177 | Ga0105248_10015938 | Ga0105248_100159385 | 247 |
| 210 | 3300009545 | Ga0105237_10240695 | Ga0105237_102406952 | 247 |
| 211 | 3300009553 | Ga0105249_10003293 | Ga0105249_100032936 | 247 |
| 212 | 3300010375 | Ga0105239_10531452 | Ga0105239_105314521 | 247 |
| 213 | 3300011119 | Ga0105246_10080470 | Ga0105246_100804703 | 247 |
| 214 | 3300013296 | Ga0157374_10200263 | Ga0157374_102002632 | 247 |
| 215 | 3300013296 | Ga0157374_11195941 | Ga0157374_111959411 | 247 |
| 216 | 3300013297 | Ga0157378_10023119 | Ga0157378_100231195 | 247 |
| 217 | 3300013306 | Ga0163162_10353198 | Ga0163162_103531983 | 247 |
| 218 | 3300013308 | Ga0157375_10040061 | Ga0157375_100400612 | 247 |
| 219 | 3300014325 | Ga0163163_10090013 | Ga0163163_100900133 | 247 |
| 220 | 3300014325 | Ga0163163_10463491 | Ga0163163_104634912 | 247 |
| 221 | 3300014325 | Ga0163163_10944872 | Ga0163163_109448722 | 247 |
| 222 | 3300014326 | Ga0157380_10015679 | Ga0157380_100156793 | 247 |
| 223 | 3300014326 | Ga0157380_10110099 | Ga0157380_101100992 | 247 |
| 224 | 3300014326 | Ga0157380_10266662 | Ga0157380_102666622 | 247 |
| 225 | 3300014326 | Ga0157380_10659157 | Ga0157380_106591572 | 247 |
| 226 | 3300014968 | Ga0157379_10016312 | Ga0157379_100163122 | 247 |
| 227 | 3300014968 | Ga0157379_10532750 | Ga0157379_105327502 | 247 |
| 228 | 3300025898 | Ga0207692_10094986 | Ga0207692_100949863 | 247 |
| 229 | 3300025899 | Ga0207642_10015491 | Ga0207642_100154913 | 247 |
| 230 | 3300025901 | Ga0207688_10011966 | Ga0207688_100119664 | 247 |
| 231 | 3300025901 | Ga0207688_10017254 | Ga0207688_100172543 | 247 |
| 232 | 3300025908 | Ga0207643_10053164 | Ga0207643_100531643 | 247 |
| 233 | 3300025914 | Ga0207671_10224882 | Ga0207671_102248822 | 247 |
| 234 | 3300025917 | Ga0207660_10179408 | Ga0207660_101794082 | 247 |
| 235 | 3300025918 | Ga0207662_10000529 | Ga0207662_1000052912 | 247 |
| 236 | 3300025920 | Ga0207649_10066170 | Ga0207649_100661702 | 247 |
| 237 | 3300025922 | Ga0207646_10104516 | Ga0207646_101045163 | 247 |
| 238 | 3300025923 | Ga0207681_10397759 | Ga0207681_103977592 | 247 |
| 239 | 3300025927 | Ga0207687_10002819 | Ga0207687_1000281910 | 247 |
| 240 | 3300025927 | Ga0207687_10080859 | Ga0207687_100808592 | 247 |
| 241 | 3300025927 | Ga0207687_10337703 | Ga0207687_103377032 | 247 |
| 242 | 3300025932 | Ga0207690_10027392 | Ga0207690_100273925 | 247 |
| 243 | 3300025932 | Ga0207690_10365367 | Ga0207690_103653672 | 247 |
| 244 | 3300025933 | Ga0207706_10310939 | Ga0207706_103109392 | 247 |
| 245 | 3300025933 | Ga0207706_10575193 | Ga0207706_105751932 | 247 |
| 246 | 3300025936 | Ga0207670_10023513 | Ga0207670_100235132 | 247 |
| 247 | 3300025937 | Ga0207669_10115832 | Ga0207669_101158321 | 247 |
| 248 | 3300025937 | Ga0207669_10210909 | Ga0207669_102109092 | 247 |
| 249 | 3300025940 | Ga0207691_10052756 | Ga0207691_100527562 | 247 |
| 250 | 3300025941 | Ga0207711_10036437 | Ga0207711_100364373 | 247 |
| 251 | 3300025942 | Ga0207689_10095526 | Ga0207689_100955263 | 247 |
| 252 | 3300025944 | Ga0207661_10223944 | Ga0207661_102239442 | 247 |
| 253 | 3300025945 | Ga0207679_10121656 | Ga0207679_101216562 | 247 |
| 254 | 3300025961 | Ga0207712_10030826 | Ga0207712_100308262 | 247 |
| 255 | 3300025972 | Ga0207668_10378201 | Ga0207668_103782012 | 247 |
| 256 | 3300025981 | Ga0207640_10118211 | Ga0207640_101182112 | 247 |
| 257 | 3300026067 | Ga0207678_10005302 | Ga0207678_100053021 | 247 |
| 258 | 3300026067 | Ga0207678_10381249 | Ga0207678_103812492 | 247 |
| 259 | 3300026075 | Ga0207708_10004427 | Ga0207708_100044275 | 247 |
| 260 | 3300026075 | Ga0207708_10030098 | Ga0207708_100300984 | 247 |
| 261 | 3300026075 | Ga0207708_10067135 | Ga0207708_100671353 | 247 |
| 262 | 3300026089 | Ga0207648_10015157 | Ga0207648_100151575 | 247 |
| 263 | 3300026089 | Ga0207648_10236883 | Ga0207648_102368832 | 247 |
| 264 | 3300026116 | Ga0207674_10005296 | Ga0207674_100052964 | 247 |
| 265 | 3300026118 | Ga0207675_100017272 | Ga0207675_1000172728 | 247 |
| 266 | 3300026118 | Ga0207675_100079669 | Ga0207675_1000796692 | 247 |
| 267 | 3300026118 | Ga0207675_100560518 | Ga0207675_1005605181 | 247 |
| 268 | 3300026121 | Ga0207683_10023294 | Ga0207683_100232944 | 247 |
| 269 | 3300026121 | Ga0207683_10283820 | Ga0207683_102838202 | 247 |
| 270 | 3300026142 | Ga0207698_10118044 | Ga0207698_101180442 | 247 |
| 271 | 3300027665 | Ga0209983_1020749 | Ga0209983_10207492 | 247 |
| 272 | 3300028379 | Ga0268266_10139868 | Ga0268266_101398682 | 247 |
| 273 | 3300028379 | Ga0268266_10333738 | Ga0268266_103337382 | 247 |
| 274 | 3300028380 | Ga0268265_10093106 | Ga0268265_100931063 | 247 |
| 275 | 3300028381 | Ga0268264_10071403 | Ga0268264_100714033 | 247 |
| 276 | 3300028556 | Ga0265337_1012246 | Ga0265337_10122462 | 247 |
| 277 | 3300028558 | Ga0265326_10011919 | Ga0265326_100119193 | 247 |
| 278 | 3300028558 | Ga0265326_10019353 | Ga0265326_100193533 | 247 |
| 279 | 3300028563 | Ga0265319_1011171 | Ga0265319_10111712 | 247 |
| 280 | 3300028563 | Ga0265319_1040373 | Ga0265319_10403732 | 247 |
| 281 | 3300028563 | Ga0265319_1080330 | Ga0265319_10803302 | 247 |
| 282 | 3300028573 | Ga0265334_10005048 | Ga0265334_100050482 | 247 |
| 283 | 3300028573 | Ga0265334_10005311 | Ga0265334_100053115 | 247 |
| 284 | 3300028573 | Ga0265334_10013793 | Ga0265334_100137934 | 247 |
| 285 | 3300028573 | Ga0265334_10016047 | Ga0265334_100160473 | 247 |
| 286 | 3300028577 | Ga0265318_10050579 | Ga0265318_100505791 | 247 |
| 287 | 3300028654 | Ga0265322_10001920 | Ga0265322_100019204 | 247 |
| 288 | 3300028800 | Ga0265338_10044626 | Ga0265338_100446262 | 247 |
| 289 | 3300028800 | Ga0265338_10117028 | Ga0265338_101170283 | 247 |
| 290 | 3300028800 | Ga0265338_10269109 | Ga0265338_102691092 | 247 |
| 291 | 3300028800 | Ga0265338_10409044 | Ga0265338_104090442 | 247 |
| 292 | 3300029957 | Ga0265324_10003860 | Ga0265324_100038603 | 247 |
| 293 | 3300031238 | Ga0265332_10017091 | Ga0265332_100170912 | 247 |
| 294 | 3300031240 | Ga0265320_10004319 | Ga0265320_1000431910 | 247 |
| 295 | 3300031240 | Ga0265320_10006704 | Ga0265320_100067043 | 247 |
| 296 | 3300031240 | Ga0265320_10034647 | Ga0265320_100346473 | 247 |
| 297 | 3300031240 | Ga0265320_10165017 | Ga0265320_101650171 | 247 |
| 298 | 3300031241 | Ga0265325_10026920 | Ga0265325_100269202 | 247 |
| 299 | 3300031241 | Ga0265325_10064884 | Ga0265325_100648843 | 247 |
| 300 | 3300031241 | Ga0265325_10070821 | Ga0265325_100708211 | 247 |
| 301 | 3300031241 | Ga0265325_10133967 | Ga0265325_101339672 | 247 |
| 302 | 3300031241 | Ga0265325_10189040 | Ga0265325_101890402 | 247 |
| 303 | 3300031242 | Ga0265329_10004814 | Ga0265329_100048142 | 247 |
| 304 | 3300031242 | Ga0265329_10006530 | Ga0265329_100065305 | 247 |
| 305 | 3300031242 | Ga0265329_10042087 | Ga0265329_100420873 | 247 |
| 306 | 3300031242 | Ga0265329_10095915 | Ga0265329_100959152 | 247 |
| 307 | 3300031247 | Ga0265340_10007157 | Ga0265340_100071573 | 247 |
| 308 | 3300031247 | Ga0265340_10065163 | Ga0265340_100651632 | 247 |
| 309 | 3300031249 | Ga0265339_10049559 | Ga0265339_100495592 | 247 |
| 310 | 3300031249 | Ga0265339_10196504 | Ga0265339_101965042 | 247 |
| 311 | 3300031250 | Ga0265331_10025696 | Ga0265331_100256962 | 247 |
| 312 | 3300031344 | Ga0265316_10002667 | Ga0265316_1000266710 | 247 |
| 313 | 3300031344 | Ga0265316_10026393 | Ga0265316_100263933 | 247 |
| 314 | 3300031344 | Ga0265316_10064015 | Ga0265316_100640152 | 247 |
| 315 | 3300031344 | Ga0265316_10071911 | Ga0265316_100719112 | 247 |
| 316 | 3300031344 | Ga0265316_10273366 | Ga0265316_102733662 | 247 |
| 317 | 3300031548 | Ga0307408_100443910 | Ga0307408_1004439102 | 247 |
| 318 | 3300031595 | Ga0265313_10047487 | Ga0265313_100474872 | 247 |
| 319 | 3300031595 | Ga0265313_10118922 | Ga0265313_101189222 | 247 |
| 320 | 3300031711 | Ga0265314_10009807 | Ga0265314_100098076 | 247 |
| 321 | 3300031712 | Ga0265342_10119607 | Ga0265342_101196072 | 247 |
| 322 | 3300031727 | Ga0316576_10003347 | Ga0316576_100033478 | 247 |
| 323 | 3300031728 | Ga0316578_10038766 | Ga0316578_100387662 | 247 |
| 324 | 3300031728 | Ga0316578_10148365 | Ga0316578_101483652 | 247 |
| 325 | 3300031824 | Ga0307413_10042574 | Ga0307413_100425742 | 247 |
| 326 | 3300031911 | Ga0307412_10073249 | Ga0307412_100732492 | 247 |
| 327 | 3300031995 | Ga0307409_100330011 | Ga0307409_1003300112 | 247 |
| 328 | 3300032002 | Ga0307416_100001530 | Ga0307416_1000015309 | 247 |
| 329 | 3300032005 | Ga0307411_10137607 | Ga0307411_101376072 | 247 |
| 330 | 3300032126 | Ga0307415_100004758 | Ga0307415_1000047582 | 247 |
| 331 | 3300032133 | Ga0316583_10024660 | Ga0316583_100246602 | 247 |
| 332 | 3300035398 | Ga0316574_0056841 | Ga0316574_0056841_687_1433 | 247 |
| 333 | 3300035398 | Ga0316574_0129354 | Ga0316574_0129354_227_973 | 247 |
| 334 | 3300035398 | Ga0316574_0155703 | Ga0316574_0155703_439_1185 | 247 |
| 335 | 3300035691 | Ga0373931_0017708 | Ga0373931_0017708_1510_2256 | 247 |
| 336 | 3300036401 | Ga0373937_0074732 | Ga0373937_0074732_2128_2925 | 247 |
| 337 | 3300036712 | Ga0316584_0051705 | Ga0316584_0051705_1893_2639 | 247 |
| 338 | 3300036712 | Ga0316584_0299814 | Ga0316584_0299814_211_957 | 247 |
| 339 | 3300041492 | Ga0451835_0571311 | Ga0451835_0571311_84_839 | 247 |
| 340 | 3300042147 | Ga0450910_001576 | Ga0450910_001576_857_1708 | 247 |
| 341 | 3300042156 | Ga0439446_0006670 | Ga0439446_0006670_1688_2557 | 247 |
| 342 | 3300042876 | Ga0451577_0067962 | Ga0451577_0067962_726_1475 | 247 |
| 343 | 3300044712 | Ga0453684_0195068 | Ga0453684_0195068_740_1489 | 247 |
| 344 | 3300045051 | Ga0451576_0259412 | Ga0451576_0259412_356_1105 | 247 |
| 345 | 3300046463 | Ga0495653_0116138 | Ga0495653_0116138_77_874 | 247 |
| 346 | 3300046511 | Ga0495608_0075608 | Ga0495608_0075608_637_1434 | 247 |
| 347 | 3300046517 | Ga0495630_0317841 | Ga0495630_0317841_69_815 | 247 |
| 348 | 3300046533 | Ga0495640_0027262 | Ga0495640_0027262_1041_1838 | 247 |
| 349 | 3300046543 | Ga0495645_0021864 | Ga0495645_0021864_487_1284 | 247 |
| 350 | 3300046559 | Ga0495667_0135306 | Ga0495667_0135306_554_1300 | 247 |
| 351 | 3300046642 | Ga0495634_0048693 | Ga0495634_0048693_868_1665 | 247 |
| 352 | 3300046642 | Ga0495634_0090953 | Ga0495634_0090953_1127_1873 | 247 |
| 353 | 3300046678 | Ga0495599_0176410 | Ga0495599_0176410_164_910 | 247 |
| 354 | 3300047319 | Ga0495674_0644344 | Ga0495674_0644344_67_813 | 247 |
| 355 | 3300047321 | Ga0495676_0135233 | Ga0495676_0135233_716_1462 | 247 |
| 356 | 3300047322 | Ga0495680_0242704 | Ga0495680_0242704_336_1082 | 247 |
| 357 | 3300047471 | Ga0495684_0026185 | Ga0495684_0026185_1732_2529 | 247 |
| 358 | 3300048903 | Ga0496100_0130501 | Ga0496100_0130501_688_1434 | 247 |
| 359 | 3300048903 | Ga0496100_0445528 | Ga0496100_0445528_205_951 | 247 |
| 360 | 3300048904 | Ga0496101_0045212 | Ga0496101_0045212_2069_2815 | 247 |
| 361 | 3300048905 | Ga0496102_0513196 | Ga0496102_0513196_46_792 | 247 |
| 362 | 3300048906 | Ga0496103_0078846 | Ga0496103_0078846_214_960 | 247 |
| 363 | 3300048907 | Ga0496104_0113611 | Ga0496104_0113611_451_1197 | 247 |
| 364 | 3300048908 | Ga0496105_0165233 | Ga0496105_0165233_163_909 | 247 |
| 365 | 3300048908 | Ga0496105_0262741 | Ga0496105_0262741_381_1127 | 247 |
| 366 | 3300048909 | Ga0496106_0025010 | Ga0496106_0025010_1050_1796 | 247 |
| 367 | 3300048909 | Ga0496106_0106501 | Ga0496106_0106501_1386_2132 | 247 |
| 368 | 3300048910 | Ga0496107_0094341 | Ga0496107_0094341_1164_1910 | 247 |
| 369 | 3300048912 | Ga0496109_0031655 | Ga0496109_0031655_443_1189 | 247 |
| 370 | 3300048912 | Ga0496109_0045957 | Ga0496109_0045957_2106_2852 | 247 |
| 371 | 3300048913 | Ga0496110_0020398 | Ga0496110_0020398_2277_3023 | 247 |
| 372 | 3300048913 | Ga0496110_0023514 | Ga0496110_0023514_2806_3552 | 247 |
| 373 | 3300048914 | Ga0496111_0035164 | Ga0496111_0035164_2019_2765 | 247 |
| 374 | 3300048914 | Ga0496111_0043839 | Ga0496111_0043839_240_986 | 247 |
| 375 | 3300048915 | Ga0496112_0304593 | Ga0496112_0304593_172_918 | 247 |
| 376 | 3300048916 | Ga0496113_0046786 | Ga0496113_0046786_1446_2192 | 247 |
| 377 | 3300048917 | Ga0496114_0069221 | Ga0496114_0069221_1271_2017 | 247 |
| 378 | 3300048917 | Ga0496114_0119383 | Ga0496114_0119383_552_1295 | 247 |
| 379 | 3300049568 | Ga0501031_0053617 | Ga0501031_0053617_1633_2379 | 247 |
| 380 | 3300049569 | Ga0501032_0324184 | Ga0501032_0324184_101_847 | 247 |
| 381 | 3300049572 | Ga0501036_0578170 | Ga0501036_0578170_83_829 | 247 |
| 382 | 3300049574 | Ga0501038_0110908 | Ga0501038_0110908_1076_1822 | 247 |
| 383 | 3300049575 | Ga0501039_0033529 | Ga0501039_0033529_269_1015 | 247 |
| 384 | 3300049575 | Ga0501039_0516080 | Ga0501039_0516080_148_894 | 247 |
| 385 | 3300049575 | Ga0501039_0552635 | Ga0501039_0552635_126_872 | 247 |
| 386 | 3300049576 | Ga0501040_0004634 | Ga0501040_0004634_411_1157 | 247 |
| 387 | 3300049576 | Ga0501040_0194440 | Ga0501040_0194440_511_1257 | 247 |
| 388 | 3300049577 | Ga0501041_0056691 | Ga0501041_0056691_544_1290 | 247 |
| 389 | 3300049577 | Ga0501041_0058167 | Ga0501041_0058167_888_1634 | 247 |
| 390 | 3300049580 | Ga0501046_0269924 | Ga0501046_0269924_136_882 | 247 |
| 391 | 3300049580 | Ga0501046_0362404 | Ga0501046_0362404_220_963 | 247 |
| 392 | 3300049582 | Ga0501048_0025817 | Ga0501048_0025817_145_891 | 247 |
| 393 | 3300049583 | Ga0501067_0034172 | Ga0501067_0034172_1501_2247 | 247 |
| 394 | 3300049583 | Ga0501067_0113076 | Ga0501067_0113076_80_823 | 247 |
| 395 | 3300049585 | Ga0501069_0032879 | Ga0501069_0032879_1262_2008 | 247 |
| 396 | 3300049585 | Ga0501069_0239288 | Ga0501069_0239288_59_802 | 247 |
| 397 | 3300049587 | Ga0501071_0225308 | Ga0501071_0225308_180_926 | 247 |
| 398 | 3300049588 | Ga0501072_0056727 | Ga0501072_0056727_2029_2775 | 247 |
| 399 | 3300049588 | Ga0501072_0296997 | Ga0501072_0296997_93_839 | 247 |
| 400 | 3300049590 | Ga0501074_0032079 | Ga0501074_0032079_1818_2564 | 247 |
| 401 | 3300049591 | Ga0501075_0100704 | Ga0501075_0100704_352_1098 | 247 |
| 402 | 3300049591 | Ga0501075_0355531 | Ga0501075_0355531_226_972 | 247 |
| 403 | 3300049592 | Ga0501076_0017957 | Ga0501076_0017957_2687_3433 | 247 |
| 404 | 3300049592 | Ga0501076_0041412 | Ga0501076_0041412_2311_3057 | 247 |
| 405 | 3300049592 | Ga0501076_0071535 | Ga0501076_0071535_351_1097 | 247 |
| 406 | 3300049592 | Ga0501076_0115936 | Ga0501076_0115936_893_1639 | 247 |
| 407 | 3300049593 | Ga0501077_0011899 | Ga0501077_0011899_4242_4988 | 247 |
| 408 | 3300049593 | Ga0501077_0130262 | Ga0501077_0130262_353_1099 | 247 |
| 409 | 3300049741 | Ga0501079_0193100 | Ga0501079_0193100_104_850 | 247 |
| 410 | 3300049741 | Ga0501079_0216089 | Ga0501079_0216089_135_881 | 247 |
| 411 | 3300049742 | Ga0501080_0024726 | Ga0501080_0024726_4011_4757 | 247 |
| 412 | 3300049742 | Ga0501080_0170393 | Ga0501080_0170393_921_1667 | 247 |
| 413 | 3300049743 | Ga0501081_0049914 | Ga0501081_0049914_1879_2625 | 247 |
| 414 | 3300049743 | Ga0501081_0104642 | Ga0501081_0104642_1066_1812 | 247 |
| 415 | 3300049822 | Ga0501035_0100151 | Ga0501035_0100151_1094_1840 | 247 |
| 416 | 3300049822 | Ga0501035_0309690 | Ga0501035_0309690_326_1072 | 247 |
| 417 | 3300049824 | Ga0501045_0005766 | Ga0501045_0005766_4495_5241 | 247 |
| 418 | 3300049824 | Ga0501045_0110611 | Ga0501045_0110611_702_1448 | 247 |
| 419 | 3300049824 | Ga0501045_0341010 | Ga0501045_0341010_283_1029 | 247 |
| 420 | 3300050492 | nmdc:mga0yw44_319676_c1 | nmdc:mga0yw44_319676_c1_190_936 | 247 |
| 421 | 3300050507 | nmdc:mga05p37_448416_c1 | nmdc:mga05p37_448416_c1_10_756 | 247 |
| 422 | 3300050507 | nmdc:mga05p37_45265_c1 | nmdc:mga05p37_45265_c1_1545_2291 | 247 |
| 423 | 3300050511 | nmdc:mga08y16_67995_c1 | nmdc:mga08y16_67995_c1_1774_2520 | 247 |
| 424 | 3300050512 | nmdc:mga0n895_266720_c1 | nmdc:mga0n895_266720_c1_35_781 | 247 |
| 425 | 3300053077 | Ga0495601_0005211 | Ga0495601_0005211_5723_6520 | 247 |
| 426 | 3300053077 | Ga0495601_0024952 | Ga0495601_0024952_665_1411 | 247 |
| 427 | 3300053084 | Ga0495595_0087071 | Ga0495595_0087071_684_1430 | 247 |
| 428 | 3300053085 | Ga0495619_0005278 | Ga0495619_0005278_4828_5625 | 247 |
| 429 | 3300053085 | Ga0495619_0310142 | Ga0495619_0310142_128_874 | 247 |
| 430 | 3300054114 | Ga0501084_0016215 | Ga0501084_0016215_688_1434 | 247 |
| 431 | 3300054114 | Ga0501084_0071518 | Ga0501084_0071518_466_1212 | 247 |
| 432 | 3300054114 | Ga0501084_0097079 | Ga0501084_0097079_435_1181 | 247 |
| 433 | 3300054114 | Ga0501084_0156225 | Ga0501084_0156225_563_1309 | 247 |
| 434 | 3300054114 | Ga0501084_0157114 | Ga0501084_0157114_717_1463 | 247 |
| 435 | 3300054114 | Ga0501084_0240792 | Ga0501084_0240792_525_1271 | 247 |
| 436 | 3300059421 | Ga0590071_019603 | Ga0590071_019603_399_1145 | 247 |
| 437 | 3300059423 | Ga0590074_012454 | Ga0590074_012454_447_1193 | 247 |
| 438 | 3300059424 | Ga0590075_002711 | Ga0590075_002711_1287_2033 | 247 |
| 439 | 3300060353 | Ga0501082_0137041 | Ga0501082_0137041_727_1473 | 247 |
| 440 | 3300060353 | Ga0501082_0227519 | Ga0501082_0227519_221_967 | 247 |
| 441 | 3300060353 | Ga0501082_0301046 | Ga0501082_0301046_178_924 | 247 |
| 442 | 3300060353 | Ga0501082_0796716 | Ga0501082_0796716_60_806 | 247 |
| 443 | 3300061734 | Ga0530510_0000395 | Ga0530510_0000395_19336_20082 | 247 |
| 444 | 3300061734 | Ga0530510_0014862 | Ga0530510_0014862_2980_3726 | 247 |
| 445 | 3300061734 | Ga0530510_0088669 | Ga0530510_0088669_906_1652 | 247 |
| 446 | 3300005328 | Ga0070676_10178133 | Ga0070676_101781332 | 248 |
| 447 | 3300005334 | Ga0068869_100290295 | Ga0068869_1002902952 | 248 |
| 448 | 3300005336 | Ga0070680_100000017 | Ga0070680_10000001770 | 248 |
| 449 | 3300005343 | Ga0070687_100021735 | Ga0070687_1000217353 | 248 |
| 450 | 3300005343 | Ga0070687_100314176 | Ga0070687_1003141761 | 248 |
| 451 | 3300005344 | Ga0070661_100286533 | Ga0070661_1002865331 | 248 |
| 452 | 3300005345 | Ga0070692_10022870 | Ga0070692_100228702 | 248 |
| 453 | 3300005354 | Ga0070675_100509041 | Ga0070675_1005090412 | 248 |
| 454 | 3300005355 | Ga0070671_100359176 | Ga0070671_1003591762 | 248 |
| 455 | 3300005367 | Ga0070667_100116907 | Ga0070667_1001169072 | 248 |
| 456 | 3300005440 | Ga0070705_100093910 | Ga0070705_1000939102 | 248 |
| 457 | 3300005440 | Ga0070705_100113057 | Ga0070705_1001130572 | 248 |
| 458 | 3300005444 | Ga0070694_100007643 | Ga0070694_1000076435 | 248 |
| 459 | 3300005444 | Ga0070694_100161800 | Ga0070694_1001618002 | 248 |
| 460 | 3300005444 | Ga0070694_100185351 | Ga0070694_1001853512 | 248 |
| 461 | 3300005445 | Ga0070708_100004866 | Ga0070708_1000048666 | 248 |
| 462 | 3300005445 | Ga0070708_100005521 | Ga0070708_10000552110 | 248 |
| 463 | 3300005445 | Ga0070708_100005677 | Ga0070708_1000056778 | 248 |
| 464 | 3300005445 | Ga0070708_100070232 | Ga0070708_1000702324 | 248 |
| 465 | 3300005445 | Ga0070708_100109168 | Ga0070708_1001091682 | 248 |
| 466 | 3300005445 | Ga0070708_100209369 | Ga0070708_1002093692 | 248 |
| 467 | 3300005445 | Ga0070708_100368043 | Ga0070708_1003680432 | 248 |
| 468 | 3300005457 | Ga0070662_100382500 | Ga0070662_1003825001 | 248 |
| 469 | 3300005457 | Ga0070662_100494152 | Ga0070662_1004941522 | 248 |
| 470 | 3300005458 | Ga0070681_10144683 | Ga0070681_101446832 | 248 |
| 471 | 3300005467 | Ga0070706_100003060 | Ga0070706_1000030608 | 248 |
| 472 | 3300005467 | Ga0070706_100006194 | Ga0070706_1000061944 | 248 |
| 473 | 3300005467 | Ga0070706_100007252 | Ga0070706_1000072529 | 248 |
| 474 | 3300005467 | Ga0070706_100102428 | Ga0070706_1001024283 | 248 |
| 475 | 3300005467 | Ga0070706_100155512 | Ga0070706_1001555122 | 248 |
| 476 | 3300005467 | Ga0070706_100308048 | Ga0070706_1003080482 | 248 |
| 477 | 3300005468 | Ga0070707_100000801 | Ga0070707_10000080114 | 248 |
| 478 | 3300005468 | Ga0070707_100003407 | Ga0070707_1000034076 | 248 |
| 479 | 3300005468 | Ga0070707_100119668 | Ga0070707_1001196682 | 248 |
| 480 | 3300005471 | Ga0070698_100225429 | Ga0070698_1002254292 | 248 |
| 481 | 3300005518 | Ga0070699_100002964 | Ga0070699_10000296412 | 248 |
| 482 | 3300005518 | Ga0070699_100030402 | Ga0070699_1000304025 | 248 |
| 483 | 3300005518 | Ga0070699_100089605 | Ga0070699_1000896053 | 248 |
| 484 | 3300005535 | Ga0070684_100020234 | Ga0070684_1000202344 | 248 |
| 485 | 3300005536 | Ga0070697_100031377 | Ga0070697_1000313774 | 248 |
| 486 | 3300005536 | Ga0070697_100216313 | Ga0070697_1002163132 | 248 |
| 487 | 3300005536 | Ga0070697_100445520 | Ga0070697_1004455202 | 248 |
| 488 | 3300005544 | Ga0070686_100354965 | Ga0070686_1003549652 | 248 |
| 489 | 3300005545 | Ga0070695_100008654 | Ga0070695_1000086543 | 248 |
| 490 | 3300005545 | Ga0070695_100158627 | Ga0070695_1001586272 | 248 |
| 491 | 3300005546 | Ga0070696_100007567 | Ga0070696_1000075675 | 248 |
| 492 | 3300005546 | Ga0070696_100015083 | Ga0070696_1000150832 | 248 |
| 493 | 3300005546 | Ga0070696_100048724 | Ga0070696_1000487243 | 248 |
| 494 | 3300005546 | Ga0070696_100179323 | Ga0070696_1001793231 | 248 |
| 495 | 3300005547 | Ga0070693_100241681 | Ga0070693_1002416811 | 248 |
| 496 | 3300005549 | Ga0070704_100050388 | Ga0070704_1000503882 | 248 |
| 497 | 3300005549 | Ga0070704_100164392 | Ga0070704_1001643922 | 248 |
| 498 | 3300005563 | Ga0068855_100263284 | Ga0068855_1002632842 | 248 |
| 499 | 3300005618 | Ga0068864_100004764 | Ga0068864_1000047646 | 248 |
| 500 | 3300005618 | Ga0068864_100192010 | Ga0068864_1001920102 | 248 |
| 501 | 3300005719 | Ga0068861_100388444 | Ga0068861_1003884442 | 248 |
| 502 | 3300005841 | Ga0068863_100017340 | Ga0068863_1000173408 | 248 |
| 503 | 3300005841 | Ga0068863_100807831 | Ga0068863_1008078311 | 248 |
| 504 | 3300005843 | Ga0068860_100025839 | Ga0068860_1000258392 | 248 |
| 505 | 3300005843 | Ga0068860_100243166 | Ga0068860_1002431662 | 248 |
| 506 | 3300005843 | Ga0068860_100460906 | Ga0068860_1004609061 | 248 |
| 507 | 3300005844 | Ga0068862_100282746 | Ga0068862_1002827462 | 248 |
| 508 | 3300005985 | Ga0081539_10007841 | Ga0081539_1000784110 | 248 |
| 509 | 3300006173 | Ga0070716_100217590 | Ga0070716_1002175902 | 248 |
| 510 | 3300006358 | Ga0068871_100740335 | Ga0068871_1007403351 | 248 |
| 511 | 3300009094 | Ga0111539_10526823 | Ga0111539_105268232 | 248 |
| 512 | 3300009098 | Ga0105245_10040835 | Ga0105245_100408353 | 248 |
| 513 | 3300009098 | Ga0105245_10320671 | Ga0105245_103206712 | 248 |
| 514 | 3300009101 | Ga0105247_10514383 | Ga0105247_105143831 | 248 |
| 515 | 3300009148 | Ga0105243_10323800 | Ga0105243_103238003 | 248 |
| 516 | 3300009148 | Ga0105243_10411104 | Ga0105243_104111042 | 248 |
| 517 | 3300009553 | Ga0105249_10041803 | Ga0105249_100418033 | 248 |
| 518 | 3300013297 | Ga0157378_10038091 | Ga0157378_100380914 | 248 |
| 519 | 3300014325 | Ga0163163_10001601 | Ga0163163_100016014 | 248 |
| 520 | 3300014325 | Ga0163163_10034936 | Ga0163163_100349364 | 248 |
| 521 | 3300014325 | Ga0163163_10388244 | Ga0163163_103882442 | 248 |
| 522 | 3300014497 | Ga0182008_10137899 | Ga0182008_101378991 | 248 |
| 523 | 3300014497 | Ga0182008_10143276 | Ga0182008_101432762 | 248 |
| 524 | 3300014745 | Ga0157377_10150081 | Ga0157377_101500812 | 248 |
| 525 | 3300014968 | Ga0157379_10056856 | Ga0157379_100568564 | 248 |
| 526 | 3300025907 | Ga0207645_10079127 | Ga0207645_100791272 | 248 |
| 527 | 3300025910 | Ga0207684_10002333 | Ga0207684_1000233310 | 248 |
| 528 | 3300025910 | Ga0207684_10024521 | Ga0207684_100245214 | 248 |
| 529 | 3300025910 | Ga0207684_10110452 | Ga0207684_101104522 | 248 |
| 530 | 3300025912 | Ga0207707_10194055 | Ga0207707_101940552 | 248 |
| 531 | 3300025917 | Ga0207660_10000002 | Ga0207660_10000002664 | 248 |
| 532 | 3300025917 | Ga0207660_10241022 | Ga0207660_102410222 | 248 |
| 533 | 3300025917 | Ga0207660_10280305 | Ga0207660_102803052 | 248 |
| 534 | 3300025918 | Ga0207662_10015221 | Ga0207662_100152213 | 248 |
| 535 | 3300025920 | Ga0207649_10129535 | Ga0207649_101295352 | 248 |
| 536 | 3300025921 | Ga0207652_10253379 | Ga0207652_102533792 | 248 |
| 537 | 3300025922 | Ga0207646_10000242 | Ga0207646_100002427 | 248 |
| 538 | 3300025922 | Ga0207646_10001771 | Ga0207646_1000177112 | 248 |
| 539 | 3300025922 | Ga0207646_10002780 | Ga0207646_1000278013 | 248 |
| 540 | 3300025933 | Ga0207706_10219201 | Ga0207706_102192011 | 248 |
| 541 | 3300025933 | Ga0207706_10474706 | Ga0207706_104747062 | 248 |
| 542 | 3300025935 | Ga0207709_10070615 | Ga0207709_100706152 | 248 |
| 543 | 3300025941 | Ga0207711_10248815 | Ga0207711_102488152 | 248 |
| 544 | 3300025941 | Ga0207711_10410255 | Ga0207711_104102552 | 248 |
| 545 | 3300025942 | Ga0207689_10113348 | Ga0207689_101133481 | 248 |
| 546 | 3300025942 | Ga0207689_10277739 | Ga0207689_102777392 | 248 |
| 547 | 3300025949 | Ga0207667_10460639 | Ga0207667_104606392 | 248 |
| 548 | 3300025961 | Ga0207712_10152994 | Ga0207712_101529942 | 248 |
| 549 | 3300025986 | Ga0207658_10659487 | Ga0207658_106594872 | 248 |
| 550 | 3300026041 | Ga0207639_10355397 | Ga0207639_103553972 | 248 |
| 551 | 3300026088 | Ga0207641_10236758 | Ga0207641_102367582 | 248 |
| 552 | 3300026088 | Ga0207641_10358419 | Ga0207641_103584192 | 248 |
| 553 | 3300026095 | Ga0207676_10121903 | Ga0207676_101219033 | 248 |
| 554 | 3300026118 | Ga0207675_100342177 | Ga0207675_1003421772 | 248 |
| 555 | 3300026121 | Ga0207683_10284381 | Ga0207683_102843812 | 248 |
| 556 | 3300026142 | Ga0207698_10182010 | Ga0207698_101820102 | 248 |
| 557 | 3300028380 | Ga0268265_10424478 | Ga0268265_104244782 | 248 |
| 558 | 3300028380 | Ga0268265_10541615 | Ga0268265_105416152 | 248 |
| 559 | 3300028381 | Ga0268264_10173127 | Ga0268264_101731272 | 248 |
| 560 | 3300028381 | Ga0268264_10196675 | Ga0268264_101966753 | 248 |
| 561 | 3300031901 | Ga0307406_10089120 | Ga0307406_100891202 | 248 |
| 562 | 3300032002 | Ga0307416_100042420 | Ga0307416_1000424203 | 248 |
| 563 | 3300032005 | Ga0307411_10075676 | Ga0307411_100756762 | 248 |
| 564 | 3300035691 | Ga0373931_0292643 | Ga0373931_0292643_66_812 | 248 |
| 565 | 3300037068 | Ga0373925_0716030 | Ga0373925_0716030_21_767 | 248 |
| 566 | 3300039437 | Ga0436365_1187677 | Ga0436365_1187677_1282_2028 | 248 |
| 567 | 3300041512 | Ga0451853_3294679 | Ga0451853_3294679_27_827 | 248 |
| 568 | 3300042010 | Ga0439452_052774 | Ga0439452_052774_31_852 | 248 |
| 569 | 3300044673 | Ga0453683_0018350 | Ga0453683_0018350_2164_2958 | 248 |
| 570 | 3300045051 | Ga0451576_0296374 | Ga0451576_0296374_753_1499 | 248 |
| 571 | 3300046690 | Ga0495624_0240882 | Ga0495624_0240882_38_838 | 248 |
| 572 | 3300047319 | Ga0495674_0212310 | Ga0495674_0212310_43_789 | 248 |
| 573 | 3300048905 | Ga0496102_0020554 | Ga0496102_0020554_235_981 | 248 |
| 574 | 3300048906 | Ga0496103_0114077 | Ga0496103_0114077_285_1031 | 248 |
| 575 | 3300048906 | Ga0496103_0152571 | Ga0496103_0152571_36_848 | 248 |
| 576 | 3300048907 | Ga0496104_0004073 | Ga0496104_0004073_39_785 | 248 |
| 577 | 3300048908 | Ga0496105_0408695 | Ga0496105_0408695_183_929 | 248 |
| 578 | 3300048911 | Ga0496108_0194693 | Ga0496108_0194693_58_804 | 248 |
| 579 | 3300048911 | Ga0496108_0202834 | Ga0496108_0202834_10_756 | 248 |
| 580 | 3300048912 | Ga0496109_0149928 | Ga0496109_0149928_1149_1895 | 248 |
| 581 | 3300048912 | Ga0496109_0153238 | Ga0496109_0153238_222_968 | 248 |
| 582 | 3300048912 | Ga0496109_0191236 | Ga0496109_0191236_296_1042 | 248 |
| 583 | 3300048913 | Ga0496110_0094608 | Ga0496110_0094608_1540_2286 | 248 |
| 584 | 3300048913 | Ga0496110_0709662 | Ga0496110_0709662_36_782 | 248 |
| 585 | 3300048914 | Ga0496111_0189387 | Ga0496111_0189387_447_1193 | 248 |
| 586 | 3300048915 | Ga0496112_0036152 | Ga0496112_0036152_38_784 | 248 |
| 587 | 3300048915 | Ga0496112_0279205 | Ga0496112_0279205_560_1306 | 248 |
| 588 | 3300048916 | Ga0496113_0360335 | Ga0496113_0360335_238_984 | 248 |
| 589 | 3300048916 | Ga0496113_0456483 | Ga0496113_0456483_143_889 | 248 |
| 590 | 3300049569 | Ga0501032_0091059 | Ga0501032_0091059_1156_1905 | 248 |
| 591 | 3300049572 | Ga0501036_0162363 | Ga0501036_0162363_188_937 | 248 |
| 592 | 3300049575 | Ga0501039_0019044 | Ga0501039_0019044_1126_1875 | 248 |
| 593 | 3300049576 | Ga0501040_0092571 | Ga0501040_0092571_964_1713 | 248 |
| 594 | 3300049577 | Ga0501041_0050100 | Ga0501041_0050100_512_1261 | 248 |
| 595 | 3300049578 | Ga0501042_0035112 | Ga0501042_0035112_444_1193 | 248 |
| 596 | 3300049584 | Ga0501068_0019660 | Ga0501068_0019660_2319_3065 | 248 |
| 597 | 3300049584 | Ga0501068_0047355 | Ga0501068_0047355_325_1071 | 248 |
| 598 | 3300049584 | Ga0501068_0443742 | Ga0501068_0443742_30_779 | 248 |
| 599 | 3300049587 | Ga0501071_0028451 | Ga0501071_0028451_2758_3507 | 248 |
| 600 | 3300049587 | Ga0501071_0658300 | Ga0501071_0658300_10_759 | 248 |
| 601 | 3300049588 | Ga0501072_0070912 | Ga0501072_0070912_227_976 | 248 |
| 602 | 3300049591 | Ga0501075_0016498 | Ga0501075_0016498_338_1087 | 248 |
| 603 | 3300049592 | Ga0501076_0133749 | Ga0501076_0133749_760_1509 | 248 |
| 604 | 3300049741 | Ga0501079_0025725 | Ga0501079_0025725_2216_2965 | 248 |
| 605 | 3300049741 | Ga0501079_0461999 | Ga0501079_0461999_67_813 | 248 |
| 606 | 3300049742 | Ga0501080_0153340 | Ga0501080_0153340_509_1258 | 248 |
| 607 | 3300049824 | Ga0501045_0019048 | Ga0501045_0019048_858_1607 | 248 |
| 608 | 3300049824 | Ga0501045_0266678 | Ga0501045_0266678_157_903 | 248 |
| 609 | 3300050507 | nmdc:mga05p37_1824_c1 | nmdc:mga05p37_1824_c1_4701_5522 | 248 |
| 610 | 3300050508 | nmdc:mga09592_13035_c1 | nmdc:mga09592_13035_c1_5465_6211 | 248 |
| 611 | 3300050511 | nmdc:mga08y16_683861_c1 | nmdc:mga08y16_683861_c1_133_879 | 248 |
| 612 | 3300050512 | nmdc:mga0n895_241712_c1 | nmdc:mga0n895_241712_c1_255_1001 | 248 |
| 613 | 3300050513 | nmdc:mga0rr50_766828_c1 | nmdc:mga0rr50_766828_c1_58_804 | 248 |
| 614 | 3300050515 | nmdc:mga0a205_94332_c1 | nmdc:mga0a205_94332_c1_1482_2228 | 248 |
| 615 | 3300053078 | Ga0495612_0000150 | Ga0495612_0000150_11387_12133 | 248 |
| 616 | 3300060353 | Ga0501082_0020148 | Ga0501082_0020148_426_1175 | 248 |
| 617 | 3300003323 | rootH1_10085238 | rootH1_100852382 | 249 |
| 618 | 3300005530 | Ga0070679_100250578 | Ga0070679_1002505782 | 249 |
| 619 | 3300036401 | Ga0373937_0108546 | Ga0373937_0108546_1628_2395 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nnw-assembly1.cif.gz_A | hypothetical protein from pyrococcus furiosus pfu-1218608 | 0.8347 | 3 | 235 |
| 2gju-assembly1.cif.gz_B | crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 | 0.8341 | 3 | 236 |
| 3qfn-assembly1.cif.gz_B | crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate | 0.824 | 3 | 245 |
| 2gju-assembly1.cif.gz_B | crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 | 0.7844 | 3 | 236 |
| 1nnw-assembly1.cif.gz_A | hypothetical protein from pyrococcus furiosus pfu-1218608 | 0.7825 | 3 | 235 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gjuC00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8335 | 3 | 236 | 3.60.21.10 |
| 3qfnB00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.824 | 3 | 245 | 3.60.21.10 |
| af_Q58322_5_243_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8161 | 5 | 246 | 3.60.21.10 |
| af_Q58322_5_243_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8097 | 5 | 246 | 3.60.21.10 |
| af_O81024_43_107_3.30.710.10 | Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A | 0.7946 | 195 | 218 | 3.30.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535IR44-F1-model_v4 | Metallophosphoesterase family protein | 0.995 | 26 | 198 |
GO:0005737
GO:0016791 |
| AF-A0A1F8SHN9-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 0.9948 | 3 | 249 |
GO:0005737
GO:0016791 |
| AF-A0A535VSG3-F1-model_v4 | Metallophosphoesterase family protein | 0.9899 | 1 | 249 |
GO:0005737
GO:0016791 |
| AF-A0A3L7VZ11-F1-model_v4 | Metallophosphoesterase | 0.9886 | 3 | 249 |
GO:0005737
GO:0016791 |
| AF-A0A1F8SHN9-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 0.9868 | 3 | 249 |
GO:0005737
GO:0016791 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar