F469833

General Info

Members Datasets Scaffolds Average Seq Length
619 267 619 247

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10089120|Ga0307406_100891202
Length 282
Sequence MAQGASPGTSGSGALARGLASALRCTTLARRSALVTARVAVLSDVHGNATALDAVRKEIRREKPDAVIVAGDLVLNGPQPAEALDGVRELEAEGAVVVQGNTDVAVADFDYTAAFPWLTDGVPDAFRAAAEWANDELGDDRLAWIRRLPSERRLLLDDTMVLACHASPGSQTQGFDQALDASVVLERVSRTDARVICCGHTHLPDVRDLGWKVIVNDGSAGYVFDGDPTASWALVTIDDDVVSAEIRRVEFDTMAVSNAISARGLPGDVYRAATVRTGKLVR

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
140 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
141 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
142 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
160 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
178 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
179 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
182 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 9.37
Rhizosphere 89.5
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10085238 3300003323 Bacteria 2553
2 Ga0070676_10057451 3300005328 Bacteria 2303
3 Ga0070676_10178133 3300005328 Bacteria 1380
4 Ga0070683_100059475 3300005329 Bacteria 3550
5 Ga0068869_100026718 3300005334 Bacteria 4019
6 Ga0068869_100290295 3300005334 Bacteria 1318
7 Ga0068869_100393423 3300005334 Unclassified 1138
8 Ga0070680_100000017 3300005336 Bacteria 89028
9 Ga0070680_100245671 3300005336 Bacteria 1513
10 Ga0070680_100260497 3300005336 Unclassified 1467
11 Ga0070682_100059049 3300005337 Bacteria 2421
12 Ga0070682_100176443 3300005337 Bacteria 1489
13 Ga0070660_100028487 3300005339 Bacteria 4180
14 Ga0070689_100008190 3300005340 Bacteria 7347
15 Ga0070687_100016213 3300005343 Bacteria 3391
16 Ga0070687_100021735 3300005343 Bacteria 3021
17 Ga0070687_100314176 3300005343 Unclassified 999
18 Ga0070661_100286533 3300005344 Bacteria 1279
19 Ga0070692_10022870 3300005345 Bacteria 3058
20 Ga0070692_10239418 3300005345 Unclassified 1081
21 Ga0070669_100108690 3300005353 Bacteria 2102
22 Ga0070675_100509041 3300005354 Bacteria 1085
23 Ga0070671_100354117 3300005355 Bacteria 1253
24 Ga0070671_100359176 3300005355 Bacteria 1244
25 Ga0070674_100011524 3300005356 Bacteria 5387
26 Ga0070674_100043227 3300005356 Bacteria 3064
27 Ga0070673_100046216 3300005364 Bacteria 3380
28 Ga0070659_100001254 3300005366 Bacteria 18424
29 Ga0070659_100517941 3300005366 Bacteria 1018
30 Ga0070667_100116907 3300005367 Unclassified 2316
31 Ga0070667_100507541 3300005367 Bacteria 1106
32 Ga0070703_10069007 3300005406 Unclassified 1176
33 Ga0070710_10045553 3300005437 Bacteria 2439
34 Ga0070701_10005841 3300005438 Bacteria 5128
35 Ga0070705_100076888 3300005440 Bacteria 2037
36 Ga0070705_100093910 3300005440 Bacteria 1877
37 Ga0070705_100113057 3300005440 Bacteria 1739
38 Ga0070700_100011673 3300005441 Bacteria 4873
39 Ga0070700_100016631 3300005441 Bacteria 4194
40 Ga0070694_100007643 3300005444 Bacteria 6597
41 Ga0070694_100146795 3300005444 Bacteria 1719
42 Ga0070694_100161800 3300005444 Bacteria 1643
43 Ga0070694_100185351 3300005444 Bacteria 1542
44 Ga0070694_100247692 3300005444 Bacteria 1347
45 Ga0070708_100004866 3300005445 Bacteria 10605
46 Ga0070708_100005521 3300005445 Bacteria 10023
47 Ga0070708_100005677 3300005445 Bacteria 9897
48 Ga0070708_100070232 3300005445 Bacteria 3150
49 Ga0070708_100109168 3300005445 Bacteria 2541
50 Ga0070708_100209369 3300005445 Bacteria 1827
51 Ga0070708_100368043 3300005445 Bacteria 1355
52 Ga0070708_100368550 3300005445 Unclassified 1354
53 Ga0070662_100123093 3300005457 Bacteria 1990
54 Ga0070662_100267132 3300005457 Unclassified 1380
55 Ga0070662_100382500 3300005457 Unclassified 1159
56 Ga0070662_100494152 3300005457 Bacteria 1020
57 Ga0070681_10144683 3300005458 Bacteria 2307
58 Ga0070681_10234517 3300005458 Bacteria 1749
59 Ga0070681_10551696 3300005458 Bacteria 1066
60 Ga0068867_100021085 3300005459 Bacteria 4647
61 Ga0068867_100095244 3300005459 Bacteria 2265
62 Ga0070685_10001599 3300005466 Bacteria 11940
63 Ga0070706_100003060 3300005467 Bacteria 16555
64 Ga0070706_100006194 3300005467 Bacteria 11319
65 Ga0070706_100007252 3300005467 Bacteria 10413
66 Ga0070706_100017669 3300005467 Bacteria 6582
67 Ga0070706_100102428 3300005467 Bacteria 2661
68 Ga0070706_100155512 3300005467 Bacteria 2135
69 Ga0070706_100308048 3300005467 Bacteria 1477
70 Ga0070707_100000801 3300005468 Bacteria 31024
71 Ga0070707_100003407 3300005468 Bacteria 15021
72 Ga0070707_100011540 3300005468 Bacteria 8238
73 Ga0070707_100017426 3300005468 Bacteria 6752
74 Ga0070707_100093270 3300005468 Bacteria 2915
75 Ga0070707_100119668 3300005468 Bacteria 2556
76 Ga0070707_100689554 3300005468 Bacteria 984
77 Ga0070698_100016493 3300005471 Bacteria 7795
78 Ga0070698_100033589 3300005471 Bacteria 5314
79 Ga0070698_100133443 3300005471 Bacteria 2437
80 Ga0070698_100211164 3300005471 Unclassified 1876
81 Ga0070698_100225429 3300005471 Bacteria 1807
82 Ga0070699_100002964 3300005518 Bacteria 15086
83 Ga0070699_100013871 3300005518 Bacteria 6931
84 Ga0070699_100019715 3300005518 Bacteria 5812
85 Ga0070699_100030402 3300005518 Bacteria 4662
86 Ga0070699_100089605 3300005518 Bacteria 2688
87 Ga0070699_100389430 3300005518 Bacteria 1259
88 Ga0070679_100250578 3300005530 Bacteria 1727
89 Ga0070684_100020234 3300005535 Bacteria 5520
90 Ga0070697_100027553 3300005536 Bacteria 4546
91 Ga0070697_100031377 3300005536 Bacteria 4275
92 Ga0070697_100045945 3300005536 Bacteria 3539
93 Ga0070697_100216313 3300005536 Bacteria 1632
94 Ga0070697_100445520 3300005536 Bacteria 1127
95 Ga0070672_100037813 3300005543 Bacteria 3684
96 Ga0070686_100004260 3300005544 Bacteria 7886
97 Ga0070686_100354965 3300005544 Bacteria 1103
98 Ga0070686_100646678 3300005544 Unclassified 838
99 Ga0070695_100008654 3300005545 Bacteria 6046
100 Ga0070695_100158627 3300005545 Bacteria 1586
101 Ga0070695_100176591 3300005545 Unclassified 1510
102 Ga0070695_100272252 3300005545 Bacteria 1241
103 Ga0070696_100007567 3300005546 Bacteria 7264
104 Ga0070696_100011346 3300005546 Bacteria 5965
105 Ga0070696_100015083 3300005546 Bacteria 5188
106 Ga0070696_100023149 3300005546 Bacteria 4222
107 Ga0070696_100048724 3300005546 Bacteria 2941
108 Ga0070696_100179323 3300005546 Bacteria 1571
109 Ga0070696_100361259 3300005546 Unclassified 1127
110 Ga0070693_100023998 3300005547 Bacteria 3266
111 Ga0070693_100241681 3300005547 Bacteria 1193
112 Ga0070665_100165311 3300005548 Archaea 2215
113 Ga0070704_100049997 3300005549 Bacteria 2936
114 Ga0070704_100050388 3300005549 Bacteria 2926
115 Ga0070704_100164392 3300005549 Bacteria 1758
116 Ga0070704_100625062 3300005549 Bacteria 949
117 Ga0068855_100263284 3300005563 Bacteria 1920
118 Ga0070664_100037315 3300005564 Bacteria 4085
119 Ga0068857_100063492 3300005577 Bacteria 3283
120 Ga0068857_100504187 3300005577 Unclassified 1136
121 Ga0068857_100626438 3300005577 Bacteria 1018
122 Ga0068854_100059036 3300005578 Bacteria 2771
123 Ga0068854_100445922 3300005578 Bacteria 1080
124 Ga0070702_100003455 3300005615 Bacteria 7069
125 Ga0068859_100021864 3300005617 Bacteria 6415
126 Ga0068864_100004764 3300005618 Bacteria 11117
127 Ga0068864_100014338 3300005618 Bacteria 6583
128 Ga0068864_100192010 3300005618 Bacteria 1873
129 Ga0068866_10053430 3300005718 Bacteria 2065
130 Ga0068861_100127663 3300005719 Bacteria 2060
131 Ga0068861_100158652 3300005719 Bacteria 1864
132 Ga0068861_100388444 3300005719 Bacteria 1235
133 Ga0068861_100525228 3300005719 Bacteria 1074
134 Ga0068861_100692070 3300005719 Unclassified 946
135 Ga0068870_10074470 3300005840 Bacteria 1860
136 Ga0068863_100017340 3300005841 Bacteria 6905
137 Ga0068863_100807831 3300005841 Bacteria 936
138 Ga0068858_100027875 3300005842 Bacteria 5248
139 Ga0068858_100428803 3300005842 Bacteria 1272
140 Ga0068860_100025839 3300005843 Bacteria 5664
141 Ga0068860_100243166 3300005843 Bacteria 1751
142 Ga0068860_100460906 3300005843 Unclassified 1265
143 Ga0068862_100149931 3300005844 Bacteria 2075
144 Ga0068862_100282746 3300005844 Bacteria 1521
145 Ga0081455_10157510 3300005937 Bacteria 1744
146 Ga0081539_10002426 3300005985 Bacteria 26337
147 Ga0081539_10007841 3300005985 Bacteria 9540
148 Ga0075365_10070077 3300006038 Bacteria 2357
149 Ga0075432_10036019 3300006058 Bacteria 1720
150 Ga0070716_100217590 3300006173 Bacteria 1281
151 Ga0068871_100740335 3300006358 Bacteria 903
152 Ga0075428_100027425 3300006844 Bacteria 6303
153 Ga0075428_100035631 3300006844 Bacteria 5485
154 Ga0075433_10049991 3300006852 Bacteria 3639
155 Ga0075433_10235102 3300006852 Bacteria 1627
156 Ga0075434_100083149 3300006871 Bacteria 3199
157 Ga0075434_100098838 3300006871 Bacteria 2923
158 Ga0075434_100301940 3300006871 Bacteria 1621
159 Ga0075434_100425794 3300006871 Unclassified 1349
160 Ga0068865_100020409 3300006881 Bacteria 4295
161 Ga0097620_100021863 3300006931 Bacteria 6415
162 Ga0075435_100218131 3300007076 Unclassified 1619
163 Ga0075435_100302508 3300007076 Unclassified 1368
164 Ga0111539_10004889 3300009094 Bacteria 17446
165 Ga0111539_10308924 3300009094 Unclassified 1840
166 Ga0111539_10396684 3300009094 Bacteria 1607
167 Ga0111539_10526823 3300009094 Bacteria 1377
168 Ga0105245_10029313 3300009098 Bacteria 4861
169 Ga0105245_10040835 3300009098 Bacteria 4134
170 Ga0105245_10114566 3300009098 Bacteria 2511
171 Ga0105245_10121887 3300009098 Bacteria 2437
172 Ga0105245_10320671 3300009098 Bacteria 1526
173 Ga0105245_10609428 3300009098 Unclassified 1119
174 Ga0105247_10514383 3300009101 Bacteria 874
175 Ga0114129_10159335 3300009147 Bacteria 3085
176 Ga0114129_10221665 3300009147 Bacteria 2551
177 Ga0114129_10221849 3300009147 Bacteria 2550
178 Ga0114129_10401639 3300009147 Bacteria 1806
179 Ga0114129_10519277 3300009147 Unclassified 1553
180 Ga0105243_10003260 3300009148 Bacteria 13210
181 Ga0105243_10137149 3300009148 Bacteria 2083
182 Ga0105243_10215588 3300009148 Bacteria 1693
183 Ga0105243_10323800 3300009148 Bacteria 1406
184 Ga0105243_10411104 3300009148 Bacteria 1259
185 Ga0105242_10097352 3300009176 Bacteria 2487
186 Ga0105242_10228881 3300009176 Bacteria 1665
187 Ga0105242_10482369 3300009176 Bacteria 1175
188 Ga0105248_10015938 3300009177 Bacteria 8277
189 Ga0105237_10240695 3300009545 Bacteria 1811
190 Ga0105249_10003293 3300009553 Bacteria 13999
191 Ga0105249_10041803 3300009553 Bacteria 4168
192 Ga0105239_10531452 3300010375 Unclassified 1338
193 Ga0105246_10007352 3300011119 Bacteria 6749
194 Ga0105246_10080470 3300011119 Bacteria 2319
195 Ga0105246_10358750 3300011119 Bacteria 1197
196 Ga0157374_10200263 3300013296 Bacteria 1955
197 Ga0157374_10377875 3300013296 Unclassified 1411
198 Ga0157374_11195941 3300013296 Unclassified 781
199 Ga0157378_10023119 3300013297 Bacteria 5470
200 Ga0157378_10038091 3300013297 Bacteria 4260
201 Ga0163162_10353198 3300013306 Bacteria 1603
202 Ga0157375_10040061 3300013308 Bacteria 4513
203 Ga0163163_10001601 3300014325 Bacteria 19022
204 Ga0163163_10034936 3300014325 Bacteria 4873
205 Ga0163163_10090013 3300014325 Bacteria 3082
206 Ga0163163_10388244 3300014325 Archaea 1454
207 Ga0163163_10463491 3300014325 Bacteria 1328
208 Ga0163163_10944872 3300014325 Unclassified 925
209 Ga0157380_10015679 3300014326 Bacteria 5571
210 Ga0157380_10060361 3300014326 Bacteria 3030
211 Ga0157380_10110099 3300014326 Bacteria 2312
212 Ga0157380_10266662 3300014326 Bacteria 1558
213 Ga0157380_10659157 3300014326 Bacteria 1045
214 Ga0182008_10137899 3300014497 Bacteria 1219
215 Ga0182008_10143276 3300014497 Unclassified 1196
216 Ga0157377_10150081 3300014745 Bacteria 1440
217 Ga0157379_10016312 3300014968 Bacteria 6534
218 Ga0157379_10056856 3300014968 Bacteria 3496
219 Ga0157379_10262858 3300014968 Bacteria 1568
220 Ga0157379_10532750 3300014968 Bacteria 1091
221 Ga0157376_10498166 3300014969 Bacteria 1197
222 Ga0163161_10018664 3300017792 Bacteria 4862
223 Ga0207653_10075184 3300025885 Unclassified 1160
224 Ga0207692_10094986 3300025898 Bacteria 1625
225 Ga0207642_10015491 3300025899 Bacteria 2843
226 Ga0207688_10011966 3300025901 Bacteria 4721
227 Ga0207688_10017254 3300025901 Bacteria 3922
228 Ga0207645_10079127 3300025907 Bacteria 2107
229 Ga0207643_10053164 3300025908 Bacteria 2301
230 Ga0207684_10002333 3300025910 Bacteria 19236
231 Ga0207684_10024521 3300025910 Bacteria 5142
232 Ga0207684_10028026 3300025910 Bacteria 4798
233 Ga0207684_10110452 3300025910 Bacteria 2353
234 Ga0207707_10194055 3300025912 Bacteria 1771
235 Ga0207671_10224882 3300025914 Bacteria 1471
236 Ga0207660_10000002 3300025917 Bacteria 883566
237 Ga0207660_10179408 3300025917 Bacteria 1644
238 Ga0207660_10241022 3300025917 Bacteria 1424
239 Ga0207660_10280305 3300025917 Bacteria 1323
240 Ga0207662_10000529 3300025918 Bacteria 16963
241 Ga0207662_10015221 3300025918 Bacteria 4326
242 Ga0207649_10066170 3300025920 Bacteria 2290
243 Ga0207649_10129535 3300025920 Bacteria 1712
244 Ga0207652_10253379 3300025921 Bacteria 1587
245 Ga0207646_10000242 3300025922 Bacteria 74986
246 Ga0207646_10001771 3300025922 Bacteria 26150
247 Ga0207646_10002780 3300025922 Bacteria 20440
248 Ga0207646_10051567 3300025922 Bacteria 3681
249 Ga0207646_10067562 3300025922 Bacteria 3191
250 Ga0207646_10104516 3300025922 Bacteria 2540
251 Ga0207646_10298562 3300025922 Bacteria 1455
252 Ga0207681_10397759 3300025923 Bacteria 1112
253 Ga0207687_10002819 3300025927 Bacteria 11786
254 Ga0207687_10080859 3300025927 Bacteria 2347
255 Ga0207687_10337703 3300025927 Bacteria 1224
256 Ga0207690_10027392 3300025932 Bacteria 3601
257 Ga0207690_10365367 3300025932 Bacteria 1144
258 Ga0207706_10219201 3300025933 Archaea 1666
259 Ga0207706_10310939 3300025933 Bacteria 1372
260 Ga0207706_10474706 3300025933 Unclassified 1081
261 Ga0207706_10575193 3300025933 Unclassified 969
262 Ga0207709_10070615 3300025935 Bacteria 2215
263 Ga0207670_10023513 3300025936 Bacteria 3837
264 Ga0207669_10115832 3300025937 Bacteria 1807
265 Ga0207669_10210909 3300025937 Bacteria 1418
266 Ga0207704_10033692 3300025938 Bacteria 2916
267 Ga0207665_10350384 3300025939 Bacteria 1114
268 Ga0207691_10052756 3300025940 Bacteria 3713
269 Ga0207711_10036437 3300025941 Bacteria 4174
270 Ga0207711_10248815 3300025941 Bacteria 1632
271 Ga0207711_10410255 3300025941 Unclassified 1259
272 Ga0207689_10095526 3300025942 Bacteria 2441
273 Ga0207689_10113348 3300025942 Bacteria 2229
274 Ga0207689_10277739 3300025942 Bacteria 1387
275 Ga0207661_10223944 3300025944 Bacteria 1663
276 Ga0207679_10121656 3300025945 Bacteria 2079
277 Ga0207667_10460639 3300025949 Bacteria 1291
278 Ga0207712_10030826 3300025961 Bacteria 3608
279 Ga0207712_10152994 3300025961 Bacteria 1784
280 Ga0207668_10378201 3300025972 Bacteria 1191
281 Ga0207640_10118211 3300025981 Bacteria 1893
282 Ga0207658_10659487 3300025986 Bacteria 944
283 Ga0207639_10355397 3300026041 Bacteria 1310
284 Ga0207678_10005302 3300026067 Bacteria 11544
285 Ga0207678_10381249 3300026067 Bacteria 1219
286 Ga0207708_10004427 3300026075 Bacteria 10354
287 Ga0207708_10030098 3300026075 Bacteria 4118
288 Ga0207708_10067135 3300026075 Bacteria 2743
289 Ga0207708_10111719 3300026075 Bacteria 2122
290 Ga0207641_10236758 3300026088 Unclassified 1699
291 Ga0207641_10358419 3300026088 Bacteria 1392
292 Ga0207648_10015157 3300026089 Bacteria 7095
293 Ga0207648_10236883 3300026089 Bacteria 1624
294 Ga0207676_10121903 3300026095 Bacteria 2200
295 Ga0207674_10005296 3300026116 Bacteria 15344
296 Ga0207675_100017272 3300026118 Bacteria 6737
297 Ga0207675_100079669 3300026118 Bacteria 3070
298 Ga0207675_100342177 3300026118 Bacteria 1464
299 Ga0207675_100560518 3300026118 Unclassified 1142
300 Ga0207683_10023294 3300026121 Bacteria 5325
301 Ga0207683_10283820 3300026121 Bacteria 1513
302 Ga0207683_10284381 3300026121 Bacteria 1512
303 Ga0207698_10118044 3300026142 Bacteria 2239
304 Ga0207698_10182010 3300026142 Bacteria 1862
305 Ga0209983_1020749 3300027665 Unclassified 1371
306 Ga0268266_10139868 3300028379 Archaea 2172
307 Ga0268266_10333738 3300028379 Bacteria 1422
308 Ga0268265_10093106 3300028380 Bacteria 2414
309 Ga0268265_10424478 3300028380 Bacteria 1235
310 Ga0268265_10541615 3300028380 Unclassified 1104
311 Ga0268264_10071403 3300028381 Bacteria 2942
312 Ga0268264_10173127 3300028381 Bacteria 1954
313 Ga0268264_10196675 3300028381 Bacteria 1841
314 Ga0265337_1012246 3300028556 Bacteria 2923
315 Ga0265326_10011919 3300028558 Bacteria 2558
316 Ga0265326_10019353 3300028558 Bacteria 1957
317 Ga0265319_1011171 3300028563 Bacteria 3696
318 Ga0265319_1040373 3300028563 Bacteria 1578
319 Ga0265319_1080330 3300028563 Bacteria 1036
320 Ga0265334_10005048 3300028573 Bacteria 5791
321 Ga0265334_10005311 3300028573 Bacteria 5631
322 Ga0265334_10013793 3300028573 Bacteria 3377
323 Ga0265334_10016047 3300028573 Bacteria 3101
324 Ga0265318_10050579 3300028577 Bacteria 1561
325 Ga0265322_10001920 3300028654 Bacteria 6581
326 Ga0265338_10044626 3300028800 Bacteria 4089
327 Ga0265338_10117028 3300028800 Unclassified 2134
328 Ga0265338_10269109 3300028800 Bacteria 1249
329 Ga0265338_10409044 3300028800 Bacteria 966
330 Ga0265324_10003860 3300029957 Bacteria 6992
331 Ga0265332_10017091 3300031238 Bacteria 3200
332 Ga0265320_10004319 3300031240 Bacteria 9335
333 Ga0265320_10006704 3300031240 Bacteria 7235
334 Ga0265320_10034647 3300031240 Bacteria 2566
335 Ga0265320_10165017 3300031240 Bacteria 996
336 Ga0265325_10026920 3300031241 Bacteria 3111
337 Ga0265325_10064884 3300031241 Bacteria 1845
338 Ga0265325_10070821 3300031241 Bacteria 1751
339 Ga0265325_10133967 3300031241 Bacteria 1184
340 Ga0265325_10189040 3300031241 Bacteria 955
341 Ga0265329_10004814 3300031242 Bacteria 5545
342 Ga0265329_10006530 3300031242 Bacteria 4616
343 Ga0265329_10042087 3300031242 Unclassified 1464
344 Ga0265329_10095915 3300031242 Unclassified 943
345 Ga0265340_10007157 3300031247 Bacteria 6077
346 Ga0265340_10065163 3300031247 Bacteria 1735
347 Ga0265339_10049559 3300031249 Bacteria 2299
348 Ga0265339_10196504 3300031249 Bacteria 997
349 Ga0265331_10025696 3300031250 Bacteria 2969
350 Ga0265316_10002667 3300031344 Bacteria 18375
351 Ga0265316_10026393 3300031344 Bacteria 4833
352 Ga0265316_10064015 3300031344 Bacteria 2849
353 Ga0265316_10071911 3300031344 Bacteria 2665
354 Ga0265316_10273366 3300031344 Bacteria 1236
355 Ga0307408_100443910 3300031548 Bacteria 1124
356 Ga0265313_10047487 3300031595 Bacteria 2077
357 Ga0265313_10118922 3300031595 Bacteria 1154
358 Ga0265314_10009807 3300031711 Bacteria 8042
359 Ga0265342_10119607 3300031712 Bacteria 1484
360 Ga0316576_10003347 3300031727 Bacteria 9376
361 Ga0316578_10038766 3300031728 Bacteria 2750
362 Ga0316578_10148365 3300031728 Bacteria 1413
363 Ga0307413_10042574 3300031824 Bacteria 2670
364 Ga0307406_10089120 3300031901 Bacteria 2072
365 Ga0307412_10073249 3300031911 Bacteria 2343
366 Ga0307409_100330011 3300031995 Bacteria 1431
367 Ga0307416_100001530 3300032002 Bacteria 12643
368 Ga0307416_100042420 3300032002 Bacteria 3551
369 Ga0307411_10075676 3300032005 Bacteria 2299
370 Ga0307411_10137607 3300032005 Unclassified 1796
371 Ga0307415_100004758 3300032126 Bacteria 7106
372 Ga0316583_10024660 3300032133 Bacteria 2148
373 Ga0373943_0097971 3300035170 Bacteria 1529
374 Ga0316574_0056841 3300035398 Bacteria 2448
375 Ga0316574_0129354 3300035398 Unclassified 1624
376 Ga0316574_0155703 3300035398 Bacteria 1472
377 Ga0373931_0017708 3300035691 Bacteria 3529
378 Ga0373931_0292643 3300035691 Bacteria 1003
379 Ga0373947_0121441 3300035725 Unclassified 1660
380 Ga0373937_0074732 3300036401 Bacteria 3128
381 Ga0373937_0108546 3300036401 Bacteria 2581
382 Ga0316584_0051705 3300036712 Bacteria 3073
383 Ga0316584_0299814 3300036712 Bacteria 1164
384 Ga0373925_0432076 3300037068 Bacteria 1077
385 Ga0373925_0716030 3300037068 Bacteria 825
386 Ga0436365_1187677 3300039437 Bacteria 3178
387 Ga0439466_0025622 3300041411 Bacteria 2058
388 Ga0451833_0052944 3300041491 Bacteria 723
389 Ga0451835_0571311 3300041492 Bacteria 875
390 Ga0451853_3294679 3300041512 Bacteria 1143
391 Ga0439452_052774 3300042010 Bacteria 927
392 Ga0450910_001576 3300042147 Bacteria 2904
393 Ga0439446_0006670 3300042156 Bacteria 3019
394 Ga0451577_0067962 3300042876 Bacteria 3179
395 Ga0453683_0018350 3300044673 Bacteria 4492
396 Ga0453684_0195068 3300044712 Bacteria 2366
397 Ga0451576_0259412 3300045051 Bacteria 1816
398 Ga0451576_0296374 3300045051 Bacteria 1691
399 Ga0495653_0116138 3300046463 Bacteria 1914
400 Ga0495582_0144782 3300046473 Unclassified 1348
401 Ga0495594_0390767 3300046499 Unclassified 792
402 Ga0495608_0075608 3300046511 Bacteria 2195
403 Ga0495618_0028799 3300046514 Bacteria 3462
404 Ga0495630_0139549 3300046517 Unclassified 1843
405 Ga0495630_0317841 3300046517 Bacteria 1190
406 Ga0495640_0027262 3300046533 Bacteria 4122
407 Ga0495645_0021864 3300046543 Bacteria 4626
408 Ga0495667_0135306 3300046559 Bacteria 1589
409 Ga0495634_0048693 3300046642 Bacteria 2852
410 Ga0495634_0090953 3300046642 Bacteria 1982
411 Ga0495599_0176410 3300046678 Unclassified 1318
412 Ga0495624_0240882 3300046690 Bacteria 1095
413 Ga0495674_0212310 3300047319 Bacteria 1603
414 Ga0495674_0644344 3300047319 Bacteria 836
415 Ga0495676_0135233 3300047321 Bacteria 1774
416 Ga0495676_0156564 3300047321 Bacteria 1616
417 Ga0495676_0178840 3300047321 Bacteria 1488
418 Ga0495680_0242704 3300047322 Bacteria 1279
419 Ga0495684_0026185 3300047471 Bacteria 4481
420 Ga0495602_0174476 3300048088 Bacteria 1665
421 Ga0496100_0130501 3300048903 Bacteria 1769
422 Ga0496100_0445528 3300048903 Bacteria 992
423 Ga0496101_0045212 3300048904 Bacteria 3153
424 Ga0496102_0020554 3300048905 Bacteria 5834
425 Ga0496102_0177775 3300048905 Bacteria 2004
426 Ga0496102_0367705 3300048905 Unclassified 1354
427 Ga0496102_0513196 3300048905 Bacteria 1121
428 Ga0496103_0038350 3300048906 Bacteria 2939
429 Ga0496103_0078846 3300048906 Bacteria 2069
430 Ga0496103_0114077 3300048906 Bacteria 1718
431 Ga0496103_0152571 3300048906 Bacteria 1480
432 Ga0496104_0004073 3300048907 Bacteria 12678
433 Ga0496104_0113611 3300048907 Bacteria 2597
434 Ga0496105_0114493 3300048908 Bacteria 2224
435 Ga0496105_0165233 3300048908 Bacteria 1816
436 Ga0496105_0262741 3300048908 Bacteria 1396
437 Ga0496105_0408695 3300048908 Bacteria 1076
438 Ga0496105_0638715 3300048908 Bacteria 822
439 Ga0496106_0025010 3300048909 Bacteria 4442
440 Ga0496106_0081043 3300048909 Bacteria 2493
441 Ga0496106_0106501 3300048909 Bacteria 2179
442 Ga0496107_0094341 3300048910 Bacteria 2189
443 Ga0496107_0254001 3300048910 Bacteria 1308
444 Ga0496108_0194693 3300048911 Bacteria 1758
445 Ga0496108_0202834 3300048911 Archaea 1721
446 Ga0496108_0376659 3300048911 Bacteria 1239
447 Ga0496108_0727419 3300048911 Bacteria 859
448 Ga0496109_0031655 3300048912 Bacteria 4750
449 Ga0496109_0045957 3300048912 Bacteria 3964
450 Ga0496109_0149928 3300048912 Bacteria 2183
451 Ga0496109_0152001 3300048912 Bacteria 2167
452 Ga0496109_0153238 3300048912 Bacteria 2158
453 Ga0496109_0191236 3300048912 Bacteria 1923
454 Ga0496110_0020398 3300048913 Bacteria 5597
455 Ga0496110_0023514 3300048913 Bacteria 5243
456 Ga0496110_0094608 3300048913 Bacteria 2675
457 Ga0496110_0133093 3300048913 Bacteria 2246
458 Ga0496110_0150850 3300048913 Bacteria 2105
459 Ga0496110_0709662 3300048913 Bacteria 908
460 Ga0496111_0035164 3300048914 Bacteria 3579
461 Ga0496111_0043839 3300048914 Bacteria 3216
462 Ga0496111_0098152 3300048914 Bacteria 2151
463 Ga0496111_0189387 3300048914 Bacteria 1529
464 Ga0496112_0000001 3300048915 Bacteria 1346031
465 Ga0496112_0036152 3300048915 Bacteria 4816
466 Ga0496112_0080161 3300048915 Bacteria 3228
467 Ga0496112_0279205 3300048915 Unclassified 1618
468 Ga0496112_0304593 3300048915 Bacteria 1539
469 Ga0496113_0046786 3300048916 Bacteria 3213
470 Ga0496113_0097754 3300048916 Bacteria 2272
471 Ga0496113_0107300 3300048916 Bacteria 2170
472 Ga0496113_0128619 3300048916 Bacteria 1985
473 Ga0496113_0278639 3300048916 Unclassified 1337
474 Ga0496113_0360335 3300048916 Bacteria 1167
475 Ga0496113_0456483 3300048916 Bacteria 1027
476 Ga0496114_0069221 3300048917 Bacteria 2963
477 Ga0496114_0119383 3300048917 Bacteria 2267
478 Ga0496114_0376805 3300048917 Bacteria 1256
479 Ga0501031_0053617 3300049568 Bacteria 2628
480 Ga0501031_0103539 3300049568 Bacteria 1857
481 Ga0501032_0091059 3300049569 Bacteria 2024
482 Ga0501032_0324184 3300049569 Bacteria 994
483 Ga0501033_0105662 3300049570 Bacteria 2052
484 Ga0501036_0041243 3300049572 Bacteria 3905
485 Ga0501036_0162363 3300049572 Bacteria 1883
486 Ga0501036_0578170 3300049572 Bacteria 933
487 Ga0501038_0034784 3300049574 Bacteria 4427
488 Ga0501038_0110908 3300049574 Bacteria 2273
489 Ga0501039_0019044 3300049575 Bacteria 5267
490 Ga0501039_0033529 3300049575 Bacteria 3960
491 Ga0501039_0137521 3300049575 Bacteria 1918
492 Ga0501039_0232787 3300049575 Bacteria 1448
493 Ga0501039_0516080 3300049575 Bacteria 938
494 Ga0501039_0552635 3300049575 Unclassified 903
495 Ga0501040_0004634 3300049576 Bacteria 8922
496 Ga0501040_0016358 3300049576 Bacteria 4909
497 Ga0501040_0092571 3300049576 Bacteria 2102
498 Ga0501040_0104469 3300049576 Bacteria 1978
499 Ga0501040_0194440 3300049576 Bacteria 1440
500 Ga0501041_0009827 3300049577 Bacteria 5632
501 Ga0501041_0050100 3300049577 Bacteria 2545
502 Ga0501041_0056691 3300049577 Bacteria 2395
503 Ga0501041_0058167 3300049577 Bacteria 2364
504 Ga0501041_0467534 3300049577 Bacteria 801
505 Ga0501042_0035112 3300049578 Bacteria 3557
506 Ga0501042_0072313 3300049578 Bacteria 2467
507 Ga0501043_0042893 3300049579 Bacteria 3556
508 Ga0501046_0046011 3300049580 Bacteria 3464
509 Ga0501046_0269924 3300049580 Bacteria 1248
510 Ga0501046_0362404 3300049580 Bacteria 1051
511 Ga0501048_0025817 3300049582 Bacteria 4280
512 Ga0501048_0097641 3300049582 Bacteria 2072
513 Ga0501067_0034172 3300049583 Bacteria 2821
514 Ga0501067_0053969 3300049583 Bacteria 2227
515 Ga0501067_0113076 3300049583 Bacteria 1510
516 Ga0501068_0019660 3300049584 Bacteria 3925
517 Ga0501068_0047355 3300049584 Bacteria 2594
518 Ga0501068_0443742 3300049584 Bacteria 839
519 Ga0501069_0032879 3300049585 Bacteria 2855
520 Ga0501069_0239288 3300049585 Bacteria 1058
521 Ga0501070_0020428 3300049586 Bacteria 5555
522 Ga0501071_0028451 3300049587 Bacteria 3940
523 Ga0501071_0171981 3300049587 Bacteria 1621
524 Ga0501071_0191313 3300049587 Bacteria 1535
525 Ga0501071_0225308 3300049587 Bacteria 1412
526 Ga0501071_0444381 3300049587 Bacteria 992
527 Ga0501071_0658300 3300049587 Bacteria 806
528 Ga0501071_0734626 3300049587 Bacteria 760
529 Ga0501072_0026651 3300049588 Bacteria 4506
530 Ga0501072_0056727 3300049588 Bacteria 3086
531 Ga0501072_0070912 3300049588 Bacteria 2752
532 Ga0501072_0296997 3300049588 Unclassified 1284
533 Ga0501073_0086292 3300049589 Bacteria 2183
534 Ga0501074_0032079 3300049590 Bacteria 3808
535 Ga0501075_0016498 3300049591 Bacteria 5321
536 Ga0501075_0100704 3300049591 Bacteria 2194
537 Ga0501075_0129528 3300049591 Bacteria 1922
538 Ga0501075_0355531 3300049591 Bacteria 1116
539 Ga0501076_0017957 3300049592 Bacteria 5381
540 Ga0501076_0020719 3300049592 Bacteria 5034
541 Ga0501076_0041412 3300049592 Bacteria 3624
542 Ga0501076_0071535 3300049592 Bacteria 2775
543 Ga0501076_0115936 3300049592 Bacteria 2167
544 Ga0501076_0133749 3300049592 Unclassified 2012
545 Ga0501077_0011899 3300049593 Bacteria 5443
546 Ga0501077_0130262 3300049593 Unclassified 1595
547 Ga0501079_0012810 3300049741 Bacteria 6402
548 Ga0501079_0025725 3300049741 Bacteria 4513
549 Ga0501079_0193100 3300049741 Bacteria 1589
550 Ga0501079_0216089 3300049741 Bacteria 1498
551 Ga0501079_0413531 3300049741 Bacteria 1058
552 Ga0501079_0461999 3300049741 Bacteria 997
553 Ga0501080_0024726 3300049742 Bacteria 5570
554 Ga0501080_0030769 3300049742 Bacteria 5001
555 Ga0501080_0058497 3300049742 Bacteria 3588
556 Ga0501080_0153340 3300049742 Bacteria 2129
557 Ga0501080_0170393 3300049742 Bacteria 2008
558 Ga0501081_0041445 3300049743 Bacteria 3153
559 Ga0501081_0049914 3300049743 Bacteria 2882
560 Ga0501081_0104642 3300049743 Bacteria 2004
561 Ga0501083_0026740 3300049744 Bacteria 3986
562 Ga0501035_0064880 3300049822 Bacteria 3244
563 Ga0501035_0100151 3300049822 Bacteria 2544
564 Ga0501035_0309690 3300049822 Bacteria 1329
565 Ga0501044_0082695 3300049823 Bacteria 3248
566 Ga0501045_0005766 3300049824 Bacteria 8568
567 Ga0501045_0019048 3300049824 Bacteria 4888
568 Ga0501045_0021477 3300049824 Bacteria 4617
569 Ga0501045_0110611 3300049824 Bacteria 2037
570 Ga0501045_0181971 3300049824 Bacteria 1566
571 Ga0501045_0266678 3300049824 Unclassified 1275
572 Ga0501045_0341010 3300049824 Archaea 1115
573 nmdc:mga0yw44_319676_c1 3300050492 Bacteria 1042
574 nmdc:mga05p37_1824_c1 3300050507 Bacteria 24835
575 nmdc:mga05p37_313751_c1 3300050507 Bacteria 1858
576 nmdc:mga05p37_448416_c1 3300050507 Bacteria 1494
577 nmdc:mga05p37_45265_c1 3300050507 Bacteria 5414
578 nmdc:mga09592_13035_c1 3300050508 Bacteria 6785
579 nmdc:mga08y16_67995_c1 3300050511 Bacteria 3716
580 nmdc:mga08y16_683861_c1 3300050511 Bacteria 1027
581 nmdc:mga0n895_166620_c1 3300050512 Bacteria 2235
582 nmdc:mga0n895_241712_c1 3300050512 Bacteria 1832
583 nmdc:mga0n895_266720_c1 3300050512 Bacteria 1737
584 nmdc:mga0rr50_766828_c1 3300050513 Bacteria 823
585 nmdc:mga08x19_487740_c1 3300050514 Bacteria 869
586 nmdc:mga08x19_75829_c1 3300050514 Bacteria 2199
587 nmdc:mga0a205_541757_c1 3300050515 Bacteria 1019
588 nmdc:mga0a205_83865_c1 3300050515 Bacteria 3078
589 nmdc:mga0a205_94332_c1 3300050515 Bacteria 2891
590 Ga0495601_0005211 3300053077 Bacteria 7561
591 Ga0495601_0024952 3300053077 Bacteria 3683
592 Ga0495601_0123988 3300053077 Unclassified 1680
593 Ga0495612_0000150 3300053078 Bacteria 29314
594 Ga0495612_0043109 3300053078 Bacteria 1843
595 Ga0495595_0087071 3300053084 Bacteria 1495
596 Ga0495619_0005278 3300053085 Bacteria 8186
597 Ga0495619_0310142 3300053085 Bacteria 1093
598 Ga0501084_0016215 3300054114 Bacteria 6187
599 Ga0501084_0024232 3300054114 Bacteria 5061
600 Ga0501084_0040751 3300054114 Bacteria 3885
601 Ga0501084_0071518 3300054114 Bacteria 2905
602 Ga0501084_0097079 3300054114 Bacteria 2474
603 Ga0501084_0156225 3300054114 Archaea 1924
604 Ga0501084_0157114 3300054114 Bacteria 1918
605 Ga0501084_0240792 3300054114 Bacteria 1527
606 Ga0590071_019603 3300059421 Unclassified 1592
607 Ga0590074_012454 3300059423 Bacteria 1431
608 Ga0590075_002711 3300059424 Bacteria 4236
609 Ga0501082_0020148 3300060353 Bacteria 5748
610 Ga0501082_0042207 3300060353 Bacteria 3932
611 Ga0501082_0137041 3300060353 Bacteria 2124
612 Ga0501082_0227519 3300060353 Bacteria 1623
613 Ga0501082_0301046 3300060353 Bacteria 1396
614 Ga0501082_0796716 3300060353 Bacteria 827
615 Ga0530510_0000395 3300061734 Bacteria 28388
616 Ga0530510_0014862 3300061734 Bacteria 5497
617 Ga0530510_0028455 3300061734 Bacteria 4007
618 Ga0530510_0082913 3300061734 Bacteria 2335
619 Ga0530510_0088669 3300061734 Bacteria 2255

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_10358750 Ga0105246_103587502 199
2 3300041491 Ga0451833_0052944 Ga0451833_0052944_22_633 199
3 3300048916 Ga0496113_0097754 Ga0496113_0097754_1635_2246 199
4 3300050507 nmdc:mga05p37_313751_c1 nmdc:mga05p37_313751_c1_858_1604 203
5 3300050515 nmdc:mga0a205_541757_c1 nmdc:mga0a205_541757_c1_127_873 204
6 3300041411 Ga0439466_0025622 Ga0439466_0025622_622_1368 206
7 3300049579 Ga0501043_0042893 Ga0501043_0042893_1791_2537 211
8 3300046499 Ga0495594_0390767 Ga0495594_0390767_15_671 214
9 3300049587 Ga0501071_0734626 Ga0501071_0734626_81_731 215
10 3300049568 Ga0501031_0103539 Ga0501031_0103539_1040_1786 218
11 3300049570 Ga0501033_0105662 Ga0501033_0105662_130_876 218
12 3300049572 Ga0501036_0041243 Ga0501036_0041243_1531_2277 218
13 3300049574 Ga0501038_0034784 Ga0501038_0034784_2258_3004 218
14 3300049575 Ga0501039_0137521 Ga0501039_0137521_1092_1838 218
15 3300049576 Ga0501040_0016358 Ga0501040_0016358_3725_4471 218
16 3300049577 Ga0501041_0009827 Ga0501041_0009827_2250_2996 218
17 3300049578 Ga0501042_0072313 Ga0501042_0072313_767_1513 218
18 3300049582 Ga0501048_0097641 Ga0501048_0097641_1165_1911 218
19 3300049586 Ga0501070_0020428 Ga0501070_0020428_1557_2303 218
20 3300049587 Ga0501071_0171981 Ga0501071_0171981_676_1422 218
21 3300049588 Ga0501072_0026651 Ga0501072_0026651_767_1513 218
22 3300049589 Ga0501073_0086292 Ga0501073_0086292_333_1079 218
23 3300049592 Ga0501076_0020719 Ga0501076_0020719_2788_3534 218
24 3300049741 Ga0501079_0012810 Ga0501079_0012810_1424_2170 218
25 3300049742 Ga0501080_0030769 Ga0501080_0030769_333_1079 218
26 3300049743 Ga0501081_0041445 Ga0501081_0041445_1616_2362 218
27 3300049744 Ga0501083_0026740 Ga0501083_0026740_720_1466 218
28 3300049822 Ga0501035_0064880 Ga0501035_0064880_2161_2907 218
29 3300049823 Ga0501044_0082695 Ga0501044_0082695_1118_1864 218
30 3300049824 Ga0501045_0021477 Ga0501045_0021477_2371_3117 218
31 3300054114 Ga0501084_0040751 Ga0501084_0040751_1689_2435 218
32 3300060353 Ga0501082_0042207 Ga0501082_0042207_1496_2242 218
33 3300061734 Ga0530510_0028455 Ga0530510_0028455_3025_3771 218
34 3300050514 nmdc:mga08x19_75829_c1 nmdc:mga08x19_75829_c1_640_1392 222
35 3300061734 Ga0530510_0082913 Ga0530510_0082913_70_816 223
36 3300049577 Ga0501041_0467534 Ga0501041_0467534_12_758 224
37 3300049742 Ga0501080_0058497 Ga0501080_0058497_2699_3445 224
38 3300049576 Ga0501040_0104469 Ga0501040_0104469_913_1659 225
39 3300049580 Ga0501046_0046011 Ga0501046_0046011_1058_1804 225
40 3300049587 Ga0501071_0444381 Ga0501071_0444381_104_850 225
41 3300054114 Ga0501084_0024232 Ga0501084_0024232_2615_3361 225
42 3300026075 Ga0207708_10111719 Ga0207708_101117192 226
43 3300049583 Ga0501067_0053969 Ga0501067_0053969_735_1424 228
44 3300009147 Ga0114129_10401639 Ga0114129_104016391 229
45 3300025922 Ga0207646_10298562 Ga0207646_102985622 234
46 3300014969 Ga0157376_10498166 Ga0157376_104981662 235
47 3300048088 Ga0495602_0174476 Ga0495602_0174476_792_1538 235
48 3300048914 Ga0496111_0098152 Ga0496111_0098152_1237_1983 237
49 3300005356 Ga0070674_100043227 Ga0070674_1000432273 238
50 3300005546 Ga0070696_100023149 Ga0070696_1000231492 238
51 3300005577 Ga0068857_100626438 Ga0068857_1006264382 238
52 3300005719 Ga0068861_100525228 Ga0068861_1005252282 238
53 3300006852 Ga0075433_10049991 Ga0075433_100499912 238
54 3300006871 Ga0075434_100425794 Ga0075434_1004257942 238
55 3300007076 Ga0075435_100302508 Ga0075435_1003025082 238
56 3300009176 Ga0105242_10482369 Ga0105242_104823692 238
57 3300011119 Ga0105246_10007352 Ga0105246_100073527 238
58 3300014326 Ga0157380_10060361 Ga0157380_100603612 238
59 3300017792 Ga0163161_10018664 Ga0163161_100186642 238
60 3300025922 Ga0207646_10051567 Ga0207646_100515673 238
61 3300025938 Ga0207704_10033692 Ga0207704_100336923 238
62 3300025939 Ga0207665_10350384 Ga0207665_103503842 238
63 3300035170 Ga0373943_0097971 Ga0373943_0097971_168_914 238
64 3300035725 Ga0373947_0121441 Ga0373947_0121441_794_1540 238
65 3300037068 Ga0373925_0432076 Ga0373925_0432076_160_906 238
66 3300047321 Ga0495676_0156564 Ga0495676_0156564_235_981 238
67 3300048905 Ga0496102_0367705 Ga0496102_0367705_594_1340 238
68 3300048908 Ga0496105_0114493 Ga0496105_0114493_1238_1984 238
69 3300048908 Ga0496105_0638715 Ga0496105_0638715_26_772 238
70 3300048911 Ga0496108_0727419 Ga0496108_0727419_67_813 238
71 3300048912 Ga0496109_0152001 Ga0496109_0152001_1325_2071 238
72 3300048913 Ga0496110_0133093 Ga0496110_0133093_832_1578 238
73 3300048915 Ga0496112_0080161 Ga0496112_0080161_606_1352 238
74 3300048916 Ga0496113_0128619 Ga0496113_0128619_538_1284 238
75 3300048917 Ga0496114_0376805 Ga0496114_0376805_395_1141 238
76 3300050512 nmdc:mga0n895_166620_c1 nmdc:mga0n895_166620_c1_387_1157 238
77 3300050515 nmdc:mga0a205_83865_c1 nmdc:mga0a205_83865_c1_1400_2170 238
78 3300005367 Ga0070667_100507541 Ga0070667_1005075411 240
79 3300013296 Ga0157374_10377875 Ga0157374_103778752 240
80 3300014968 Ga0157379_10262858 Ga0157379_102628582 240
81 3300048911 Ga0496108_0376659 Ga0496108_0376659_316_1062 240
82 3300048913 Ga0496110_0150850 Ga0496110_0150850_1053_1799 240
83 3300048916 Ga0496113_0107300 Ga0496113_0107300_286_1032 240
84 3300005471 Ga0070698_100211164 Ga0070698_1002111642 241
85 3300005406 Ga0070703_10069007 Ga0070703_100690072 242
86 3300005467 Ga0070706_100017669 Ga0070706_1000176695 242
87 3300005468 Ga0070707_100011540 Ga0070707_10001154010 242
88 3300005471 Ga0070698_100033589 Ga0070698_1000335895 242
89 3300005549 Ga0070704_100049997 Ga0070704_1000499973 242
90 3300006844 Ga0075428_100027425 Ga0075428_1000274252 242
91 3300009148 Ga0105243_10137149 Ga0105243_101371493 242
92 3300009176 Ga0105242_10228881 Ga0105242_102288812 242
93 3300025885 Ga0207653_10075184 Ga0207653_100751842 242
94 3300025910 Ga0207684_10028026 Ga0207684_100280263 242
95 3300025922 Ga0207646_10067562 Ga0207646_100675621 242
96 3300048905 Ga0496102_0177775 Ga0496102_0177775_45_773 242
97 3300048906 Ga0496103_0038350 Ga0496103_0038350_1255_1983 242
98 3300048909 Ga0496106_0081043 Ga0496106_0081043_457_1185 242
99 3300048910 Ga0496107_0254001 Ga0496107_0254001_388_1116 242
100 3300006871 Ga0075434_100301940 Ga0075434_1003019402 243
101 3300048915 Ga0496112_0000001 Ga0496112_0000001_213726_214475 243
102 3300048916 Ga0496113_0278639 Ga0496113_0278639_252_1001 243
103 3300050514 nmdc:mga08x19_487740_c1 nmdc:mga08x19_487740_c1_47_859 243
104 3300005545 Ga0070695_100272252 Ga0070695_1002722521 244
105 3300046514 Ga0495618_0028799 Ga0495618_0028799_645_1436 245
106 3300053078 Ga0495612_0043109 Ga0495612_0043109_777_1568 245
107 3300005840 Ga0068870_10074470 Ga0068870_100744702 246
108 3300005842 Ga0068858_100428803 Ga0068858_1004288032 246
109 3300005985 Ga0081539_10002426 Ga0081539_1000242617 246
110 3300046473 Ga0495582_0144782 Ga0495582_0144782_510_1253 246
111 3300046517 Ga0495630_0139549 Ga0495630_0139549_904_1647 246
112 3300047321 Ga0495676_0178840 Ga0495676_0178840_13_756 246
113 3300049575 Ga0501039_0232787 Ga0501039_0232787_46_789 246
114 3300049587 Ga0501071_0191313 Ga0501071_0191313_136_879 246
115 3300049591 Ga0501075_0129528 Ga0501075_0129528_1060_1803 246
116 3300049741 Ga0501079_0413531 Ga0501079_0413531_301_1044 246
117 3300049824 Ga0501045_0181971 Ga0501045_0181971_788_1531 246
118 3300053077 Ga0495601_0123988 Ga0495601_0123988_203_946 246
119 3300005328 Ga0070676_10057451 Ga0070676_100574512 247
120 3300005329 Ga0070683_100059475 Ga0070683_1000594753 247
121 3300005334 Ga0068869_100026718 Ga0068869_1000267183 247
122 3300005334 Ga0068869_100393423 Ga0068869_1003934232 247
123 3300005336 Ga0070680_100245671 Ga0070680_1002456712 247
124 3300005336 Ga0070680_100260497 Ga0070680_1002604972 247
125 3300005337 Ga0070682_100059049 Ga0070682_1000590493 247
126 3300005337 Ga0070682_100176443 Ga0070682_1001764432 247
127 3300005339 Ga0070660_100028487 Ga0070660_1000284874 247
128 3300005340 Ga0070689_100008190 Ga0070689_1000081903 247
129 3300005343 Ga0070687_100016213 Ga0070687_1000162134 247
130 3300005345 Ga0070692_10239418 Ga0070692_102394181 247
131 3300005353 Ga0070669_100108690 Ga0070669_1001086903 247
132 3300005355 Ga0070671_100354117 Ga0070671_1003541172 247
133 3300005356 Ga0070674_100011524 Ga0070674_1000115245 247
134 3300005364 Ga0070673_100046216 Ga0070673_1000462164 247
135 3300005366 Ga0070659_100001254 Ga0070659_10000125418 247
136 3300005366 Ga0070659_100517941 Ga0070659_1005179412 247
137 3300005437 Ga0070710_10045553 Ga0070710_100455532 247
138 3300005438 Ga0070701_10005841 Ga0070701_100058415 247
139 3300005440 Ga0070705_100076888 Ga0070705_1000768882 247
140 3300005441 Ga0070700_100011673 Ga0070700_1000116733 247
141 3300005441 Ga0070700_100016631 Ga0070700_1000166314 247
142 3300005444 Ga0070694_100146795 Ga0070694_1001467952 247
143 3300005444 Ga0070694_100247692 Ga0070694_1002476921 247
144 3300005445 Ga0070708_100368550 Ga0070708_1003685501 247
145 3300005457 Ga0070662_100123093 Ga0070662_1001230932 247
146 3300005457 Ga0070662_100267132 Ga0070662_1002671322 247
147 3300005458 Ga0070681_10234517 Ga0070681_102345172 247
148 3300005458 Ga0070681_10551696 Ga0070681_105516962 247
149 3300005459 Ga0068867_100021085 Ga0068867_1000210854 247
150 3300005459 Ga0068867_100095244 Ga0068867_1000952442 247
151 3300005466 Ga0070685_10001599 Ga0070685_100015996 247
152 3300005468 Ga0070707_100017426 Ga0070707_1000174265 247
153 3300005468 Ga0070707_100093270 Ga0070707_1000932702 247
154 3300005468 Ga0070707_100689554 Ga0070707_1006895542 247
155 3300005471 Ga0070698_100016493 Ga0070698_1000164938 247
156 3300005471 Ga0070698_100133443 Ga0070698_1001334433 247
157 3300005518 Ga0070699_100013871 Ga0070699_1000138712 247
158 3300005518 Ga0070699_100019715 Ga0070699_1000197154 247
159 3300005518 Ga0070699_100389430 Ga0070699_1003894302 247
160 3300005536 Ga0070697_100027553 Ga0070697_1000275534 247
161 3300005536 Ga0070697_100045945 Ga0070697_1000459454 247
162 3300005543 Ga0070672_100037813 Ga0070672_1000378132 247
163 3300005544 Ga0070686_100004260 Ga0070686_1000042604 247
164 3300005544 Ga0070686_100646678 Ga0070686_1006466781 247
165 3300005545 Ga0070695_100176591 Ga0070695_1001765912 247
166 3300005546 Ga0070696_100011346 Ga0070696_1000113463 247
167 3300005546 Ga0070696_100361259 Ga0070696_1003612592 247
168 3300005547 Ga0070693_100023998 Ga0070693_1000239984 247
169 3300005548 Ga0070665_100165311 Ga0070665_1001653112 247
170 3300005549 Ga0070704_100625062 Ga0070704_1006250622 247
171 3300005564 Ga0070664_100037315 Ga0070664_1000373151 247
172 3300005577 Ga0068857_100063492 Ga0068857_1000634923 247
173 3300005577 Ga0068857_100504187 Ga0068857_1005041872 247
174 3300005578 Ga0068854_100059036 Ga0068854_1000590362 247
175 3300005578 Ga0068854_100445922 Ga0068854_1004459222 247
176 3300005615 Ga0070702_100003455 Ga0070702_1000034552 247
177 3300005617 Ga0068859_100021864 Ga0068859_1000218646 247
178 3300005618 Ga0068864_100014338 Ga0068864_1000143385 247
179 3300005718 Ga0068866_10053430 Ga0068866_100534303 247
180 3300005719 Ga0068861_100127663 Ga0068861_1001276632 247
181 3300005719 Ga0068861_100158652 Ga0068861_1001586522 247
182 3300005719 Ga0068861_100692070 Ga0068861_1006920701 247
183 3300005842 Ga0068858_100027875 Ga0068858_1000278753 247
184 3300005844 Ga0068862_100149931 Ga0068862_1001499313 247
185 3300005937 Ga0081455_10157510 Ga0081455_101575102 247
186 3300006038 Ga0075365_10070077 Ga0075365_100700773 247
187 3300006058 Ga0075432_10036019 Ga0075432_100360192 247
188 3300006844 Ga0075428_100035631 Ga0075428_1000356312 247
189 3300006852 Ga0075433_10235102 Ga0075433_102351022 247
190 3300006871 Ga0075434_100083149 Ga0075434_1000831494 247
191 3300006871 Ga0075434_100098838 Ga0075434_1000988382 247
192 3300006881 Ga0068865_100020409 Ga0068865_1000204095 247
193 3300006931 Ga0097620_100021863 Ga0097620_1000218632 247
194 3300007076 Ga0075435_100218131 Ga0075435_1002181312 247
195 3300009094 Ga0111539_10004889 Ga0111539_1000488910 247
196 3300009094 Ga0111539_10308924 Ga0111539_103089242 247
197 3300009094 Ga0111539_10396684 Ga0111539_103966842 247
198 3300009098 Ga0105245_10029313 Ga0105245_100293133 247
199 3300009098 Ga0105245_10114566 Ga0105245_101145662 247
200 3300009098 Ga0105245_10121887 Ga0105245_101218873 247
201 3300009098 Ga0105245_10609428 Ga0105245_106094282 247
202 3300009147 Ga0114129_10159335 Ga0114129_101593353 247
203 3300009147 Ga0114129_10221665 Ga0114129_102216653 247
204 3300009147 Ga0114129_10221849 Ga0114129_102218493 247
205 3300009147 Ga0114129_10519277 Ga0114129_105192772 247
206 3300009148 Ga0105243_10003260 Ga0105243_100032607 247
207 3300009148 Ga0105243_10215588 Ga0105243_102155883 247
208 3300009176 Ga0105242_10097352 Ga0105242_100973523 247
209 3300009177 Ga0105248_10015938 Ga0105248_100159385 247
210 3300009545 Ga0105237_10240695 Ga0105237_102406952 247
211 3300009553 Ga0105249_10003293 Ga0105249_100032936 247
212 3300010375 Ga0105239_10531452 Ga0105239_105314521 247
213 3300011119 Ga0105246_10080470 Ga0105246_100804703 247
214 3300013296 Ga0157374_10200263 Ga0157374_102002632 247
215 3300013296 Ga0157374_11195941 Ga0157374_111959411 247
216 3300013297 Ga0157378_10023119 Ga0157378_100231195 247
217 3300013306 Ga0163162_10353198 Ga0163162_103531983 247
218 3300013308 Ga0157375_10040061 Ga0157375_100400612 247
219 3300014325 Ga0163163_10090013 Ga0163163_100900133 247
220 3300014325 Ga0163163_10463491 Ga0163163_104634912 247
221 3300014325 Ga0163163_10944872 Ga0163163_109448722 247
222 3300014326 Ga0157380_10015679 Ga0157380_100156793 247
223 3300014326 Ga0157380_10110099 Ga0157380_101100992 247
224 3300014326 Ga0157380_10266662 Ga0157380_102666622 247
225 3300014326 Ga0157380_10659157 Ga0157380_106591572 247
226 3300014968 Ga0157379_10016312 Ga0157379_100163122 247
227 3300014968 Ga0157379_10532750 Ga0157379_105327502 247
228 3300025898 Ga0207692_10094986 Ga0207692_100949863 247
229 3300025899 Ga0207642_10015491 Ga0207642_100154913 247
230 3300025901 Ga0207688_10011966 Ga0207688_100119664 247
231 3300025901 Ga0207688_10017254 Ga0207688_100172543 247
232 3300025908 Ga0207643_10053164 Ga0207643_100531643 247
233 3300025914 Ga0207671_10224882 Ga0207671_102248822 247
234 3300025917 Ga0207660_10179408 Ga0207660_101794082 247
235 3300025918 Ga0207662_10000529 Ga0207662_1000052912 247
236 3300025920 Ga0207649_10066170 Ga0207649_100661702 247
237 3300025922 Ga0207646_10104516 Ga0207646_101045163 247
238 3300025923 Ga0207681_10397759 Ga0207681_103977592 247
239 3300025927 Ga0207687_10002819 Ga0207687_1000281910 247
240 3300025927 Ga0207687_10080859 Ga0207687_100808592 247
241 3300025927 Ga0207687_10337703 Ga0207687_103377032 247
242 3300025932 Ga0207690_10027392 Ga0207690_100273925 247
243 3300025932 Ga0207690_10365367 Ga0207690_103653672 247
244 3300025933 Ga0207706_10310939 Ga0207706_103109392 247
245 3300025933 Ga0207706_10575193 Ga0207706_105751932 247
246 3300025936 Ga0207670_10023513 Ga0207670_100235132 247
247 3300025937 Ga0207669_10115832 Ga0207669_101158321 247
248 3300025937 Ga0207669_10210909 Ga0207669_102109092 247
249 3300025940 Ga0207691_10052756 Ga0207691_100527562 247
250 3300025941 Ga0207711_10036437 Ga0207711_100364373 247
251 3300025942 Ga0207689_10095526 Ga0207689_100955263 247
252 3300025944 Ga0207661_10223944 Ga0207661_102239442 247
253 3300025945 Ga0207679_10121656 Ga0207679_101216562 247
254 3300025961 Ga0207712_10030826 Ga0207712_100308262 247
255 3300025972 Ga0207668_10378201 Ga0207668_103782012 247
256 3300025981 Ga0207640_10118211 Ga0207640_101182112 247
257 3300026067 Ga0207678_10005302 Ga0207678_100053021 247
258 3300026067 Ga0207678_10381249 Ga0207678_103812492 247
259 3300026075 Ga0207708_10004427 Ga0207708_100044275 247
260 3300026075 Ga0207708_10030098 Ga0207708_100300984 247
261 3300026075 Ga0207708_10067135 Ga0207708_100671353 247
262 3300026089 Ga0207648_10015157 Ga0207648_100151575 247
263 3300026089 Ga0207648_10236883 Ga0207648_102368832 247
264 3300026116 Ga0207674_10005296 Ga0207674_100052964 247
265 3300026118 Ga0207675_100017272 Ga0207675_1000172728 247
266 3300026118 Ga0207675_100079669 Ga0207675_1000796692 247
267 3300026118 Ga0207675_100560518 Ga0207675_1005605181 247
268 3300026121 Ga0207683_10023294 Ga0207683_100232944 247
269 3300026121 Ga0207683_10283820 Ga0207683_102838202 247
270 3300026142 Ga0207698_10118044 Ga0207698_101180442 247
271 3300027665 Ga0209983_1020749 Ga0209983_10207492 247
272 3300028379 Ga0268266_10139868 Ga0268266_101398682 247
273 3300028379 Ga0268266_10333738 Ga0268266_103337382 247
274 3300028380 Ga0268265_10093106 Ga0268265_100931063 247
275 3300028381 Ga0268264_10071403 Ga0268264_100714033 247
276 3300028556 Ga0265337_1012246 Ga0265337_10122462 247
277 3300028558 Ga0265326_10011919 Ga0265326_100119193 247
278 3300028558 Ga0265326_10019353 Ga0265326_100193533 247
279 3300028563 Ga0265319_1011171 Ga0265319_10111712 247
280 3300028563 Ga0265319_1040373 Ga0265319_10403732 247
281 3300028563 Ga0265319_1080330 Ga0265319_10803302 247
282 3300028573 Ga0265334_10005048 Ga0265334_100050482 247
283 3300028573 Ga0265334_10005311 Ga0265334_100053115 247
284 3300028573 Ga0265334_10013793 Ga0265334_100137934 247
285 3300028573 Ga0265334_10016047 Ga0265334_100160473 247
286 3300028577 Ga0265318_10050579 Ga0265318_100505791 247
287 3300028654 Ga0265322_10001920 Ga0265322_100019204 247
288 3300028800 Ga0265338_10044626 Ga0265338_100446262 247
289 3300028800 Ga0265338_10117028 Ga0265338_101170283 247
290 3300028800 Ga0265338_10269109 Ga0265338_102691092 247
291 3300028800 Ga0265338_10409044 Ga0265338_104090442 247
292 3300029957 Ga0265324_10003860 Ga0265324_100038603 247
293 3300031238 Ga0265332_10017091 Ga0265332_100170912 247
294 3300031240 Ga0265320_10004319 Ga0265320_1000431910 247
295 3300031240 Ga0265320_10006704 Ga0265320_100067043 247
296 3300031240 Ga0265320_10034647 Ga0265320_100346473 247
297 3300031240 Ga0265320_10165017 Ga0265320_101650171 247
298 3300031241 Ga0265325_10026920 Ga0265325_100269202 247
299 3300031241 Ga0265325_10064884 Ga0265325_100648843 247
300 3300031241 Ga0265325_10070821 Ga0265325_100708211 247
301 3300031241 Ga0265325_10133967 Ga0265325_101339672 247
302 3300031241 Ga0265325_10189040 Ga0265325_101890402 247
303 3300031242 Ga0265329_10004814 Ga0265329_100048142 247
304 3300031242 Ga0265329_10006530 Ga0265329_100065305 247
305 3300031242 Ga0265329_10042087 Ga0265329_100420873 247
306 3300031242 Ga0265329_10095915 Ga0265329_100959152 247
307 3300031247 Ga0265340_10007157 Ga0265340_100071573 247
308 3300031247 Ga0265340_10065163 Ga0265340_100651632 247
309 3300031249 Ga0265339_10049559 Ga0265339_100495592 247
310 3300031249 Ga0265339_10196504 Ga0265339_101965042 247
311 3300031250 Ga0265331_10025696 Ga0265331_100256962 247
312 3300031344 Ga0265316_10002667 Ga0265316_1000266710 247
313 3300031344 Ga0265316_10026393 Ga0265316_100263933 247
314 3300031344 Ga0265316_10064015 Ga0265316_100640152 247
315 3300031344 Ga0265316_10071911 Ga0265316_100719112 247
316 3300031344 Ga0265316_10273366 Ga0265316_102733662 247
317 3300031548 Ga0307408_100443910 Ga0307408_1004439102 247
318 3300031595 Ga0265313_10047487 Ga0265313_100474872 247
319 3300031595 Ga0265313_10118922 Ga0265313_101189222 247
320 3300031711 Ga0265314_10009807 Ga0265314_100098076 247
321 3300031712 Ga0265342_10119607 Ga0265342_101196072 247
322 3300031727 Ga0316576_10003347 Ga0316576_100033478 247
323 3300031728 Ga0316578_10038766 Ga0316578_100387662 247
324 3300031728 Ga0316578_10148365 Ga0316578_101483652 247
325 3300031824 Ga0307413_10042574 Ga0307413_100425742 247
326 3300031911 Ga0307412_10073249 Ga0307412_100732492 247
327 3300031995 Ga0307409_100330011 Ga0307409_1003300112 247
328 3300032002 Ga0307416_100001530 Ga0307416_1000015309 247
329 3300032005 Ga0307411_10137607 Ga0307411_101376072 247
330 3300032126 Ga0307415_100004758 Ga0307415_1000047582 247
331 3300032133 Ga0316583_10024660 Ga0316583_100246602 247
332 3300035398 Ga0316574_0056841 Ga0316574_0056841_687_1433 247
333 3300035398 Ga0316574_0129354 Ga0316574_0129354_227_973 247
334 3300035398 Ga0316574_0155703 Ga0316574_0155703_439_1185 247
335 3300035691 Ga0373931_0017708 Ga0373931_0017708_1510_2256 247
336 3300036401 Ga0373937_0074732 Ga0373937_0074732_2128_2925 247
337 3300036712 Ga0316584_0051705 Ga0316584_0051705_1893_2639 247
338 3300036712 Ga0316584_0299814 Ga0316584_0299814_211_957 247
339 3300041492 Ga0451835_0571311 Ga0451835_0571311_84_839 247
340 3300042147 Ga0450910_001576 Ga0450910_001576_857_1708 247
341 3300042156 Ga0439446_0006670 Ga0439446_0006670_1688_2557 247
342 3300042876 Ga0451577_0067962 Ga0451577_0067962_726_1475 247
343 3300044712 Ga0453684_0195068 Ga0453684_0195068_740_1489 247
344 3300045051 Ga0451576_0259412 Ga0451576_0259412_356_1105 247
345 3300046463 Ga0495653_0116138 Ga0495653_0116138_77_874 247
346 3300046511 Ga0495608_0075608 Ga0495608_0075608_637_1434 247
347 3300046517 Ga0495630_0317841 Ga0495630_0317841_69_815 247
348 3300046533 Ga0495640_0027262 Ga0495640_0027262_1041_1838 247
349 3300046543 Ga0495645_0021864 Ga0495645_0021864_487_1284 247
350 3300046559 Ga0495667_0135306 Ga0495667_0135306_554_1300 247
351 3300046642 Ga0495634_0048693 Ga0495634_0048693_868_1665 247
352 3300046642 Ga0495634_0090953 Ga0495634_0090953_1127_1873 247
353 3300046678 Ga0495599_0176410 Ga0495599_0176410_164_910 247
354 3300047319 Ga0495674_0644344 Ga0495674_0644344_67_813 247
355 3300047321 Ga0495676_0135233 Ga0495676_0135233_716_1462 247
356 3300047322 Ga0495680_0242704 Ga0495680_0242704_336_1082 247
357 3300047471 Ga0495684_0026185 Ga0495684_0026185_1732_2529 247
358 3300048903 Ga0496100_0130501 Ga0496100_0130501_688_1434 247
359 3300048903 Ga0496100_0445528 Ga0496100_0445528_205_951 247
360 3300048904 Ga0496101_0045212 Ga0496101_0045212_2069_2815 247
361 3300048905 Ga0496102_0513196 Ga0496102_0513196_46_792 247
362 3300048906 Ga0496103_0078846 Ga0496103_0078846_214_960 247
363 3300048907 Ga0496104_0113611 Ga0496104_0113611_451_1197 247
364 3300048908 Ga0496105_0165233 Ga0496105_0165233_163_909 247
365 3300048908 Ga0496105_0262741 Ga0496105_0262741_381_1127 247
366 3300048909 Ga0496106_0025010 Ga0496106_0025010_1050_1796 247
367 3300048909 Ga0496106_0106501 Ga0496106_0106501_1386_2132 247
368 3300048910 Ga0496107_0094341 Ga0496107_0094341_1164_1910 247
369 3300048912 Ga0496109_0031655 Ga0496109_0031655_443_1189 247
370 3300048912 Ga0496109_0045957 Ga0496109_0045957_2106_2852 247
371 3300048913 Ga0496110_0020398 Ga0496110_0020398_2277_3023 247
372 3300048913 Ga0496110_0023514 Ga0496110_0023514_2806_3552 247
373 3300048914 Ga0496111_0035164 Ga0496111_0035164_2019_2765 247
374 3300048914 Ga0496111_0043839 Ga0496111_0043839_240_986 247
375 3300048915 Ga0496112_0304593 Ga0496112_0304593_172_918 247
376 3300048916 Ga0496113_0046786 Ga0496113_0046786_1446_2192 247
377 3300048917 Ga0496114_0069221 Ga0496114_0069221_1271_2017 247
378 3300048917 Ga0496114_0119383 Ga0496114_0119383_552_1295 247
379 3300049568 Ga0501031_0053617 Ga0501031_0053617_1633_2379 247
380 3300049569 Ga0501032_0324184 Ga0501032_0324184_101_847 247
381 3300049572 Ga0501036_0578170 Ga0501036_0578170_83_829 247
382 3300049574 Ga0501038_0110908 Ga0501038_0110908_1076_1822 247
383 3300049575 Ga0501039_0033529 Ga0501039_0033529_269_1015 247
384 3300049575 Ga0501039_0516080 Ga0501039_0516080_148_894 247
385 3300049575 Ga0501039_0552635 Ga0501039_0552635_126_872 247
386 3300049576 Ga0501040_0004634 Ga0501040_0004634_411_1157 247
387 3300049576 Ga0501040_0194440 Ga0501040_0194440_511_1257 247
388 3300049577 Ga0501041_0056691 Ga0501041_0056691_544_1290 247
389 3300049577 Ga0501041_0058167 Ga0501041_0058167_888_1634 247
390 3300049580 Ga0501046_0269924 Ga0501046_0269924_136_882 247
391 3300049580 Ga0501046_0362404 Ga0501046_0362404_220_963 247
392 3300049582 Ga0501048_0025817 Ga0501048_0025817_145_891 247
393 3300049583 Ga0501067_0034172 Ga0501067_0034172_1501_2247 247
394 3300049583 Ga0501067_0113076 Ga0501067_0113076_80_823 247
395 3300049585 Ga0501069_0032879 Ga0501069_0032879_1262_2008 247
396 3300049585 Ga0501069_0239288 Ga0501069_0239288_59_802 247
397 3300049587 Ga0501071_0225308 Ga0501071_0225308_180_926 247
398 3300049588 Ga0501072_0056727 Ga0501072_0056727_2029_2775 247
399 3300049588 Ga0501072_0296997 Ga0501072_0296997_93_839 247
400 3300049590 Ga0501074_0032079 Ga0501074_0032079_1818_2564 247
401 3300049591 Ga0501075_0100704 Ga0501075_0100704_352_1098 247
402 3300049591 Ga0501075_0355531 Ga0501075_0355531_226_972 247
403 3300049592 Ga0501076_0017957 Ga0501076_0017957_2687_3433 247
404 3300049592 Ga0501076_0041412 Ga0501076_0041412_2311_3057 247
405 3300049592 Ga0501076_0071535 Ga0501076_0071535_351_1097 247
406 3300049592 Ga0501076_0115936 Ga0501076_0115936_893_1639 247
407 3300049593 Ga0501077_0011899 Ga0501077_0011899_4242_4988 247
408 3300049593 Ga0501077_0130262 Ga0501077_0130262_353_1099 247
409 3300049741 Ga0501079_0193100 Ga0501079_0193100_104_850 247
410 3300049741 Ga0501079_0216089 Ga0501079_0216089_135_881 247
411 3300049742 Ga0501080_0024726 Ga0501080_0024726_4011_4757 247
412 3300049742 Ga0501080_0170393 Ga0501080_0170393_921_1667 247
413 3300049743 Ga0501081_0049914 Ga0501081_0049914_1879_2625 247
414 3300049743 Ga0501081_0104642 Ga0501081_0104642_1066_1812 247
415 3300049822 Ga0501035_0100151 Ga0501035_0100151_1094_1840 247
416 3300049822 Ga0501035_0309690 Ga0501035_0309690_326_1072 247
417 3300049824 Ga0501045_0005766 Ga0501045_0005766_4495_5241 247
418 3300049824 Ga0501045_0110611 Ga0501045_0110611_702_1448 247
419 3300049824 Ga0501045_0341010 Ga0501045_0341010_283_1029 247
420 3300050492 nmdc:mga0yw44_319676_c1 nmdc:mga0yw44_319676_c1_190_936 247
421 3300050507 nmdc:mga05p37_448416_c1 nmdc:mga05p37_448416_c1_10_756 247
422 3300050507 nmdc:mga05p37_45265_c1 nmdc:mga05p37_45265_c1_1545_2291 247
423 3300050511 nmdc:mga08y16_67995_c1 nmdc:mga08y16_67995_c1_1774_2520 247
424 3300050512 nmdc:mga0n895_266720_c1 nmdc:mga0n895_266720_c1_35_781 247
425 3300053077 Ga0495601_0005211 Ga0495601_0005211_5723_6520 247
426 3300053077 Ga0495601_0024952 Ga0495601_0024952_665_1411 247
427 3300053084 Ga0495595_0087071 Ga0495595_0087071_684_1430 247
428 3300053085 Ga0495619_0005278 Ga0495619_0005278_4828_5625 247
429 3300053085 Ga0495619_0310142 Ga0495619_0310142_128_874 247
430 3300054114 Ga0501084_0016215 Ga0501084_0016215_688_1434 247
431 3300054114 Ga0501084_0071518 Ga0501084_0071518_466_1212 247
432 3300054114 Ga0501084_0097079 Ga0501084_0097079_435_1181 247
433 3300054114 Ga0501084_0156225 Ga0501084_0156225_563_1309 247
434 3300054114 Ga0501084_0157114 Ga0501084_0157114_717_1463 247
435 3300054114 Ga0501084_0240792 Ga0501084_0240792_525_1271 247
436 3300059421 Ga0590071_019603 Ga0590071_019603_399_1145 247
437 3300059423 Ga0590074_012454 Ga0590074_012454_447_1193 247
438 3300059424 Ga0590075_002711 Ga0590075_002711_1287_2033 247
439 3300060353 Ga0501082_0137041 Ga0501082_0137041_727_1473 247
440 3300060353 Ga0501082_0227519 Ga0501082_0227519_221_967 247
441 3300060353 Ga0501082_0301046 Ga0501082_0301046_178_924 247
442 3300060353 Ga0501082_0796716 Ga0501082_0796716_60_806 247
443 3300061734 Ga0530510_0000395 Ga0530510_0000395_19336_20082 247
444 3300061734 Ga0530510_0014862 Ga0530510_0014862_2980_3726 247
445 3300061734 Ga0530510_0088669 Ga0530510_0088669_906_1652 247
446 3300005328 Ga0070676_10178133 Ga0070676_101781332 248
447 3300005334 Ga0068869_100290295 Ga0068869_1002902952 248
448 3300005336 Ga0070680_100000017 Ga0070680_10000001770 248
449 3300005343 Ga0070687_100021735 Ga0070687_1000217353 248
450 3300005343 Ga0070687_100314176 Ga0070687_1003141761 248
451 3300005344 Ga0070661_100286533 Ga0070661_1002865331 248
452 3300005345 Ga0070692_10022870 Ga0070692_100228702 248
453 3300005354 Ga0070675_100509041 Ga0070675_1005090412 248
454 3300005355 Ga0070671_100359176 Ga0070671_1003591762 248
455 3300005367 Ga0070667_100116907 Ga0070667_1001169072 248
456 3300005440 Ga0070705_100093910 Ga0070705_1000939102 248
457 3300005440 Ga0070705_100113057 Ga0070705_1001130572 248
458 3300005444 Ga0070694_100007643 Ga0070694_1000076435 248
459 3300005444 Ga0070694_100161800 Ga0070694_1001618002 248
460 3300005444 Ga0070694_100185351 Ga0070694_1001853512 248
461 3300005445 Ga0070708_100004866 Ga0070708_1000048666 248
462 3300005445 Ga0070708_100005521 Ga0070708_10000552110 248
463 3300005445 Ga0070708_100005677 Ga0070708_1000056778 248
464 3300005445 Ga0070708_100070232 Ga0070708_1000702324 248
465 3300005445 Ga0070708_100109168 Ga0070708_1001091682 248
466 3300005445 Ga0070708_100209369 Ga0070708_1002093692 248
467 3300005445 Ga0070708_100368043 Ga0070708_1003680432 248
468 3300005457 Ga0070662_100382500 Ga0070662_1003825001 248
469 3300005457 Ga0070662_100494152 Ga0070662_1004941522 248
470 3300005458 Ga0070681_10144683 Ga0070681_101446832 248
471 3300005467 Ga0070706_100003060 Ga0070706_1000030608 248
472 3300005467 Ga0070706_100006194 Ga0070706_1000061944 248
473 3300005467 Ga0070706_100007252 Ga0070706_1000072529 248
474 3300005467 Ga0070706_100102428 Ga0070706_1001024283 248
475 3300005467 Ga0070706_100155512 Ga0070706_1001555122 248
476 3300005467 Ga0070706_100308048 Ga0070706_1003080482 248
477 3300005468 Ga0070707_100000801 Ga0070707_10000080114 248
478 3300005468 Ga0070707_100003407 Ga0070707_1000034076 248
479 3300005468 Ga0070707_100119668 Ga0070707_1001196682 248
480 3300005471 Ga0070698_100225429 Ga0070698_1002254292 248
481 3300005518 Ga0070699_100002964 Ga0070699_10000296412 248
482 3300005518 Ga0070699_100030402 Ga0070699_1000304025 248
483 3300005518 Ga0070699_100089605 Ga0070699_1000896053 248
484 3300005535 Ga0070684_100020234 Ga0070684_1000202344 248
485 3300005536 Ga0070697_100031377 Ga0070697_1000313774 248
486 3300005536 Ga0070697_100216313 Ga0070697_1002163132 248
487 3300005536 Ga0070697_100445520 Ga0070697_1004455202 248
488 3300005544 Ga0070686_100354965 Ga0070686_1003549652 248
489 3300005545 Ga0070695_100008654 Ga0070695_1000086543 248
490 3300005545 Ga0070695_100158627 Ga0070695_1001586272 248
491 3300005546 Ga0070696_100007567 Ga0070696_1000075675 248
492 3300005546 Ga0070696_100015083 Ga0070696_1000150832 248
493 3300005546 Ga0070696_100048724 Ga0070696_1000487243 248
494 3300005546 Ga0070696_100179323 Ga0070696_1001793231 248
495 3300005547 Ga0070693_100241681 Ga0070693_1002416811 248
496 3300005549 Ga0070704_100050388 Ga0070704_1000503882 248
497 3300005549 Ga0070704_100164392 Ga0070704_1001643922 248
498 3300005563 Ga0068855_100263284 Ga0068855_1002632842 248
499 3300005618 Ga0068864_100004764 Ga0068864_1000047646 248
500 3300005618 Ga0068864_100192010 Ga0068864_1001920102 248
501 3300005719 Ga0068861_100388444 Ga0068861_1003884442 248
502 3300005841 Ga0068863_100017340 Ga0068863_1000173408 248
503 3300005841 Ga0068863_100807831 Ga0068863_1008078311 248
504 3300005843 Ga0068860_100025839 Ga0068860_1000258392 248
505 3300005843 Ga0068860_100243166 Ga0068860_1002431662 248
506 3300005843 Ga0068860_100460906 Ga0068860_1004609061 248
507 3300005844 Ga0068862_100282746 Ga0068862_1002827462 248
508 3300005985 Ga0081539_10007841 Ga0081539_1000784110 248
509 3300006173 Ga0070716_100217590 Ga0070716_1002175902 248
510 3300006358 Ga0068871_100740335 Ga0068871_1007403351 248
511 3300009094 Ga0111539_10526823 Ga0111539_105268232 248
512 3300009098 Ga0105245_10040835 Ga0105245_100408353 248
513 3300009098 Ga0105245_10320671 Ga0105245_103206712 248
514 3300009101 Ga0105247_10514383 Ga0105247_105143831 248
515 3300009148 Ga0105243_10323800 Ga0105243_103238003 248
516 3300009148 Ga0105243_10411104 Ga0105243_104111042 248
517 3300009553 Ga0105249_10041803 Ga0105249_100418033 248
518 3300013297 Ga0157378_10038091 Ga0157378_100380914 248
519 3300014325 Ga0163163_10001601 Ga0163163_100016014 248
520 3300014325 Ga0163163_10034936 Ga0163163_100349364 248
521 3300014325 Ga0163163_10388244 Ga0163163_103882442 248
522 3300014497 Ga0182008_10137899 Ga0182008_101378991 248
523 3300014497 Ga0182008_10143276 Ga0182008_101432762 248
524 3300014745 Ga0157377_10150081 Ga0157377_101500812 248
525 3300014968 Ga0157379_10056856 Ga0157379_100568564 248
526 3300025907 Ga0207645_10079127 Ga0207645_100791272 248
527 3300025910 Ga0207684_10002333 Ga0207684_1000233310 248
528 3300025910 Ga0207684_10024521 Ga0207684_100245214 248
529 3300025910 Ga0207684_10110452 Ga0207684_101104522 248
530 3300025912 Ga0207707_10194055 Ga0207707_101940552 248
531 3300025917 Ga0207660_10000002 Ga0207660_10000002664 248
532 3300025917 Ga0207660_10241022 Ga0207660_102410222 248
533 3300025917 Ga0207660_10280305 Ga0207660_102803052 248
534 3300025918 Ga0207662_10015221 Ga0207662_100152213 248
535 3300025920 Ga0207649_10129535 Ga0207649_101295352 248
536 3300025921 Ga0207652_10253379 Ga0207652_102533792 248
537 3300025922 Ga0207646_10000242 Ga0207646_100002427 248
538 3300025922 Ga0207646_10001771 Ga0207646_1000177112 248
539 3300025922 Ga0207646_10002780 Ga0207646_1000278013 248
540 3300025933 Ga0207706_10219201 Ga0207706_102192011 248
541 3300025933 Ga0207706_10474706 Ga0207706_104747062 248
542 3300025935 Ga0207709_10070615 Ga0207709_100706152 248
543 3300025941 Ga0207711_10248815 Ga0207711_102488152 248
544 3300025941 Ga0207711_10410255 Ga0207711_104102552 248
545 3300025942 Ga0207689_10113348 Ga0207689_101133481 248
546 3300025942 Ga0207689_10277739 Ga0207689_102777392 248
547 3300025949 Ga0207667_10460639 Ga0207667_104606392 248
548 3300025961 Ga0207712_10152994 Ga0207712_101529942 248
549 3300025986 Ga0207658_10659487 Ga0207658_106594872 248
550 3300026041 Ga0207639_10355397 Ga0207639_103553972 248
551 3300026088 Ga0207641_10236758 Ga0207641_102367582 248
552 3300026088 Ga0207641_10358419 Ga0207641_103584192 248
553 3300026095 Ga0207676_10121903 Ga0207676_101219033 248
554 3300026118 Ga0207675_100342177 Ga0207675_1003421772 248
555 3300026121 Ga0207683_10284381 Ga0207683_102843812 248
556 3300026142 Ga0207698_10182010 Ga0207698_101820102 248
557 3300028380 Ga0268265_10424478 Ga0268265_104244782 248
558 3300028380 Ga0268265_10541615 Ga0268265_105416152 248
559 3300028381 Ga0268264_10173127 Ga0268264_101731272 248
560 3300028381 Ga0268264_10196675 Ga0268264_101966753 248
561 3300031901 Ga0307406_10089120 Ga0307406_100891202 248
562 3300032002 Ga0307416_100042420 Ga0307416_1000424203 248
563 3300032005 Ga0307411_10075676 Ga0307411_100756762 248
564 3300035691 Ga0373931_0292643 Ga0373931_0292643_66_812 248
565 3300037068 Ga0373925_0716030 Ga0373925_0716030_21_767 248
566 3300039437 Ga0436365_1187677 Ga0436365_1187677_1282_2028 248
567 3300041512 Ga0451853_3294679 Ga0451853_3294679_27_827 248
568 3300042010 Ga0439452_052774 Ga0439452_052774_31_852 248
569 3300044673 Ga0453683_0018350 Ga0453683_0018350_2164_2958 248
570 3300045051 Ga0451576_0296374 Ga0451576_0296374_753_1499 248
571 3300046690 Ga0495624_0240882 Ga0495624_0240882_38_838 248
572 3300047319 Ga0495674_0212310 Ga0495674_0212310_43_789 248
573 3300048905 Ga0496102_0020554 Ga0496102_0020554_235_981 248
574 3300048906 Ga0496103_0114077 Ga0496103_0114077_285_1031 248
575 3300048906 Ga0496103_0152571 Ga0496103_0152571_36_848 248
576 3300048907 Ga0496104_0004073 Ga0496104_0004073_39_785 248
577 3300048908 Ga0496105_0408695 Ga0496105_0408695_183_929 248
578 3300048911 Ga0496108_0194693 Ga0496108_0194693_58_804 248
579 3300048911 Ga0496108_0202834 Ga0496108_0202834_10_756 248
580 3300048912 Ga0496109_0149928 Ga0496109_0149928_1149_1895 248
581 3300048912 Ga0496109_0153238 Ga0496109_0153238_222_968 248
582 3300048912 Ga0496109_0191236 Ga0496109_0191236_296_1042 248
583 3300048913 Ga0496110_0094608 Ga0496110_0094608_1540_2286 248
584 3300048913 Ga0496110_0709662 Ga0496110_0709662_36_782 248
585 3300048914 Ga0496111_0189387 Ga0496111_0189387_447_1193 248
586 3300048915 Ga0496112_0036152 Ga0496112_0036152_38_784 248
587 3300048915 Ga0496112_0279205 Ga0496112_0279205_560_1306 248
588 3300048916 Ga0496113_0360335 Ga0496113_0360335_238_984 248
589 3300048916 Ga0496113_0456483 Ga0496113_0456483_143_889 248
590 3300049569 Ga0501032_0091059 Ga0501032_0091059_1156_1905 248
591 3300049572 Ga0501036_0162363 Ga0501036_0162363_188_937 248
592 3300049575 Ga0501039_0019044 Ga0501039_0019044_1126_1875 248
593 3300049576 Ga0501040_0092571 Ga0501040_0092571_964_1713 248
594 3300049577 Ga0501041_0050100 Ga0501041_0050100_512_1261 248
595 3300049578 Ga0501042_0035112 Ga0501042_0035112_444_1193 248
596 3300049584 Ga0501068_0019660 Ga0501068_0019660_2319_3065 248
597 3300049584 Ga0501068_0047355 Ga0501068_0047355_325_1071 248
598 3300049584 Ga0501068_0443742 Ga0501068_0443742_30_779 248
599 3300049587 Ga0501071_0028451 Ga0501071_0028451_2758_3507 248
600 3300049587 Ga0501071_0658300 Ga0501071_0658300_10_759 248
601 3300049588 Ga0501072_0070912 Ga0501072_0070912_227_976 248
602 3300049591 Ga0501075_0016498 Ga0501075_0016498_338_1087 248
603 3300049592 Ga0501076_0133749 Ga0501076_0133749_760_1509 248
604 3300049741 Ga0501079_0025725 Ga0501079_0025725_2216_2965 248
605 3300049741 Ga0501079_0461999 Ga0501079_0461999_67_813 248
606 3300049742 Ga0501080_0153340 Ga0501080_0153340_509_1258 248
607 3300049824 Ga0501045_0019048 Ga0501045_0019048_858_1607 248
608 3300049824 Ga0501045_0266678 Ga0501045_0266678_157_903 248
609 3300050507 nmdc:mga05p37_1824_c1 nmdc:mga05p37_1824_c1_4701_5522 248
610 3300050508 nmdc:mga09592_13035_c1 nmdc:mga09592_13035_c1_5465_6211 248
611 3300050511 nmdc:mga08y16_683861_c1 nmdc:mga08y16_683861_c1_133_879 248
612 3300050512 nmdc:mga0n895_241712_c1 nmdc:mga0n895_241712_c1_255_1001 248
613 3300050513 nmdc:mga0rr50_766828_c1 nmdc:mga0rr50_766828_c1_58_804 248
614 3300050515 nmdc:mga0a205_94332_c1 nmdc:mga0a205_94332_c1_1482_2228 248
615 3300053078 Ga0495612_0000150 Ga0495612_0000150_11387_12133 248
616 3300060353 Ga0501082_0020148 Ga0501082_0020148_426_1175 248
617 3300003323 rootH1_10085238 rootH1_100852382 249
618 3300005530 Ga0070679_100250578 Ga0070679_1002505782 249
619 3300036401 Ga0373937_0108546 Ga0373937_0108546_1628_2395 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

38

240

0.92

PF00149

Metallophos

Calcineurin-like phosphoesterase

37

204

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.8347 3 235
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.8341 3 236
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.824 3 245
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.7844 3 236
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.7825 3 235
ID Description Score Start End Superfamily
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8335 3 236 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.824 3 245 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8161 5 246 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8097 5 246 3.60.21.10
af_O81024_43_107_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.7946 195 218 3.30.710.10
ID Description Score Start End GO Terms
AF-A0A535IR44-F1-model_v4 Metallophosphoesterase family protein 0.995 26 198 GO:0005737
GO:0016791
AF-A0A1F8SHN9-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9948 3 249 GO:0005737
GO:0016791
AF-A0A535VSG3-F1-model_v4 Metallophosphoesterase family protein 0.9899 1 249 GO:0005737
GO:0016791
AF-A0A3L7VZ11-F1-model_v4 Metallophosphoesterase 0.9886 3 249 GO:0005737
GO:0016791
AF-A0A1F8SHN9-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9868 3 249 GO:0005737
GO:0016791

Feature Viewer

pLDDT pTM Quality
97.35 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map