F469767

General Info

Members Datasets Scaffolds Average Seq Length
618 233 605 306

Family's Representative Sequence

Representative Sequence 3300048091|Ga0495626_0000085|Ga0495626_0000085_8517_9596
Length 359
Sequence VRELQFHDFLDEIPKASTIPEADVKIRFKFVELCYRLRTFACAKVAPSNHAIQTAVSFIETVPASVPYVGRFAPSPTGALHAGSLVAALASYLDARAHGGTWLVRIEDIDEGRSVAGAADEILAQLAWLGMHSDREVVWQSRRKHFYQAAYDSLAGQAYGCGCNRREIADSRLGFAPDGAAIYPGTCRHGLAPGRSARSLRLRVPAAGQDVITFEDRFAGTVSQKLASESGDFVLKRADGYWAYQLAVVVDDAEQGVTDVVRGADLLDSTPRQIYLQRLLGVPTPRYLHVPVVRNALGEKLSKQTGALAVRSDGDEGAAVAALRQAAGFLGLDVGAADSLASFYAAAVPAWSRLLDARA

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221684 Massilia sp. Root133 Isolate Unclassified
6 2818991436 Collimonas arenae 515 Isolate Unclassified
7 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
8 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
9 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
10 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
11 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
12 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
13 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
107 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
110 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
125 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
223 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
230 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
233 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.47
Nodule 0.32
Rhizoplane 3.72
Rhizosphere 82.2
Stem 0
Stem Tuber 0
Unclassified 7.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000231 3300002704 Bacteria 21910
2 JGI25155J39150_1000569 3300002704 Bacteria 8227
3 JGI25156J39149_1000254 3300002705 Bacteria 36723
4 JGI25156J39149_1001652 3300002705 Bacteria 9038
5 JGI25162J39368_1000001 3300002737 Bacteria 740113
6 JGI25162J39368_1009031 3300002737 Bacteria 1369
7 JGI25154J39366_1000216 3300002738 Bacteria 39678
8 JGI25154J39366_1000309 3300002738 Bacteria 28234
9 JGI25157J39369_1000337 3300002741 Bacteria 33353
10 JGI25159J45721_1007853 3300002987 Bacteria 3001
11 JGI25165J46597_1000001 3300003214 Bacteria 1111887
12 rootL2_10042985 3300003322 Bacteria 6069
13 rootL2_10073232 3300003322 Bacteria 5393
14 Ga0055538_1000001 3300003751 Bacteria 1111887
15 Ga0055539_1000001 3300003752 Bacteria 1111887
16 Ga0055533_1000003 3300003756 Bacteria 1111887
17 Ga0055532_1000005 3300003758 Bacteria 458107
18 Ga0055525_1000003 3300003759 Bacteria 962094
19 Ga0055535_1005468 3300003761 Bacteria 2771
20 Ga0055526_1002033 3300003771 Bacteria 13914
21 Ga0055537_1000122 3300003773 Bacteria 58918
22 Ga0055524_1025167 3300003775 Bacteria 1870
23 Ga0055534_1000217 3300003784 Bacteria 42503
24 Ga0055528_1000042 3300003790 Bacteria 104874
25 Ga0055541_1000001 3300003841 Bacteria 1111887
26 Ga0055543_1003804 3300004625 Bacteria 4294
27 Ga0065165_1000003 3300005262 Bacteria 390701
28 Ga0070670_100052233 3300005331 Bacteria 3510
29 Ga0070682_100015810 3300005337 Bacteria 4380
30 Ga0070660_100017278 3300005339 Bacteria 5255
31 Ga0070661_100007454 3300005344 Bacteria 7544
32 Ga0070659_100005057 3300005366 Bacteria 9456
33 Ga0070659_100054192 3300005366 Bacteria 3158
34 Ga0068853_100347458 3300005539 Bacteria 1379
35 Ga0068855_100033505 3300005563 Bacteria 6129
36 Ga0068855_100390090 3300005563 Bacteria 1527
37 Ga0070664_100274684 3300005564 Bacteria 1519
38 Ga0068856_100097587 3300005614 Bacteria 2928
39 Ga0068852_100001944 3300005616 Bacteria 14073
40 Ga0068852_100244537 3300005616 Bacteria 1716
41 Ga0068851_10040656 3300005834 Bacteria 2337
42 Ga0068862_100047499 3300005844 Bacteria 3664
43 Ga0070717_10214484 3300006028 Bacteria 1690
44 Ga0105240_10001776 3300009093 Bacteria 36388
45 Ga0105243_10061877 3300009148 Bacteria 2995
46 Ga0105242_10287941 3300009176 Bacteria 1495
47 Ga0105237_10056248 3300009545 Bacteria 3938
48 Ga0105237_10578502 3300009545 Bacteria 1130
49 Ga0105238_10115527 3300009551 Bacteria 2663
50 Ga0157371_10000001 3300013102 Bacteria 1162285
51 Ga0157369_10181117 3300013105 Bacteria 2217
52 Ga0163162_10181305 3300013306 Bacteria 2232
53 Ga0157380_10229259 3300014326 Bacteria 1667
54 Ga0182008_10024716 3300014497 Bacteria 3056
55 Ga0182008_10029801 3300014497 Bacteria 2755
56 Ga0182006_1036016 3300015261 Bacteria 1969
57 Ga0182005_1000335 3300015265 Bacteria 27471
58 Ga0209435_100004 3300025206 Bacteria 633417
59 Ga0209435_100192 3300025206 Bacteria 17942
60 Ga0209784_100004 3300025224 Bacteria 1378156
61 Ga0209566_100004 3300025225 Bacteria 1531866
62 Ga0209674_100006 3300025226 Bacteria 1531866
63 Ga0209147_100011 3300025229 Bacteria 702140
64 Ga0209563_100007 3300025230 Bacteria 1579402
65 Ga0209563_100009 3300025230 Bacteria 1378156
66 Ga0207427_100562 3300025231 Bacteria 18794
67 Ga0209437_100004 3300025233 Bacteria 1378156
68 Ga0209437_101120 3300025233 Bacteria 8252
69 Ga0209258_100441 3300025242 Bacteria 46899
70 Ga0209646_1000032 3300025246 Bacteria 375315
71 Ga0209646_1000052 3300025246 Bacteria 286370
72 Ga0209026_1000062 3300025250 Bacteria 213298
73 Ga0209026_1003016 3300025250 Bacteria 5810
74 Ga0209677_100005 3300025253 Bacteria 1378156
75 Ga0209148_1000241 3300025254 Bacteria 87665
76 Ga0209759_1000054 3300025256 Bacteria 211422
77 Ga0209759_1000481 3300025256 Bacteria 44298
78 Ga0209233_1000005 3300025261 Bacteria 1531866
79 Ga0209565_1000018 3300025263 Bacteria 460940
80 Ga0209455_1010438 3300025272 Bacteria 2361
81 Ga0209673_1000006 3300025273 Bacteria 650600
82 Ga0209130_1000036 3300025284 Bacteria 284111
83 Ga0209675_1000005 3300025291 Bacteria 849192
84 Ga0209564_1000078 3300025295 Bacteria 275766
85 Ga0209256_1000070 3300025299 Bacteria 245034
86 Ga0207705_10108793 3300025909 Bacteria 2046
87 Ga0207654_10001828 3300025911 Bacteria 11041
88 Ga0207695_10003255 3300025913 Bacteria 23086
89 Ga0207695_10038427 3300025913 Bacteria 5153
90 Ga0207657_10003000 3300025919 Bacteria 18084
91 Ga0207657_10009261 3300025919 Bacteria 9919
92 Ga0207657_10067917 3300025919 Bacteria 3030
93 Ga0207649_10031669 3300025920 Bacteria 3145
94 Ga0207649_10106380 3300025920 Bacteria 1866
95 Ga0207694_10045910 3300025924 Bacteria 3375
96 Ga0207650_10037641 3300025925 Bacteria 3527
97 Ga0207690_10003411 3300025932 Bacteria 9486
98 Ga0207690_10290312 3300025932 Bacteria 1276
99 Ga0207686_10215554 3300025934 Bacteria 1383
100 Ga0207679_10000976 3300025945 Bacteria 18379
101 Ga0207679_10182783 3300025945 Bacteria 1736
102 Ga0207667_10006781 3300025949 Bacteria 13831
103 Ga0207667_10045349 3300025949 Bacteria 4657
104 Ga0207667_10290834 3300025949 Bacteria 1669
105 Ga0207640_10273443 3300025981 Bacteria 1323
106 Ga0207702_10073449 3300026078 Bacteria 2949
107 Ga0207674_10475541 3300026116 Bacteria 1208
108 Ga0207698_10008488 3300026142 Bacteria 6502
109 Ga0268265_10049991 3300028380 Bacteria 3148
110 Ga0316177_1064384 3300030731 Bacteria 4510
111 Ga0307408_100004778 3300031548 Bacteria 9125
112 Ga0307518_10105009 3300031838 Bacteria 2018
113 Ga0395899_0000028 3300037312 Bacteria 334378
114 Ga0395899_0000962 3300037312 Bacteria 26757
115 Ga0395899_0001947 3300037312 Bacteria 16986
116 Ga0395899_0004273 3300037312 Bacteria 11170
117 Ga0395899_0018098 3300037312 Bacteria 5361
118 Ga0395899_0042848 3300037312 Bacteria 3377
119 Ga0395899_0059120 3300037312 Bacteria 2825
120 Ga0395899_0097940 3300037312 Bacteria 2119
121 Ga0395899_0130270 3300037312 Bacteria 1796
122 Ga0395900_0001133 3300037418 Bacteria 33674
123 Ga0395900_0002311 3300037418 Bacteria 21134
124 Ga0395900_0004029 3300037418 Bacteria 15679
125 Ga0395900_0004876 3300037418 Bacteria 14129
126 Ga0395900_0011123 3300037418 Bacteria 9197
127 Ga0395900_0066254 3300037418 Bacteria 3711
128 Ga0395900_0076601 3300037418 Bacteria 3437
129 Ga0395900_0127259 3300037418 Bacteria 2612
130 Ga0395898_0020583 3300037466 Bacteria 6700
131 Ga0395898_0030720 3300037466 Bacteria 5374
132 Ga0395898_0035623 3300037466 Bacteria 4946
133 Ga0395898_0137912 3300037466 Bacteria 2335
134 Ga0395905_0000274 3300037471 Bacteria 76206
135 Ga0395905_0032690 3300037471 Bacteria 4891
136 Ga0395905_0059820 3300037471 Bacteria 3562
137 Ga0395905_0111220 3300037471 Bacteria 2572
138 Ga0395905_0197834 3300037471 Bacteria 1884
139 Ga0395905_0232426 3300037471 Bacteria 1724
140 Ga0395901_0000217 3300038443 Bacteria 72615
141 Ga0395901_0002580 3300038443 Bacteria 18373
142 Ga0395901_0005885 3300038443 Bacteria 12409
143 Ga0395901_0036053 3300038443 Bacteria 5110
144 Ga0395901_0079528 3300038443 Bacteria 3423
145 Ga0395901_0085553 3300038443 Bacteria 3296
146 Ga0395901_0086001 3300038443 Bacteria 3287
147 Ga0395901_0640435 3300038443 Bacteria 1067
148 Ga0395901_0641637 3300038443 Bacteria 1066
149 Ga0436361_0483400 3300039447 Bacteria 10630
150 Ga0439433_0025877 3300041999 Bacteria 1327
151 Ga0439448_0004858 3300042005 Bacteria 3812
152 Ga0439448_0044818 3300042005 Bacteria 1439
153 Ga0439449_0032798 3300042007 Bacteria 1935
154 Ga0439450_009271 3300042008 Bacteria 1864
155 Ga0439450_052381 3300042008 Bacteria 972
156 Ga0439458_0002771 3300042157 Bacteria 4218
157 Ga0466972_0002141 3300044658 Bacteria 9697
158 Ga0466965_0000811 3300044683 Bacteria 11789
159 Ga0466965_0015712 3300044683 Bacteria 3597
160 Ga0466965_0074714 3300044683 Bacteria 1708
161 Ga0466966_0003126 3300044684 Bacteria 10894
162 Ga0466966_0011786 3300044684 Bacteria 5789
163 Ga0466966_0035386 3300044684 Bacteria 3226
164 Ga0466966_0064800 3300044684 Bacteria 2299
165 Ga0466961_0067784 3300044693 Bacteria 2266
166 Ga0466963_0145430 3300044694 Bacteria 1644
167 Ga0466964_0001360 3300044706 Bacteria 8354
168 Ga0466964_0002165 3300044706 Bacteria 6943
169 Ga0466968_0000959 3300044735 Bacteria 10127
170 Ga0466970_0005760 3300044765 Bacteria 6158
171 Ga0466957_0000259 3300044842 Bacteria 25418
172 Ga0466957_0010474 3300044842 Bacteria 5328
173 Ga0466959_0004736 3300045049 Bacteria 9164
174 Ga0466959_0006140 3300045049 Bacteria 8300
175 Ga0466959_0025801 3300045049 Bacteria 4358
176 Ga0466959_0037988 3300045049 Bacteria 3558
177 Ga0466959_0077461 3300045049 Bacteria 2399
178 Ga0466958_0053416 3300045836 Bacteria 2449
179 Ga0466958_0110458 3300045836 Bacteria 1716
180 Ga0495617_000029 3300046452 Bacteria 153239
181 Ga0495617_002147 3300046452 Bacteria 8107
182 Ga0495627_000860 3300046453 Bacteria 21681
183 Ga0495590_0000284 3300046457 Bacteria 27320
184 Ga0495590_0000578 3300046457 Bacteria 17373
185 Ga0495590_0021505 3300046457 Bacteria 2286
186 Ga0495591_000240 3300046458 Bacteria 52636
187 Ga0495629_0007221 3300046459 Bacteria 8181
188 Ga0495629_0173311 3300046459 Bacteria 1496
189 Ga0495629_0192443 3300046459 Bacteria 1412
190 Ga0495638_0014941 3300046460 Bacteria 5229
191 Ga0495638_0187863 3300046460 Bacteria 1174
192 Ga0495651_0068349 3300046462 Bacteria 2708
193 Ga0495653_0054133 3300046463 Bacteria 3067
194 Ga0495653_0057911 3300046463 Bacteria 2947
195 Ga0495653_0060189 3300046463 Bacteria 2878
196 Ga0495653_0103778 3300046463 Bacteria 2055
197 Ga0495650_0000011 3300046471 Bacteria 615329
198 Ga0495650_0001041 3300046471 Bacteria 31054
199 Ga0495650_0002636 3300046471 Bacteria 14038
200 Ga0495580_0172567 3300046472 Bacteria 1494
201 Ga0495582_0015069 3300046473 Bacteria 4251
202 Ga0495582_0020097 3300046473 Bacteria 3654
203 Ga0495605_0000359 3300046474 Bacteria 43761
204 Ga0495605_0007163 3300046474 Bacteria 6343
205 Ga0495605_0010281 3300046474 Bacteria 5240
206 Ga0495605_0021099 3300046474 Bacteria 3454
207 Ga0495605_0052723 3300046474 Bacteria 1975
208 Ga0495584_0000421 3300046491 Bacteria 29230
209 Ga0495584_0000473 3300046491 Bacteria 27603
210 Ga0495584_0000680 3300046491 Bacteria 22627
211 Ga0495584_0000983 3300046491 Bacteria 17863
212 Ga0495584_0001672 3300046491 Bacteria 13028
213 Ga0495584_0001737 3300046491 Bacteria 12740
214 Ga0495584_0002692 3300046491 Bacteria 9989
215 Ga0495584_0005657 3300046491 Bacteria 6606
216 Ga0495584_0008639 3300046491 Bacteria 5273
217 Ga0495584_0017319 3300046491 Bacteria 3670
218 Ga0495584_0029671 3300046491 Bacteria 2772
219 Ga0495584_0048392 3300046491 Bacteria 2143
220 Ga0495585_0001564 3300046492 Bacteria 17767
221 Ga0495585_0003260 3300046492 Bacteria 11055
222 Ga0495585_0004127 3300046492 Bacteria 9506
223 Ga0495585_0004290 3300046492 Bacteria 9281
224 Ga0495585_0006686 3300046492 Bacteria 7122
225 Ga0495585_0007451 3300046492 Bacteria 6695
226 Ga0495585_0017554 3300046492 Bacteria 4134
227 Ga0495585_0026314 3300046492 Bacteria 3322
228 Ga0495585_0034283 3300046492 Bacteria 2869
229 Ga0495585_0039344 3300046492 Bacteria 2658
230 Ga0495585_0042303 3300046492 Bacteria 2552
231 Ga0495585_0047717 3300046492 Bacteria 2384
232 Ga0495585_0077017 3300046492 Bacteria 1811
233 Ga0495585_0079347 3300046492 Bacteria 1780
234 Ga0495596_0001442 3300046500 Bacteria 13606
235 Ga0495596_0001830 3300046500 Bacteria 11803
236 Ga0495596_0003064 3300046500 Bacteria 8637
237 Ga0495596_0005350 3300046500 Bacteria 6076
238 Ga0495596_0006175 3300046500 Bacteria 5550
239 Ga0495596_0011466 3300046500 Bacteria 3824
240 Ga0495596_0013547 3300046500 Bacteria 3454
241 Ga0495596_0030137 3300046500 Bacteria 2172
242 Ga0495596_0034805 3300046500 Bacteria 1998
243 Ga0495596_0047849 3300046500 Bacteria 1677
244 Ga0495596_0057456 3300046500 Bacteria 1518
245 Ga0495607_0001873 3300046501 Bacteria 17836
246 Ga0495607_0003520 3300046501 Bacteria 11958
247 Ga0495607_0005336 3300046501 Bacteria 9234
248 Ga0495607_0029857 3300046501 Bacteria 3353
249 Ga0495607_0036184 3300046501 Bacteria 2977
250 Ga0495607_0043812 3300046501 Bacteria 2643
251 Ga0495607_0053828 3300046501 Bacteria 2322
252 Ga0495607_0087215 3300046501 Bacteria 1699
253 Ga0495607_0102598 3300046501 Bacteria 1529
254 Ga0495583_0000016 3300046506 Bacteria 312691
255 Ga0495583_0000660 3300046506 Bacteria 45145
256 Ga0495583_0001945 3300046506 Bacteria 19045
257 Ga0495583_0004249 3300046506 Bacteria 10386
258 Ga0495583_0004362 3300046506 Bacteria 10187
259 Ga0495583_0007164 3300046506 Bacteria 7092
260 Ga0495583_0012122 3300046506 Bacteria 4903
261 Ga0495583_0012392 3300046506 Bacteria 4829
262 Ga0495583_0013928 3300046506 Bacteria 4458
263 Ga0495583_0019681 3300046506 Bacteria 3516
264 Ga0495606_0000360 3300046507 Bacteria 77832
265 Ga0495606_0000452 3300046507 Bacteria 67182
266 Ga0495606_0008264 3300046507 Bacteria 9082
267 Ga0495606_0014176 3300046507 Bacteria 6239
268 Ga0495606_0015206 3300046507 Bacteria 5947
269 Ga0495606_0019130 3300046507 Bacteria 5106
270 Ga0495606_0040996 3300046507 Bacteria 3107
271 Ga0495606_0167337 3300046507 Bacteria 1278
272 Ga0495608_0009271 3300046511 Bacteria 6881
273 Ga0495610_0002372 3300046512 Bacteria 15918
274 Ga0495616_0000584 3300046513 Bacteria 27429
275 Ga0495616_0001909 3300046513 Bacteria 14059
276 Ga0495616_0004977 3300046513 Bacteria 8290
277 Ga0495616_0010332 3300046513 Bacteria 5409
278 Ga0495616_0010621 3300046513 Bacteria 5320
279 Ga0495616_0016380 3300046513 Bacteria 4104
280 Ga0495616_0016772 3300046513 Bacteria 4047
281 Ga0495616_0039857 3300046513 Bacteria 2403
282 Ga0495616_0093871 3300046513 Bacteria 1416
283 Ga0495618_0035517 3300046514 Bacteria 3128
284 Ga0495620_0005536 3300046515 Bacteria 7039
285 Ga0495628_0013564 3300046516 Bacteria 6853
286 Ga0495631_0001075 3300046518 Bacteria 16958
287 Ga0495631_0002730 3300046518 Bacteria 9789
288 Ga0495631_0003480 3300046518 Bacteria 8611
289 Ga0495631_0003714 3300046518 Bacteria 8325
290 Ga0495631_0030433 3300046518 Bacteria 2448
291 Ga0495631_0033662 3300046518 Bacteria 2300
292 Ga0495631_0048481 3300046518 Bacteria 1862
293 Ga0495631_0059091 3300046518 Bacteria 1666
294 Ga0495631_0128558 3300046518 Bacteria 1088
295 Ga0495632_0000911 3300046519 Bacteria 25927
296 Ga0495632_0000969 3300046519 Bacteria 25051
297 Ga0495632_0004880 3300046519 Bacteria 8995
298 Ga0495632_0010396 3300046519 Bacteria 5516
299 Ga0495632_0070306 3300046519 Bacteria 1683
300 Ga0495632_0130744 3300046519 Bacteria 1168
301 Ga0495637_0000004 3300046520 Bacteria 589740
302 Ga0495643_0000960 3300046522 Bacteria 29547
303 Ga0495643_0002160 3300046522 Bacteria 16128
304 Ga0495643_0029608 3300046522 Bacteria 3062
305 Ga0495643_0036040 3300046522 Bacteria 2720
306 Ga0495643_0052314 3300046522 Bacteria 2193
307 Ga0495643_0147566 3300046522 Bacteria 1167
308 Ga0495644_0001247 3300046523 Bacteria 10435
309 Ga0495644_0002109 3300046523 Bacteria 7993
310 Ga0495644_0002405 3300046523 Bacteria 7467
311 Ga0495644_0005105 3300046523 Bacteria 5137
312 Ga0495644_0005479 3300046523 Bacteria 4957
313 Ga0495644_0005720 3300046523 Bacteria 4852
314 Ga0495644_0009356 3300046523 Bacteria 3779
315 Ga0495644_0032166 3300046523 Bacteria 1982
316 Ga0495644_0038910 3300046523 Bacteria 1793
317 Ga0495648_0000547 3300046524 Bacteria 40394
318 Ga0495648_0002909 3300046524 Bacteria 15387
319 Ga0495648_0004818 3300046524 Bacteria 11387
320 Ga0495648_0006368 3300046524 Bacteria 9651
321 Ga0495648_0011743 3300046524 Bacteria 6572
322 Ga0495648_0019964 3300046524 Bacteria 4688
323 Ga0495648_0038661 3300046524 Bacteria 3048
324 Ga0495648_0098699 3300046524 Bacteria 1617
325 Ga0495666_0000211 3300046526 Bacteria 24804
326 Ga0495666_0009248 3300046526 Bacteria 4927
327 Ga0495666_0029894 3300046526 Bacteria 2678
328 Ga0495666_0056161 3300046526 Bacteria 1886
329 Ga0495666_0099759 3300046526 Bacteria 1368
330 Ga0495642_0000149 3300046528 Bacteria 40735
331 Ga0495642_0001150 3300046528 Bacteria 12168
332 Ga0495642_0005068 3300046528 Bacteria 5074
333 Ga0495642_0008869 3300046528 Bacteria 3847
334 Ga0495642_0010011 3300046528 Bacteria 3632
335 Ga0495642_0017768 3300046528 Bacteria 2779
336 Ga0495642_0036455 3300046528 Bacteria 1987
337 Ga0495642_0041145 3300046528 Bacteria 1879
338 Ga0495642_0100174 3300046528 Bacteria 1232
339 Ga0495652_0009196 3300046529 Bacteria 8985
340 Ga0495652_0013920 3300046529 Bacteria 7233
341 Ga0495652_0044948 3300046529 Bacteria 3801
342 Ga0495652_0252961 3300046529 Bacteria 1304
343 Ga0495654_0009857 3300046530 Bacteria 5219
344 Ga0495654_0027217 3300046530 Bacteria 2933
345 Ga0495654_0029967 3300046530 Bacteria 2771
346 Ga0495654_0061047 3300046530 Bacteria 1811
347 Ga0495665_0029648 3300046531 Bacteria 2931
348 Ga0495586_0004104 3300046535 Bacteria 7806
349 Ga0495586_0039548 3300046535 Bacteria 2535
350 Ga0495587_0016085 3300046536 Bacteria 4657
351 Ga0495587_0049154 3300046536 Bacteria 2496
352 Ga0495609_0003235 3300046538 Bacteria 9446
353 Ga0495609_0003957 3300046538 Bacteria 8295
354 Ga0495609_0011893 3300046538 Bacteria 4137
355 Ga0495609_0016809 3300046538 Bacteria 3407
356 Ga0495609_0022780 3300046538 Bacteria 2885
357 Ga0495609_0027227 3300046538 Bacteria 2614
358 Ga0495609_0082813 3300046538 Bacteria 1401
359 Ga0495609_0109740 3300046538 Bacteria 1191
360 Ga0495621_0006605 3300046539 Bacteria 3394
361 Ga0495597_0000334 3300046542 Bacteria 42179
362 Ga0495597_0000708 3300046542 Bacteria 26728
363 Ga0495597_0001360 3300046542 Bacteria 17718
364 Ga0495597_0002323 3300046542 Bacteria 12328
365 Ga0495645_0274574 3300046543 Bacteria 1111
366 Ga0495622_0001804 3300046557 Bacteria 10548
367 Ga0495622_0008886 3300046557 Bacteria 4654
368 Ga0495622_0016674 3300046557 Bacteria 3421
369 Ga0495622_0067833 3300046557 Bacteria 1648
370 Ga0495622_0093246 3300046557 Bacteria 1382
371 Ga0495622_0095298 3300046557 Bacteria 1366
372 Ga0495633_0001572 3300046558 Bacteria 17489
373 Ga0495633_0001663 3300046558 Bacteria 16773
374 Ga0495633_0005582 3300046558 Bacteria 7636
375 Ga0495633_0008644 3300046558 Bacteria 5717
376 Ga0495633_0014408 3300046558 Bacteria 4136
377 Ga0495633_0044976 3300046558 Bacteria 2091
378 Ga0495633_0054364 3300046558 Bacteria 1883
379 Ga0495633_0112553 3300046558 Bacteria 1262
380 Ga0495656_0000984 3300046615 Bacteria 9211
381 Ga0495656_0005418 3300046615 Bacteria 4404
382 Ga0495656_0017717 3300046615 Bacteria 2722
383 Ga0495668_0000046 3300046616 Bacteria 224203
384 Ga0495668_0000700 3300046616 Bacteria 40370
385 Ga0495668_0000915 3300046616 Bacteria 33010
386 Ga0495668_0002542 3300046616 Bacteria 14868
387 Ga0495668_0004179 3300046616 Bacteria 10420
388 Ga0495668_0008561 3300046616 Bacteria 6368
389 Ga0495668_0023344 3300046616 Bacteria 3529
390 Ga0495668_0104753 3300046616 Bacteria 1547
391 Ga0495668_0197537 3300046616 Bacteria 1101
392 Ga0495634_0127864 3300046642 Bacteria 1622
393 Ga0495634_0161247 3300046642 Bacteria 1414
394 Ga0495611_0002008 3300046648 Bacteria 9631
395 Ga0495611_0002009 3300046648 Bacteria 9631
396 Ga0495611_0002143 3300046648 Bacteria 9222
397 Ga0495611_0018746 3300046648 Bacteria 2968
398 Ga0495611_0021242 3300046648 Bacteria 2802
399 Ga0495611_0027676 3300046648 Bacteria 2479
400 Ga0495611_0046111 3300046648 Bacteria 1953
401 Ga0495625_0003638 3300046660 Bacteria 15115
402 Ga0495625_0005795 3300046660 Bacteria 11159
403 Ga0495625_0008581 3300046660 Bacteria 8699
404 Ga0495625_0074814 3300046660 Bacteria 2371
405 Ga0495625_0116850 3300046660 Bacteria 1819
406 Ga0495659_0003520 3300046664 Bacteria 4991
407 Ga0495661_0001839 3300046665 Bacteria 16980
408 Ga0495661_0002396 3300046665 Bacteria 14473
409 Ga0495661_0006437 3300046665 Bacteria 8259
410 Ga0495661_0007332 3300046665 Bacteria 7687
411 Ga0495661_0007800 3300046665 Bacteria 7445
412 Ga0495661_0009264 3300046665 Bacteria 6763
413 Ga0495661_0016789 3300046665 Bacteria 4842
414 Ga0495661_0044487 3300046665 Bacteria 2721
415 Ga0495661_0050593 3300046665 Bacteria 2514
416 Ga0495661_0087237 3300046665 Bacteria 1784
417 Ga0495661_0092747 3300046665 Bacteria 1715
418 Ga0495661_0116551 3300046665 Bacteria 1481
419 Ga0495588_0000424 3300046674 Bacteria 22685
420 Ga0495588_0055376 3300046674 Bacteria 2046
421 Ga0495657_0017127 3300046675 Bacteria 5267
422 Ga0495599_0015536 3300046678 Bacteria 4726
423 Ga0495623_0006531 3300046679 Bacteria 7591
424 Ga0495623_0017119 3300046679 Bacteria 4682
425 Ga0495623_0094620 3300046679 Bacteria 1827
426 Ga0495646_0014239 3300046680 Bacteria 5057
427 Ga0495669_0000161 3300046684 Bacteria 42856
428 Ga0495669_0000918 3300046684 Bacteria 12312
429 Ga0495669_0003258 3300046684 Bacteria 6678
430 Ga0495669_0003802 3300046684 Bacteria 6203
431 Ga0495669_0008058 3300046684 Bacteria 4421
432 Ga0495669_0013621 3300046684 Bacteria 3469
433 Ga0495669_0054294 3300046684 Bacteria 1803
434 Ga0495669_0099722 3300046684 Bacteria 1348
435 Ga0495613_0068983 3300046689 Bacteria 2578
436 Ga0495624_0008478 3300046690 Bacteria 7164
437 Ga0495624_0036654 3300046690 Bacteria 3159
438 Ga0495670_0000766 3300046691 Bacteria 15420
439 Ga0495670_0003129 3300046691 Bacteria 8153
440 Ga0495670_0003471 3300046691 Bacteria 7742
441 Ga0495670_0006133 3300046691 Bacteria 5900
442 Ga0495670_0007737 3300046691 Bacteria 5284
443 Ga0495670_0015524 3300046691 Bacteria 3742
444 Ga0495670_0019075 3300046691 Bacteria 3379
445 Ga0495670_0040557 3300046691 Bacteria 2321
446 Ga0495670_0045669 3300046691 Bacteria 2187
447 Ga0495670_0051057 3300046691 Bacteria 2069
448 Ga0495671_0000329 3300046692 Bacteria 39770
449 Ga0495671_0001236 3300046692 Bacteria 17497
450 Ga0495671_0019879 3300046692 Bacteria 3544
451 Ga0495671_0024913 3300046692 Bacteria 3113
452 Ga0495671_0035359 3300046692 Bacteria 2537
453 Ga0495649_0000565 3300046694 Bacteria 31302
454 Ga0495649_0010548 3300046694 Bacteria 5446
455 Ga0495649_0035933 3300046694 Bacteria 2724
456 Ga0495649_0060752 3300046694 Bacteria 2033
457 Ga0495589_0000542 3300046794 Bacteria 26343
458 Ga0495589_0001209 3300046794 Bacteria 15365
459 Ga0495589_0003662 3300046794 Bacteria 8305
460 Ga0495589_0005414 3300046794 Bacteria 6731
461 Ga0495589_0010034 3300046794 Bacteria 4921
462 Ga0495589_0041928 3300046794 Bacteria 2281
463 Ga0495589_0071404 3300046794 Bacteria 1697
464 Ga0495600_0011452 3300046809 Bacteria 5527
465 Ga0495600_0025084 3300046809 Bacteria 3842
466 Ga0495600_0031868 3300046809 Bacteria 3417
467 Ga0495660_0005212 3300046810 Bacteria 7797
468 Ga0495660_0009081 3300046810 Bacteria 5804
469 Ga0495581_0010892 3300047315 Bacteria 5258
470 Ga0495581_0018535 3300047315 Bacteria 4042
471 Ga0495581_0031597 3300047315 Bacteria 3067
472 Ga0495581_0148335 3300047315 Bacteria 1369
473 Ga0495604_0011716 3300047317 Bacteria 6973
474 Ga0495604_0060198 3300047317 Bacteria 2909
475 Ga0495604_0065737 3300047317 Bacteria 2760
476 Ga0495604_0085519 3300047317 Bacteria 2353
477 Ga0495604_0103163 3300047317 Bacteria 2092
478 Ga0495636_0000666 3300047318 Bacteria 12597
479 Ga0495636_0002491 3300047318 Bacteria 7058
480 Ga0495636_0002555 3300047318 Bacteria 6993
481 Ga0495674_0017029 3300047319 Bacteria 6772
482 Ga0495672_0000342 3300047320 Bacteria 59691
483 Ga0495672_0000869 3300047320 Bacteria 31801
484 Ga0495672_0004681 3300047320 Bacteria 11083
485 Ga0495672_0005247 3300047320 Bacteria 10321
486 Ga0495672_0009308 3300047320 Bacteria 7132
487 Ga0495672_0035958 3300047320 Bacteria 3045
488 Ga0495672_0045806 3300047320 Bacteria 2614
489 Ga0495676_0000138 3300047321 Bacteria 55467
490 Ga0495676_0020325 3300047321 Bacteria 5828
491 Ga0495680_0009343 3300047322 Bacteria 8828
492 Ga0495680_0013540 3300047322 Bacteria 7109
493 Ga0495680_0116281 3300047322 Bacteria 1978
494 Ga0495683_0000764 3300047323 Bacteria 23128
495 Ga0495683_0000884 3300047323 Bacteria 21141
496 Ga0495683_0011518 3300047323 Bacteria 4650
497 Ga0495683_0033888 3300047323 Bacteria 2597
498 Ga0495683_0034144 3300047323 Bacteria 2587
499 Ga0495683_0074177 3300047323 Bacteria 1668
500 Ga0495687_000149 3300047443 Bacteria 106301
501 Ga0495687_000856 3300047443 Bacteria 32433
502 Ga0495687_000892 3300047443 Bacteria 31395
503 Ga0495687_005149 3300047443 Bacteria 8460
504 Ga0495675_0126155 3300047444 Bacteria 1592
505 Ga0495677_0000601 3300047445 Bacteria 14733
506 Ga0495677_0001218 3300047445 Bacteria 10305
507 Ga0495677_0001922 3300047445 Bacteria 8305
508 Ga0495677_0006508 3300047445 Bacteria 4412
509 Ga0495677_0016072 3300047445 Bacteria 2716
510 Ga0495677_0016501 3300047445 Bacteria 2680
511 Ga0495677_0024170 3300047445 Bacteria 2204
512 Ga0495677_0024583 3300047445 Bacteria 2185
513 Ga0495679_003558 3300047446 Bacteria 7448
514 Ga0495685_000107 3300047447 Bacteria 29740
515 Ga0495685_003866 3300047447 Bacteria 4802
516 Ga0495685_005078 3300047447 Bacteria 4285
517 Ga0495673_0013280 3300047469 Bacteria 4332
518 Ga0495681_0000456 3300047470 Bacteria 31327
519 Ga0495681_0001166 3300047470 Bacteria 19946
520 Ga0495681_0002172 3300047470 Bacteria 14208
521 Ga0495681_0011398 3300047470 Bacteria 5294
522 Ga0495686_0000830 3300047472 Bacteria 39724
523 Ga0495686_0001280 3300047472 Bacteria 28422
524 Ga0495686_0001510 3300047472 Bacteria 25040
525 Ga0495686_0009063 3300047472 Bacteria 7218
526 Ga0495686_0016505 3300047472 Bacteria 5007
527 Ga0495593_0012656 3300047673 Bacteria 4819
528 Ga0495593_0018101 3300047673 Bacteria 3961
529 Ga0495593_0021559 3300047673 Bacteria 3596
530 Ga0495602_0002600 3300048088 Bacteria 18448
531 Ga0495602_0029009 3300048088 Bacteria 5283
532 Ga0495614_0008578 3300048089 Bacteria 4544
533 Ga0495626_0000085 3300048091 Bacteria 125255
534 Ga0495626_0002291 3300048091 Bacteria 13567
535 Ga0495626_0002495 3300048091 Bacteria 12713
536 Ga0495626_0004720 3300048091 Bacteria 8247
537 Ga0495626_0005956 3300048091 Bacteria 7012
538 Ga0495626_0006986 3300048091 Bacteria 6348
539 Ga0495626_0008174 3300048091 Bacteria 5764
540 Ga0495626_0013524 3300048091 Bacteria 4238
541 Ga0495626_0015421 3300048091 Bacteria 3912
542 Ga0495626_0018775 3300048091 Bacteria 3464
543 Ga0495626_0024931 3300048091 Bacteria 2928
544 Ga0495626_0037305 3300048091 Bacteria 2310
545 Ga0495626_0037494 3300048091 Bacteria 2303
546 Ga0495626_0049051 3300048091 Bacteria 1956
547 Ga0495626_0063833 3300048091 Bacteria 1669
548 Ga0496101_0041675 3300048904 Bacteria 3275
549 Ga0496102_0000463 3300048905 Bacteria 45105
550 Ga0496102_0000470 3300048905 Bacteria 44790
551 Ga0496102_0060149 3300048905 Bacteria 3475
552 Ga0496102_0257379 3300048905 Bacteria 1646
553 Ga0496103_0009590 3300048906 Bacteria 5731
554 Ga0496103_0017062 3300048906 Bacteria 4341
555 Ga0496105_0100007 3300048908 Bacteria 2395
556 Ga0496105_0182916 3300048908 Bacteria 1716
557 Ga0496105_0282184 3300048908 Bacteria 1339
558 Ga0496106_0140034 3300048909 Bacteria 1902
559 Ga0496106_0245367 3300048909 Bacteria 1431
560 Ga0496107_0052831 3300048910 Bacteria 2931
561 Ga0496107_0058587 3300048910 Bacteria 2785
562 Ga0496107_0299012 3300048910 Bacteria 1198
563 Ga0496108_0100681 3300048911 Bacteria 2465
564 Ga0496110_0000301 3300048913 Bacteria 32495
565 Ga0496110_0008326 3300048913 Bacteria 8342
566 Ga0496110_0099195 3300048913 Bacteria 2611
567 Ga0496113_0001462 3300048916 Bacteria 13164
568 Ga0496114_0084374 3300048917 Bacteria 2690
569 Ga0496115_0227030 3300048918 Bacteria 1540
570 Ga0496115_0261216 3300048918 Bacteria 1424
571 Ga0496121_0247150 3300048924 Bacteria 1239
572 Ga0496122_0000249 3300048925 Bacteria 121066
573 Ga0496122_0002158 3300048925 Bacteria 28834
574 Ga0496122_0002461 3300048925 Bacteria 26207
575 Ga0496122_0017558 3300048925 Bacteria 6680
576 Ga0496123_0000347 3300048926 Bacteria 86788
577 Ga0496123_0001417 3300048926 Bacteria 33507
578 Ga0496123_0002690 3300048926 Bacteria 21402
579 Ga0496123_0144052 3300048926 Bacteria 1297
580 Ga0496124_0009412 3300048927 Bacteria 10063
581 Ga0496124_0034201 3300048927 Bacteria 4464
582 Ga0496124_0034401 3300048927 Bacteria 4448
583 Ga0496124_0042495 3300048927 Bacteria 3914
584 Ga0496124_0132325 3300048927 Bacteria 1980
585 Ga0496125_0001876 3300048928 Bacteria 28875
586 Ga0496125_0001889 3300048928 Bacteria 28781
587 Ga0496125_0046803 3300048928 Bacteria 3625
588 Ga0496125_0080641 3300048928 Bacteria 2489
589 Ga0495678_000784 3300049459 Bacteria 28475
590 Ga0495678_000887 3300049459 Bacteria 26597
591 Ga0495678_001594 3300049459 Bacteria 17374
592 Ga0495678_005759 3300049459 Bacteria 6732
593 Ga0495678_008663 3300049459 Bacteria 5113
594 Ga0495682_0000793 3300049460 Bacteria 20009
595 Ga0495682_0001573 3300049460 Bacteria 11905
596 Ga0495682_0012972 3300049460 Bacteria 3181
597 Ga0495682_0022545 3300049460 Bacteria 2355
598 Ga0501036_0276074 3300049572 Bacteria 1407
599 Ga0501039_0276216 3300049575 Bacteria 1321
600 Ga0501035_0017229 3300049822 Bacteria 6659
601 Ga0501045_0569128 3300049824 Bacteria 840
602 Ga0495601_0012846 3300053077 Bacteria 5027
603 Ga0500595_002888 3300053119 Bacteria 8233
604 Ga0500619_001947 3300053154 Bacteria 3837
605 Ga0466962_0157227 3300061719 Bacteria 1104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049824 Ga0501045_0569128 Ga0501045_0569128_48_821 235
2 3300046692 Ga0495671_0019879 Ga0495671_0019879_33_833 249
3 3300003771 Ga0055526_1002033 Ga0055526_10020334 264
4 3300003773 Ga0055537_1000122 Ga0055537_100012258 264
5 3300003775 Ga0055524_1025167 Ga0055524_10251672 264
6 3300003784 Ga0055534_1000217 Ga0055534_100021718 264
7 3300003790 Ga0055528_1000042 Ga0055528_100004258 264
8 iso_pu_bacteria 8002869464 8002872366 265
9 3300005844 Ga0068862_100047499 Ga0068862_1000474992 268
10 3300028380 Ga0268265_10049991 Ga0268265_100499912 268
11 3300014326 Ga0157380_10229259 Ga0157380_102292592 269
12 3300047472 Ga0495686_0016505 Ga0495686_0016505_3418_4272 271
13 3300046615 Ga0495656_0000984 Ga0495656_0000984_6334_7257 276
14 3300046665 Ga0495661_0009264 Ga0495661_0009264_1479_2423 277
15 3300046501 Ga0495607_0003520 Ga0495607_0003520_7260_8201 278
16 3300046519 Ga0495632_0004880 Ga0495632_0004880_632_1585 278
17 3300046524 Ga0495648_0038661 Ga0495648_0038661_1092_1988 278
18 3300046665 Ga0495661_0002396 Ga0495661_0002396_13062_14003 278
19 3300047445 Ga0495677_0001218 Ga0495677_0001218_5065_6006 278
20 3300003322 rootL2_10073232 rootL2_100732324 279
21 3300009545 Ga0105237_10578502 Ga0105237_105785021 280
22 3300025911 Ga0207654_10001828 Ga0207654_100018289 280
23 3300025949 Ga0207667_10006781 Ga0207667_1000678111 280
24 3300042005 Ga0439448_0044818 Ga0439448_0044818_338_1243 280
25 3300005366 Ga0070659_100054192 Ga0070659_1000541921 281
26 3300005616 Ga0068852_100244537 Ga0068852_1002445372 281
27 3300009148 Ga0105243_10061877 Ga0105243_100618772 281
28 3300009176 Ga0105242_10287941 Ga0105242_102879411 281
29 3300009551 Ga0105238_10115527 Ga0105238_101155272 281
30 3300025920 Ga0207649_10106380 Ga0207649_101063802 281
31 3300025932 Ga0207690_10290312 Ga0207690_102903121 281
32 3300025934 Ga0207686_10215554 Ga0207686_102155542 281
33 3300025981 Ga0207640_10273443 Ga0207640_102734432 281
34 3300026116 Ga0207674_10475541 Ga0207674_104755412 281
35 3300037312 Ga0395899_0018098 Ga0395899_0018098_3944_4846 281
36 3300037418 Ga0395900_0004029 Ga0395900_0004029_13151_14053 281
37 3300037466 Ga0395898_0030720 Ga0395898_0030720_3135_4037 281
38 3300037471 Ga0395905_0197834 Ga0395905_0197834_549_1451 281
39 3300038443 Ga0395901_0000217 Ga0395901_0000217_18310_19221 281
40 3300038443 Ga0395901_0005885 Ga0395901_0005885_5751_6653 281
41 3300038443 Ga0395901_0036053 Ga0395901_0036053_3564_4481 281
42 3300042008 Ga0439450_009271 Ga0439450_009271_11_928 281
43 3300042157 Ga0439458_0002771 Ga0439458_0002771_207_1136 281
44 3300044684 Ga0466966_0064800 Ga0466966_0064800_133_1035 281
45 3300044694 Ga0466963_0145430 Ga0466963_0145430_227_1135 281
46 3300044842 Ga0466957_0000259 Ga0466957_0000259_13235_14137 281
47 3300045049 Ga0466959_0004736 Ga0466959_0004736_779_1681 281
48 3300048904 Ga0496101_0041675 Ga0496101_0041675_113_1018 281
49 3300048910 Ga0496107_0299012 Ga0496107_0299012_221_1126 281
50 3300048927 Ga0496124_0034401 Ga0496124_0034401_949_1866 281
51 3300039447 Ga0436361_0483400 Ga0436361_0483400_324_1241 282
52 3300041999 Ga0439433_0025877 Ga0439433_0025877_320_1237 282
53 3300042007 Ga0439449_0032798 Ga0439449_0032798_291_1208 282
54 3300044683 Ga0466965_0015712 Ga0466965_0015712_835_1737 282
55 3300042005 Ga0439448_0004858 Ga0439448_0004858_2864_3769 283
56 3300042008 Ga0439450_052381 Ga0439450_052381_13_918 283
57 3300044706 Ga0466964_0002165 Ga0466964_0002165_1474_2379 283
58 3300046519 Ga0495632_0000969 Ga0495632_0000969_2400_3371 283
59 3300046665 Ga0495661_0007332 Ga0495661_0007332_1745_2716 283
60 3300005339 Ga0070660_100017278 Ga0070660_1000172782 284
61 3300005344 Ga0070661_100007454 Ga0070661_1000074542 284
62 3300005366 Ga0070659_100005057 Ga0070659_1000050578 284
63 3300025919 Ga0207657_10009261 Ga0207657_100092619 284
64 3300025920 Ga0207649_10031669 Ga0207649_100316692 284
65 3300025932 Ga0207690_10003411 Ga0207690_100034113 284
66 3300025945 Ga0207679_10000976 Ga0207679_100009769 284
67 3300030731 Ga0316177_1064384 Ga0316177_10643842 284
68 3300037471 Ga0395905_0232426 Ga0395905_0232426_697_1566 284
69 3300044765 Ga0466970_0005760 Ga0466970_0005760_4249_5115 284
70 3300045049 Ga0466959_0025801 Ga0466959_0025801_1781_2647 284
71 3300046539 Ga0495621_0006605 Ga0495621_0006605_2040_2915 284
72 3300048908 Ga0496105_0100007 Ga0496105_0100007_1365_2240 284
73 3300048911 Ga0496108_0100681 Ga0496108_0100681_303_1178 284
74 3300048913 Ga0496110_0099195 Ga0496110_0099195_1289_2164 284
75 3300006028 Ga0070717_10214484 Ga0070717_102144842 285
76 3300031548 Ga0307408_100004778 Ga0307408_1000047784 285
77 3300037418 Ga0395900_0001133 Ga0395900_0001133_20462_21364 285
78 3300038443 Ga0395901_0002580 Ga0395901_0002580_1689_2561 285
79 iso_pu_bacteria 2643221556 2643802081 285
80 iso_pu_bacteria 2643221638 2644216080 285
81 iso_pu_bacteria 2643221684 2644473769 285
82 iso_pu_bacteria 8047673197 8047674154 285
83 3300037312 Ga0395899_0097940 Ga0395899_0097940_385_1275 286
84 3300037471 Ga0395905_0000274 Ga0395905_0000274_53973_54845 286
85 3300045836 Ga0466958_0110458 Ga0466958_0110458_44_934 286
86 3300046491 Ga0495584_0000983 Ga0495584_0000983_9664_10554 286
87 3300046506 Ga0495583_0013928 Ga0495583_0013928_1018_1932 286
88 3300046507 Ga0495606_0014176 Ga0495606_0014176_2512_3402 286
89 3300046616 Ga0495668_0000046 Ga0495668_0000046_182774_183691 286
90 3300046674 Ga0495588_0000424 Ga0495588_0000424_6994_7884 286
91 3300047443 Ga0495687_000856 Ga0495687_000856_11994_12884 286
92 3300047472 Ga0495686_0000830 Ga0495686_0000830_11901_12818 286
93 3300048905 Ga0496102_0060149 Ga0496102_0060149_1797_2681 286
94 3300002987 JGI25159J45721_1007853 JGI25159J45721_10078532 287
95 3300003322 rootL2_10042985 rootL2_100429857 287
96 3300004625 Ga0055543_1003804 Ga0055543_10038043 287
97 3300005262 Ga0065165_1000003 Ga0065165_1000003157 287
98 3300005563 Ga0068855_100390090 Ga0068855_1003900902 287
99 3300013105 Ga0157369_10181117 Ga0157369_101811172 287
100 3300025263 Ga0209565_1000018 Ga0209565_1000018232 287
101 3300025273 Ga0209673_1000006 Ga0209673_1000006540 287
102 3300025284 Ga0209130_1000036 Ga0209130_1000036176 287
103 3300025291 Ga0209675_1000005 Ga0209675_1000005232 287
104 3300025295 Ga0209564_1000078 Ga0209564_100007832 287
105 3300025299 Ga0209256_1000070 Ga0209256_100007053 287
106 3300025919 Ga0207657_10003000 Ga0207657_1000300017 287
107 3300025949 Ga0207667_10290834 Ga0207667_102908342 287
108 3300037312 Ga0395899_0000962 Ga0395899_0000962_9542_10417 287
109 3300037312 Ga0395899_0004273 Ga0395899_0004273_5263_6156 287
110 3300037418 Ga0395900_0002311 Ga0395900_0002311_9857_10750 287
111 3300037418 Ga0395900_0011123 Ga0395900_0011123_3519_4412 287
112 3300037418 Ga0395900_0076601 Ga0395900_0076601_954_1829 287
113 3300037418 Ga0395900_0127259 Ga0395900_0127259_1559_2452 287
114 3300037471 Ga0395905_0059820 Ga0395905_0059820_1688_2563 287
115 3300038443 Ga0395901_0640435 Ga0395901_0640435_104_979 287
116 3300038443 Ga0395901_0641637 Ga0395901_0641637_121_1014 287
117 3300044658 Ga0466972_0002141 Ga0466972_0002141_6583_7476 287
118 3300044683 Ga0466965_0000811 Ga0466965_0000811_2207_3100 287
119 3300044683 Ga0466965_0074714 Ga0466965_0074714_649_1542 287
120 3300044684 Ga0466966_0003126 Ga0466966_0003126_6922_7815 287
121 3300044684 Ga0466966_0011786 Ga0466966_0011786_1730_2623 287
122 3300044684 Ga0466966_0035386 Ga0466966_0035386_1243_2136 287
123 3300044693 Ga0466961_0067784 Ga0466961_0067784_1019_1912 287
124 3300044706 Ga0466964_0001360 Ga0466964_0001360_472_1365 287
125 3300044735 Ga0466968_0000959 Ga0466968_0000959_3225_4118 287
126 3300045049 Ga0466959_0006140 Ga0466959_0006140_5428_6321 287
127 3300045049 Ga0466959_0037988 Ga0466959_0037988_2611_3504 287
128 3300045049 Ga0466959_0077461 Ga0466959_0077461_918_1811 287
129 3300045836 Ga0466958_0053416 Ga0466958_0053416_1070_1963 287
130 3300046452 Ga0495617_002147 Ga0495617_002147_6019_6939 287
131 3300046457 Ga0495590_0021505 Ga0495590_0021505_259_1179 287
132 3300046474 Ga0495605_0010281 Ga0495605_0010281_3686_4606 287
133 3300046491 Ga0495584_0002692 Ga0495584_0002692_5606_6571 287
134 3300046491 Ga0495584_0048392 Ga0495584_0048392_986_1915 287
135 3300046492 Ga0495585_0007451 Ga0495585_0007451_1809_2774 287
136 3300046492 Ga0495585_0039344 Ga0495585_0039344_1309_2238 287
137 3300046492 Ga0495585_0042303 Ga0495585_0042303_1355_2284 287
138 3300046500 Ga0495596_0013547 Ga0495596_0013547_287_1252 287
139 3300046501 Ga0495607_0029857 Ga0495607_0029857_808_1773 287
140 3300046501 Ga0495607_0036184 Ga0495607_0036184_284_1204 287
141 3300046501 Ga0495607_0053828 Ga0495607_0053828_1280_2209 287
142 3300046501 Ga0495607_0102598 Ga0495607_0102598_354_1283 287
143 3300046506 Ga0495583_0000016 Ga0495583_0000016_39761_40681 287
144 3300046506 Ga0495583_0001945 Ga0495583_0001945_4371_5336 287
145 3300046507 Ga0495606_0000360 Ga0495606_0000360_62697_63614 287
146 3300046507 Ga0495606_0019130 Ga0495606_0019130_1060_1935 287
147 3300046513 Ga0495616_0010621 Ga0495616_0010621_655_1620 287
148 3300046513 Ga0495616_0039857 Ga0495616_0039857_1335_2255 287
149 3300046513 Ga0495616_0093871 Ga0495616_0093871_63_956 287
150 3300046518 Ga0495631_0003480 Ga0495631_0003480_4102_5067 287
151 3300046519 Ga0495632_0010396 Ga0495632_0010396_2707_3672 287
152 3300046523 Ga0495644_0001247 Ga0495644_0001247_5848_6813 287
153 3300046523 Ga0495644_0002109 Ga0495644_0002109_4958_5887 287
154 3300046523 Ga0495644_0002405 Ga0495644_0002405_1482_2402 287
155 3300046524 Ga0495648_0002909 Ga0495648_0002909_8644_9564 287
156 3300046528 Ga0495642_0036455 Ga0495642_0036455_424_1386 287
157 3300046538 Ga0495609_0003235 Ga0495609_0003235_2430_3350 287
158 3300046557 Ga0495622_0067833 Ga0495622_0067833_694_1623 287
159 3300046558 Ga0495633_0001572 Ga0495633_0001572_5415_6344 287
160 3300046558 Ga0495633_0005582 Ga0495633_0005582_1936_2901 287
161 3300046558 Ga0495633_0014408 Ga0495633_0014408_243_1172 287
162 3300046615 Ga0495656_0005418 Ga0495656_0005418_2436_3365 287
163 3300046648 Ga0495611_0002009 Ga0495611_0002009_7200_8129 287
164 3300046648 Ga0495611_0002143 Ga0495611_0002143_4126_5091 287
165 3300046648 Ga0495611_0021242 Ga0495611_0021242_377_1297 287
166 3300046660 Ga0495625_0005795 Ga0495625_0005795_643_1563 287
167 3300046664 Ga0495659_0003520 Ga0495659_0003520_2792_3712 287
168 3300046665 Ga0495661_0092747 Ga0495661_0092747_145_1074 287
169 3300046691 Ga0495670_0003129 Ga0495670_0003129_1376_2296 287
170 3300046691 Ga0495670_0051057 Ga0495670_0051057_651_1580 287
171 3300046794 Ga0495589_0005414 Ga0495589_0005414_4813_5778 287
172 3300046794 Ga0495589_0071404 Ga0495589_0071404_93_1022 287
173 3300046810 Ga0495660_0005212 Ga0495660_0005212_5236_6201 287
174 3300046810 Ga0495660_0009081 Ga0495660_0009081_450_1343 287
175 3300047318 Ga0495636_0000666 Ga0495636_0000666_10959_11879 287
176 3300047320 Ga0495672_0035958 Ga0495672_0035958_790_1710 287
177 3300047323 Ga0495683_0011518 Ga0495683_0011518_13_978 287
178 3300047323 Ga0495683_0034144 Ga0495683_0034144_1521_2441 287
179 3300047443 Ga0495687_000892 Ga0495687_000892_13229_14149 287
180 3300047445 Ga0495677_0006508 Ga0495677_0006508_2107_3027 287
181 3300047445 Ga0495677_0024583 Ga0495677_0024583_118_1047 287
182 3300047446 Ga0495679_003558 Ga0495679_003558_5783_6748 287
183 3300047447 Ga0495685_000107 Ga0495685_000107_25365_26285 287
184 3300048906 Ga0496103_0009590 Ga0496103_0009590_4814_5704 287
185 3300048908 Ga0496105_0282184 Ga0496105_0282184_240_1133 287
186 3300048916 Ga0496113_0001462 Ga0496113_0001462_10515_11408 287
187 3300048925 Ga0496122_0002158 Ga0496122_0002158_10091_11014 287
188 3300048925 Ga0496122_0002461 Ga0496122_0002461_15388_16281 287
189 3300048925 Ga0496122_0017558 Ga0496122_0017558_3320_4213 287
190 3300048926 Ga0496123_0001417 Ga0496123_0001417_9628_10551 287
191 3300048926 Ga0496123_0002690 Ga0496123_0002690_10204_11097 287
192 3300048926 Ga0496123_0144052 Ga0496123_0144052_262_1155 287
193 3300048927 Ga0496124_0042495 Ga0496124_0042495_2766_3659 287
194 3300048928 Ga0496125_0001889 Ga0496125_0001889_18403_19326 287
195 3300048928 Ga0496125_0046803 Ga0496125_0046803_1164_2057 287
196 3300049459 Ga0495678_001594 Ga0495678_001594_4804_5724 287
197 3300049459 Ga0495678_008663 Ga0495678_008663_82_1047 287
198 3300049460 Ga0495682_0000793 Ga0495682_0000793_7181_8110 287
199 3300049460 Ga0495682_0001573 Ga0495682_0001573_3714_4634 287
200 3300061719 Ga0466962_0157227 Ga0466962_0157227_165_1058 287
201 3300005337 Ga0070682_100015810 Ga0070682_1000158103 288
202 3300013306 Ga0163162_10181305 Ga0163162_101813052 288
203 3300025230 Ga0209563_100007 Ga0209563_100007935 288
204 3300031838 Ga0307518_10105009 Ga0307518_101050092 288
205 3300046471 Ga0495650_0000011 Ga0495650_0000011_495626_496510 288
206 3300046491 Ga0495584_0000473 Ga0495584_0000473_21746_22690 288
207 3300046491 Ga0495584_0005657 Ga0495584_0005657_982_1941 288
208 3300046507 Ga0495606_0000452 Ga0495606_0000452_1909_2853 288
209 3300046530 Ga0495654_0009857 Ga0495654_0009857_3405_4364 288
210 3300046542 Ga0495597_0002323 Ga0495597_0002323_5333_6292 288
211 3300046616 Ga0495668_0004179 Ga0495668_0004179_535_1494 288
212 3300046665 Ga0495661_0044487 Ga0495661_0044487_1539_2435 288
213 3300047320 Ga0495672_0004681 Ga0495672_0004681_5675_6634 288
214 3300047320 Ga0495672_0009308 Ga0495672_0009308_1075_2007 288
215 3300048927 Ga0496124_0132325 Ga0496124_0132325_1048_1944 288
216 3300049572 Ga0501036_0276074 Ga0501036_0276074_79_1002 288
217 3300025254 Ga0209148_1000241 Ga0209148_10002417 289
218 3300037312 Ga0395899_0001947 Ga0395899_0001947_11722_12612 289
219 3300037312 Ga0395899_0042848 Ga0395899_0042848_2384_3322 289
220 3300037312 Ga0395899_0059120 Ga0395899_0059120_947_1846 289
221 3300037418 Ga0395900_0004876 Ga0395900_0004876_139_1077 289
222 3300037466 Ga0395898_0035623 Ga0395898_0035623_3282_4172 289
223 3300038443 Ga0395901_0079528 Ga0395901_0079528_78_977 289
224 3300038443 Ga0395901_0086001 Ga0395901_0086001_1429_2319 289
225 3300046452 Ga0495617_000029 Ga0495617_000029_80981_81934 289
226 3300046453 Ga0495627_000860 Ga0495627_000860_12442_13395 289
227 3300046457 Ga0495590_0000284 Ga0495590_0000284_7452_8405 289
228 3300046458 Ga0495591_000240 Ga0495591_000240_23558_24511 289
229 3300046460 Ga0495638_0014941 Ga0495638_0014941_415_1353 289
230 3300046474 Ga0495605_0000359 Ga0495605_0000359_14734_15687 289
231 3300046474 Ga0495605_0021099 Ga0495605_0021099_1204_2181 289
232 3300046474 Ga0495605_0052723 Ga0495605_0052723_585_1538 289
233 3300046491 Ga0495584_0000421 Ga0495584_0000421_16913_17866 289
234 3300046491 Ga0495584_0029671 Ga0495584_0029671_1470_2447 289
235 3300046492 Ga0495585_0004127 Ga0495585_0004127_6860_7798 289
236 3300046492 Ga0495585_0004290 Ga0495585_0004290_2111_3064 289
237 3300046492 Ga0495585_0006686 Ga0495585_0006686_2905_3858 289
238 3300046492 Ga0495585_0026314 Ga0495585_0026314_586_1539 289
239 3300046492 Ga0495585_0034283 Ga0495585_0034283_1090_2067 289
240 3300046492 Ga0495585_0077017 Ga0495585_0077017_487_1431 289
241 3300046500 Ga0495596_0003064 Ga0495596_0003064_3809_4762 289
242 3300046500 Ga0495596_0005350 Ga0495596_0005350_124_1071 289
243 3300046500 Ga0495596_0011466 Ga0495596_0011466_2477_3430 289
244 3300046500 Ga0495596_0030137 Ga0495596_0030137_1113_2066 289
245 3300046500 Ga0495596_0047849 Ga0495596_0047849_426_1403 289
246 3300046501 Ga0495607_0001873 Ga0495607_0001873_9339_10292 289
247 3300046506 Ga0495583_0004249 Ga0495583_0004249_5121_6065 289
248 3300046506 Ga0495583_0004362 Ga0495583_0004362_1880_2833 289
249 3300046506 Ga0495583_0007164 Ga0495583_0007164_1897_2814 289
250 3300046506 Ga0495583_0012122 Ga0495583_0012122_2802_3740 289
251 3300046507 Ga0495606_0040996 Ga0495606_0040996_1183_2160 289
252 3300046512 Ga0495610_0002372 Ga0495610_0002372_7566_8519 289
253 3300046513 Ga0495616_0000584 Ga0495616_0000584_18078_19037 289
254 3300046513 Ga0495616_0001909 Ga0495616_0001909_2396_3301 289
255 3300046513 Ga0495616_0016380 Ga0495616_0016380_1393_2370 289
256 3300046513 Ga0495616_0016772 Ga0495616_0016772_1109_2062 289
257 3300046518 Ga0495631_0001075 Ga0495631_0001075_2336_3271 289
258 3300046518 Ga0495631_0002730 Ga0495631_0002730_6449_7402 289
259 3300046518 Ga0495631_0003714 Ga0495631_0003714_30_983 289
260 3300046518 Ga0495631_0030433 Ga0495631_0030433_1370_2323 289
261 3300046518 Ga0495631_0059091 Ga0495631_0059091_326_1303 289
262 3300046518 Ga0495631_0128558 Ga0495631_0128558_44_1003 289
263 3300046519 Ga0495632_0000911 Ga0495632_0000911_8607_9566 289
264 3300046519 Ga0495632_0070306 Ga0495632_0070306_202_1155 289
265 3300046519 Ga0495632_0130744 Ga0495632_0130744_108_1085 289
266 3300046520 Ga0495637_0000004 Ga0495637_0000004_224010_224963 289
267 3300046522 Ga0495643_0002160 Ga0495643_0002160_2358_3275 289
268 3300046522 Ga0495643_0029608 Ga0495643_0029608_1631_2584 289
269 3300046522 Ga0495643_0036040 Ga0495643_0036040_1714_2691 289
270 3300046523 Ga0495644_0005105 Ga0495644_0005105_3101_4054 289
271 3300046523 Ga0495644_0005479 Ga0495644_0005479_3558_4511 289
272 3300046523 Ga0495644_0005720 Ga0495644_0005720_1540_2517 289
273 3300046523 Ga0495644_0038910 Ga0495644_0038910_186_1130 289
274 3300046524 Ga0495648_0000547 Ga0495648_0000547_12401_13354 289
275 3300046524 Ga0495648_0006368 Ga0495648_0006368_7641_8618 289
276 3300046524 Ga0495648_0011743 Ga0495648_0011743_5345_6283 289
277 3300046524 Ga0495648_0019964 Ga0495648_0019964_2866_3804 289
278 3300046528 Ga0495642_0000149 Ga0495642_0000149_15481_16434 289
279 3300046528 Ga0495642_0001150 Ga0495642_0001150_8681_9640 289
280 3300046528 Ga0495642_0008869 Ga0495642_0008869_1818_2795 289
281 3300046528 Ga0495642_0010011 Ga0495642_0010011_2310_3248 289
282 3300046528 Ga0495642_0100174 Ga0495642_0100174_104_1057 289
283 3300046530 Ga0495654_0027217 Ga0495654_0027217_623_1576 289
284 3300046530 Ga0495654_0029967 Ga0495654_0029967_103_1041 289
285 3300046530 Ga0495654_0061047 Ga0495654_0061047_67_1044 289
286 3300046536 Ga0495587_0016085 Ga0495587_0016085_3694_4596 289
287 3300046538 Ga0495609_0011893 Ga0495609_0011893_2513_3451 289
288 3300046538 Ga0495609_0016809 Ga0495609_0016809_1805_2758 289
289 3300046538 Ga0495609_0109740 Ga0495609_0109740_52_990 289
290 3300046542 Ga0495597_0000334 Ga0495597_0000334_31662_32603 289
291 3300046542 Ga0495597_0001360 Ga0495597_0001360_7428_8363 289
292 3300046558 Ga0495633_0001663 Ga0495633_0001663_13488_14423 289
293 3300046615 Ga0495656_0017717 Ga0495656_0017717_755_1699 289
294 3300046616 Ga0495668_0000700 Ga0495668_0000700_12326_13279 289
295 3300046616 Ga0495668_0002542 Ga0495668_0002542_1202_2140 289
296 3300046616 Ga0495668_0104753 Ga0495668_0104753_438_1391 289
297 3300046616 Ga0495668_0197537 Ga0495668_0197537_146_1090 289
298 3300046648 Ga0495611_0002008 Ga0495611_0002008_2196_3149 289
299 3300046648 Ga0495611_0046111 Ga0495611_0046111_378_1331 289
300 3300046660 Ga0495625_0008581 Ga0495625_0008581_6293_7231 289
301 3300046660 Ga0495625_0074814 Ga0495625_0074814_683_1660 289
302 3300046660 Ga0495625_0116850 Ga0495625_0116850_559_1497 289
303 3300046665 Ga0495661_0001839 Ga0495661_0001839_13696_14631 289
304 3300046665 Ga0495661_0007800 Ga0495661_0007800_6090_7043 289
305 3300046665 Ga0495661_0016789 Ga0495661_0016789_1265_2218 289
306 3300046665 Ga0495661_0050593 Ga0495661_0050593_401_1354 289
307 3300046665 Ga0495661_0116551 Ga0495661_0116551_223_1161 289
308 3300046684 Ga0495669_0000918 Ga0495669_0000918_2789_3748 289
309 3300046684 Ga0495669_0003258 Ga0495669_0003258_4954_5907 289
310 3300046684 Ga0495669_0003802 Ga0495669_0003802_4598_5551 289
311 3300046684 Ga0495669_0013621 Ga0495669_0013621_1316_2263 289
312 3300046684 Ga0495669_0054294 Ga0495669_0054294_182_1159 289
313 3300046691 Ga0495670_0000766 Ga0495670_0000766_12013_12948 289
314 3300046691 Ga0495670_0006133 Ga0495670_0006133_1593_2537 289
315 3300046691 Ga0495670_0007737 Ga0495670_0007737_4138_5115 289
316 3300046691 Ga0495670_0019075 Ga0495670_0019075_1117_2067 289
317 3300046692 Ga0495671_0000329 Ga0495671_0000329_12285_13238 289
318 3300046692 Ga0495671_0001236 Ga0495671_0001236_11398_12342 289
319 3300046692 Ga0495671_0024913 Ga0495671_0024913_1136_2074 289
320 3300046694 Ga0495649_0000565 Ga0495649_0000565_7260_8213 289
321 3300046694 Ga0495649_0010548 Ga0495649_0010548_3103_4080 289
322 3300046694 Ga0495649_0035933 Ga0495649_0035933_1405_2439 289
323 3300046794 Ga0495589_0000542 Ga0495589_0000542_10801_11736 289
324 3300046794 Ga0495589_0001209 Ga0495589_0001209_12240_13193 289
325 3300046794 Ga0495589_0041928 Ga0495589_0041928_25_978 289
326 3300047320 Ga0495672_0000342 Ga0495672_0000342_51287_52240 289
327 3300047320 Ga0495672_0000869 Ga0495672_0000869_3462_4439 289
328 3300047320 Ga0495672_0045806 Ga0495672_0045806_325_1302 289
329 3300047323 Ga0495683_0000884 Ga0495683_0000884_18321_19274 289
330 3300047323 Ga0495683_0033888 Ga0495683_0033888_1295_2272 289
331 3300047443 Ga0495687_000149 Ga0495687_000149_17702_18640 289
332 3300047445 Ga0495677_0000601 Ga0495677_0000601_7261_8214 289
333 3300047445 Ga0495677_0016501 Ga0495677_0016501_1249_2187 289
334 3300047445 Ga0495677_0024170 Ga0495677_0024170_254_1231 289
335 3300047447 Ga0495685_003866 Ga0495685_003866_2451_3389 289
336 3300047447 Ga0495685_005078 Ga0495685_005078_1318_2295 289
337 3300047470 Ga0495681_0000456 Ga0495681_0000456_5779_6732 289
338 3300047470 Ga0495681_0001166 Ga0495681_0001166_6418_7362 289
339 3300047470 Ga0495681_0002172 Ga0495681_0002172_1395_2330 289
340 3300047472 Ga0495686_0001280 Ga0495686_0001280_9619_10596 289
341 3300047472 Ga0495686_0001510 Ga0495686_0001510_16415_17314 289
342 3300047472 Ga0495686_0009063 Ga0495686_0009063_3436_4389 289
343 3300048091 Ga0495626_0002291 Ga0495626_0002291_12581_13534 289
344 3300048091 Ga0495626_0002495 Ga0495626_0002495_9092_9988 289
345 3300048091 Ga0495626_0013524 Ga0495626_0013524_522_1460 289
346 3300048091 Ga0495626_0015421 Ga0495626_0015421_312_1280 289
347 3300048091 Ga0495626_0037305 Ga0495626_0037305_332_1285 289
348 3300048091 Ga0495626_0049051 Ga0495626_0049051_806_1783 289
349 3300048091 Ga0495626_0063833 Ga0495626_0063833_652_1548 289
350 3300048905 Ga0496102_0000463 Ga0496102_0000463_26108_27061 289
351 3300048908 Ga0496105_0182916 Ga0496105_0182916_319_1257 289
352 3300048909 Ga0496106_0140034 Ga0496106_0140034_103_1002 289
353 3300048910 Ga0496107_0052831 Ga0496107_0052831_680_1618 289
354 3300048910 Ga0496107_0058587 Ga0496107_0058587_1038_1937 289
355 3300048913 Ga0496110_0000301 Ga0496110_0000301_11298_12236 289
356 3300048913 Ga0496110_0008326 Ga0496110_0008326_437_1375 289
357 3300048927 Ga0496124_0009412 Ga0496124_0009412_3590_4531 289
358 3300049459 Ga0495678_000784 Ga0495678_000784_12822_13760 289
359 3300049459 Ga0495678_000887 Ga0495678_000887_7651_8604 289
360 3300049459 Ga0495678_005759 Ga0495678_005759_1704_2657 289
361 3300049460 Ga0495682_0012972 Ga0495682_0012972_1076_2029 289
362 3300049460 Ga0495682_0022545 Ga0495682_0022545_852_1829 289
363 iso_pu_bacteria 2818991436 2819543595 289
364 3300005564 Ga0070664_100274684 Ga0070664_1002746842 290
365 3300013102 Ga0157371_10000001 Ga0157371_10000001226 290
366 3300014497 Ga0182008_10024716 Ga0182008_100247163 290
367 3300025909 Ga0207705_10108793 Ga0207705_101087932 290
368 3300025919 Ga0207657_10067917 Ga0207657_100679172 290
369 3300025945 Ga0207679_10182783 Ga0207679_101827832 290
370 3300037312 Ga0395899_0000028 Ga0395899_0000028_211168_212079 290
371 3300046457 Ga0495590_0000578 Ga0495590_0000578_10122_11039 290
372 3300046459 Ga0495629_0007221 Ga0495629_0007221_1106_2002 290
373 3300046459 Ga0495629_0173311 Ga0495629_0173311_499_1449 290
374 3300046459 Ga0495629_0192443 Ga0495629_0192443_192_1103 290
375 3300046460 Ga0495638_0187863 Ga0495638_0187863_165_1070 290
376 3300046463 Ga0495653_0054133 Ga0495653_0054133_687_1613 290
377 3300046463 Ga0495653_0057911 Ga0495653_0057911_1582_2499 290
378 3300046463 Ga0495653_0060189 Ga0495653_0060189_803_1720 290
379 3300046471 Ga0495650_0001041 Ga0495650_0001041_26090_27100 290
380 3300046471 Ga0495650_0002636 Ga0495650_0002636_5811_6701 290
381 3300046472 Ga0495580_0172567 Ga0495580_0172567_451_1362 290
382 3300046473 Ga0495582_0015069 Ga0495582_0015069_2610_3560 290
383 3300046473 Ga0495582_0020097 Ga0495582_0020097_2400_3311 290
384 3300046474 Ga0495605_0007163 Ga0495605_0007163_720_1625 290
385 3300046491 Ga0495584_0000680 Ga0495584_0000680_8839_9744 290
386 3300046491 Ga0495584_0001672 Ga0495584_0001672_5922_6827 290
387 3300046491 Ga0495584_0001737 Ga0495584_0001737_11096_12001 290
388 3300046491 Ga0495584_0008639 Ga0495584_0008639_3483_4394 290
389 3300046491 Ga0495584_0017319 Ga0495584_0017319_1587_2552 290
390 3300046492 Ga0495585_0001564 Ga0495585_0001564_6877_7788 290
391 3300046492 Ga0495585_0003260 Ga0495585_0003260_5902_6807 290
392 3300046492 Ga0495585_0017554 Ga0495585_0017554_2316_3209 290
393 3300046492 Ga0495585_0047717 Ga0495585_0047717_754_1668 290
394 3300046492 Ga0495585_0079347 Ga0495585_0079347_237_1208 290
395 3300046500 Ga0495596_0001442 Ga0495596_0001442_4472_5422 290
396 3300046500 Ga0495596_0001830 Ga0495596_0001830_6964_7872 290
397 3300046500 Ga0495596_0006175 Ga0495596_0006175_2442_3452 290
398 3300046500 Ga0495596_0034805 Ga0495596_0034805_673_1578 290
399 3300046500 Ga0495596_0057456 Ga0495596_0057456_273_1223 290
400 3300046501 Ga0495607_0005336 Ga0495607_0005336_3434_4339 290
401 3300046501 Ga0495607_0043812 Ga0495607_0043812_823_1776 290
402 3300046501 Ga0495607_0087215 Ga0495607_0087215_185_1093 290
403 3300046506 Ga0495583_0000660 Ga0495583_0000660_15922_16827 290
404 3300046506 Ga0495583_0012392 Ga0495583_0012392_1148_2056 290
405 3300046506 Ga0495583_0019681 Ga0495583_0019681_759_1652 290
406 3300046507 Ga0495606_0008264 Ga0495606_0008264_4022_4948 290
407 3300046507 Ga0495606_0015206 Ga0495606_0015206_4178_5071 290
408 3300046507 Ga0495606_0167337 Ga0495606_0167337_55_957 290
409 3300046513 Ga0495616_0004977 Ga0495616_0004977_3515_4420 290
410 3300046513 Ga0495616_0010332 Ga0495616_0010332_4149_5054 290
411 3300046515 Ga0495620_0005536 Ga0495620_0005536_3436_4329 290
412 3300046518 Ga0495631_0033662 Ga0495631_0033662_506_1456 290
413 3300046518 Ga0495631_0048481 Ga0495631_0048481_433_1344 290
414 3300046522 Ga0495643_0052314 Ga0495643_0052314_863_1768 290
415 3300046522 Ga0495643_0147566 Ga0495643_0147566_239_1150 290
416 3300046523 Ga0495644_0009356 Ga0495644_0009356_73_981 290
417 3300046523 Ga0495644_0032166 Ga0495644_0032166_625_1575 290
418 3300046524 Ga0495648_0004818 Ga0495648_0004818_9875_10795 290
419 3300046524 Ga0495648_0098699 Ga0495648_0098699_290_1183 290
420 3300046526 Ga0495666_0000211 Ga0495666_0000211_1292_2251 290
421 3300046526 Ga0495666_0009248 Ga0495666_0009248_1372_2298 290
422 3300046526 Ga0495666_0029894 Ga0495666_0029894_534_1442 290
423 3300046526 Ga0495666_0056161 Ga0495666_0056161_891_1805 290
424 3300046526 Ga0495666_0099759 Ga0495666_0099759_191_1102 290
425 3300046528 Ga0495642_0005068 Ga0495642_0005068_256_1149 290
426 3300046528 Ga0495642_0017768 Ga0495642_0017768_1219_2130 290
427 3300046528 Ga0495642_0041145 Ga0495642_0041145_722_1630 290
428 3300046529 Ga0495652_0009196 Ga0495652_0009196_1702_2628 290
429 3300046529 Ga0495652_0013920 Ga0495652_0013920_133_1044 290
430 3300046531 Ga0495665_0029648 Ga0495665_0029648_779_1738 290
431 3300046535 Ga0495586_0004104 Ga0495586_0004104_3471_4382 290
432 3300046535 Ga0495586_0039548 Ga0495586_0039548_242_1258 290
433 3300046536 Ga0495587_0049154 Ga0495587_0049154_149_1060 290
434 3300046538 Ga0495609_0003957 Ga0495609_0003957_3871_4776 290
435 3300046538 Ga0495609_0022780 Ga0495609_0022780_922_1833 290
436 3300046538 Ga0495609_0027227 Ga0495609_0027227_858_1868 290
437 3300046538 Ga0495609_0082813 Ga0495609_0082813_305_1255 290
438 3300046542 Ga0495597_0000708 Ga0495597_0000708_16487_17449 290
439 3300046543 Ga0495645_0274574 Ga0495645_0274574_123_1040 290
440 3300046557 Ga0495622_0001804 Ga0495622_0001804_8719_9630 290
441 3300046557 Ga0495622_0008886 Ga0495622_0008886_2522_3433 290
442 3300046557 Ga0495622_0016674 Ga0495622_0016674_1492_2403 290
443 3300046557 Ga0495622_0093246 Ga0495622_0093246_182_1132 290
444 3300046558 Ga0495633_0008644 Ga0495633_0008644_557_1462 290
445 3300046558 Ga0495633_0044976 Ga0495633_0044976_178_1086 290
446 3300046558 Ga0495633_0054364 Ga0495633_0054364_437_1387 290
447 3300046558 Ga0495633_0112553 Ga0495633_0112553_269_1180 290
448 3300046616 Ga0495668_0000915 Ga0495668_0000915_18619_19575 290
449 3300046616 Ga0495668_0008561 Ga0495668_0008561_1219_2124 290
450 3300046616 Ga0495668_0023344 Ga0495668_0023344_1881_2792 290
451 3300046642 Ga0495634_0127864 Ga0495634_0127864_589_1500 290
452 3300046648 Ga0495611_0018746 Ga0495611_0018746_1173_2087 290
453 3300046648 Ga0495611_0027676 Ga0495611_0027676_1218_2168 290
454 3300046665 Ga0495661_0006437 Ga0495661_0006437_3484_4389 290
455 3300046665 Ga0495661_0087237 Ga0495661_0087237_338_1288 290
456 3300046674 Ga0495588_0055376 Ga0495588_0055376_846_1796 290
457 3300046679 Ga0495623_0006531 Ga0495623_0006531_3797_4723 290
458 3300046679 Ga0495623_0017119 Ga0495623_0017119_2412_3362 290
459 3300046684 Ga0495669_0000161 Ga0495669_0000161_37449_38399 290
460 3300046684 Ga0495669_0008058 Ga0495669_0008058_869_1777 290
461 3300046684 Ga0495669_0099722 Ga0495669_0099722_60_953 290
462 3300046689 Ga0495613_0068983 Ga0495613_0068983_51_1001 290
463 3300046690 Ga0495624_0036654 Ga0495624_0036654_122_1033 290
464 3300046691 Ga0495670_0003471 Ga0495670_0003471_2605_3510 290
465 3300046691 Ga0495670_0015524 Ga0495670_0015524_1787_2713 290
466 3300046691 Ga0495670_0040557 Ga0495670_0040557_107_1057 290
467 3300046691 Ga0495670_0045669 Ga0495670_0045669_984_1892 290
468 3300046692 Ga0495671_0035359 Ga0495671_0035359_1439_2365 290
469 3300046694 Ga0495649_0060752 Ga0495649_0060752_401_1351 290
470 3300046794 Ga0495589_0003662 Ga0495589_0003662_3530_4435 290
471 3300046794 Ga0495589_0010034 Ga0495589_0010034_991_2001 290
472 3300046809 Ga0495600_0011452 Ga0495600_0011452_2110_3021 290
473 3300046809 Ga0495600_0025084 Ga0495600_0025084_1186_2112 290
474 3300047315 Ga0495581_0010892 Ga0495581_0010892_1667_2578 290
475 3300047315 Ga0495581_0018535 Ga0495581_0018535_411_1361 290
476 3300047315 Ga0495581_0031597 Ga0495581_0031597_1967_2875 290
477 3300047315 Ga0495581_0148335 Ga0495581_0148335_194_1102 290
478 3300047317 Ga0495604_0011716 Ga0495604_0011716_3561_4487 290
479 3300047317 Ga0495604_0060198 Ga0495604_0060198_486_1397 290
480 3300047317 Ga0495604_0085519 Ga0495604_0085519_823_1782 290
481 3300047317 Ga0495604_0103163 Ga0495604_0103163_229_1140 290
482 3300047318 Ga0495636_0002491 Ga0495636_0002491_1300_2214 290
483 3300047318 Ga0495636_0002555 Ga0495636_0002555_3296_4204 290
484 3300047319 Ga0495674_0017029 Ga0495674_0017029_2530_3426 290
485 3300047320 Ga0495672_0005247 Ga0495672_0005247_3267_4277 290
486 3300047321 Ga0495676_0000138 Ga0495676_0000138_2191_3141 290
487 3300047321 Ga0495676_0020325 Ga0495676_0020325_1697_2608 290
488 3300047322 Ga0495680_0009343 Ga0495680_0009343_5962_6879 290
489 3300047322 Ga0495680_0013540 Ga0495680_0013540_1978_2994 290
490 3300047322 Ga0495680_0116281 Ga0495680_0116281_721_1647 290
491 3300047323 Ga0495683_0000764 Ga0495683_0000764_6649_7554 290
492 3300047323 Ga0495683_0074177 Ga0495683_0074177_237_1142 290
493 3300047443 Ga0495687_005149 Ga0495687_005149_3685_4590 290
494 3300047444 Ga0495675_0126155 Ga0495675_0126155_583_1494 290
495 3300047445 Ga0495677_0001922 Ga0495677_0001922_3530_4435 290
496 3300047445 Ga0495677_0016072 Ga0495677_0016072_1001_1951 290
497 3300047469 Ga0495673_0013280 Ga0495673_0013280_1913_2824 290
498 3300047470 Ga0495681_0011398 Ga0495681_0011398_926_1867 290
499 3300047673 Ga0495593_0012656 Ga0495593_0012656_1463_2374 290
500 3300047673 Ga0495593_0018101 Ga0495593_0018101_1890_2906 290
501 3300047673 Ga0495593_0021559 Ga0495593_0021559_721_1629 290
502 3300048088 Ga0495602_0002600 Ga0495602_0002600_4598_5515 290
503 3300048088 Ga0495602_0029009 Ga0495602_0029009_2522_3433 290
504 3300048089 Ga0495614_0008578 Ga0495614_0008578_567_1517 290
505 3300048091 Ga0495626_0000085 Ga0495626_0000085_8517_9596 290
506 3300048091 Ga0495626_0004720 Ga0495626_0004720_3860_4765 290
507 3300048091 Ga0495626_0005956 Ga0495626_0005956_88_999 290
508 3300048091 Ga0495626_0006986 Ga0495626_0006986_1025_1975 290
509 3300048091 Ga0495626_0008174 Ga0495626_0008174_3311_4222 290
510 3300048091 Ga0495626_0018775 Ga0495626_0018775_147_1088 290
511 3300048091 Ga0495626_0037494 Ga0495626_0037494_972_1979 290
512 3300048905 Ga0496102_0000470 Ga0496102_0000470_41161_42063 290
513 3300048905 Ga0496102_0257379 Ga0496102_0257379_603_1511 290
514 3300048906 Ga0496103_0017062 Ga0496103_0017062_698_1600 290
515 3300048909 Ga0496106_0245367 Ga0496106_0245367_454_1371 290
516 3300048918 Ga0496115_0227030 Ga0496115_0227030_374_1282 290
517 3300048918 Ga0496115_0261216 Ga0496115_0261216_24_935 290
518 3300049575 Ga0501039_0276216 Ga0501039_0276216_219_1139 290
519 3300049822 Ga0501035_0017229 Ga0501035_0017229_999_1919 290
520 3300002704 JGI25155J39150_1000569 JGI25155J39150_10005691 291
521 3300002705 JGI25156J39149_1001652 JGI25156J39149_10016525 291
522 3300002737 JGI25162J39368_1000001 JGI25162J39368_100000179 291
523 3300002738 JGI25154J39366_1000309 JGI25154J39366_100030917 291
524 3300003214 JGI25165J46597_1000001 JGI25165J46597_100000175 291
525 3300003751 Ga0055538_1000001 Ga0055538_1000001958 291
526 3300003752 Ga0055539_1000001 Ga0055539_1000001958 291
527 3300003756 Ga0055533_1000003 Ga0055533_100000375 291
528 3300003759 Ga0055525_1000003 Ga0055525_100000375 291
529 3300003841 Ga0055541_1000001 Ga0055541_100000175 291
530 3300015261 Ga0182006_1036016 Ga0182006_10360162 291
531 3300015265 Ga0182005_1000335 Ga0182005_10003357 291
532 3300025206 Ga0209435_100192 Ga0209435_1001924 291
533 3300025224 Ga0209784_100004 Ga0209784_10000476 291
534 3300025225 Ga0209566_100004 Ga0209566_100004233 291
535 3300025226 Ga0209674_100006 Ga0209674_100006233 291
536 3300025230 Ga0209563_100009 Ga0209563_10000976 291
537 3300025231 Ga0207427_100562 Ga0207427_1005627 291
538 3300025233 Ga0209437_100004 Ga0209437_10000476 291
539 3300025246 Ga0209646_1000052 Ga0209646_100005276 291
540 3300025250 Ga0209026_1003016 Ga0209026_10030164 291
541 3300025253 Ga0209677_100005 Ga0209677_10000576 291
542 3300025256 Ga0209759_1000481 Ga0209759_100048125 291
543 3300025261 Ga0209233_1000005 Ga0209233_1000005233 291
544 3300025913 Ga0207695_10038427 Ga0207695_100384272 291
545 3300046462 Ga0495651_0068349 Ga0495651_0068349_1601_2494 291
546 3300046463 Ga0495653_0103778 Ga0495653_0103778_259_1152 291
547 3300046511 Ga0495608_0009271 Ga0495608_0009271_2146_3039 291
548 3300046514 Ga0495618_0035517 Ga0495618_0035517_205_1098 291
549 3300046516 Ga0495628_0013564 Ga0495628_0013564_5107_6000 291
550 3300046529 Ga0495652_0044948 Ga0495652_0044948_1348_2241 291
551 3300046529 Ga0495652_0252961 Ga0495652_0252961_197_1090 291
552 3300046557 Ga0495622_0095298 Ga0495622_0095298_167_1060 291
553 3300046642 Ga0495634_0161247 Ga0495634_0161247_371_1264 291
554 3300046675 Ga0495657_0017127 Ga0495657_0017127_2208_3101 291
555 3300046678 Ga0495599_0015536 Ga0495599_0015536_2053_2946 291
556 3300046679 Ga0495623_0094620 Ga0495623_0094620_447_1340 291
557 3300046680 Ga0495646_0014239 Ga0495646_0014239_2641_3534 291
558 3300046690 Ga0495624_0008478 Ga0495624_0008478_1617_2510 291
559 3300046809 Ga0495600_0031868 Ga0495600_0031868_2003_2896 291
560 3300047317 Ga0495604_0065737 Ga0495604_0065737_1442_2335 291
561 3300048917 Ga0496114_0084374 Ga0496114_0084374_527_1516 291
562 3300053077 Ga0495601_0012846 Ga0495601_0012846_803_1696 291
563 3300053119 Ga0500595_002888 Ga0500595_002888_646_1539 291
564 3300053154 Ga0500619_001947 Ga0500619_001947_1938_2831 291
565 iso_pu_bacteria 2511231003 2511248270 291
566 3300037466 Ga0395898_0137912 Ga0395898_0137912_1026_1934 292
567 3300046522 Ga0495643_0000960 Ga0495643_0000960_8417_9349 292
568 3300048091 Ga0495626_0024931 Ga0495626_0024931_260_1192 292
569 3300048927 Ga0496124_0034201 Ga0496124_0034201_3277_4212 292
570 3300037312 Ga0395899_0130270 Ga0395899_0130270_703_1614 293
571 3300037418 Ga0395900_0066254 Ga0395900_0066254_573_1478 293
572 3300037466 Ga0395898_0020583 Ga0395898_0020583_3055_4011 293
573 3300037471 Ga0395905_0032690 Ga0395905_0032690_491_1447 293
574 3300037471 Ga0395905_0111220 Ga0395905_0111220_1202_2107 293
575 3300038443 Ga0395901_0085553 Ga0395901_0085553_541_1446 293
576 iso_pu_bacteria 2548876994 2550697472 293
577 iso_pu_bacteria 2818991445 2819594676 293
578 iso_pu_bacteria 2884811622 2884814565 293
579 iso_pu_bacteria 2884836552 2884839112 293
580 iso_pu_bacteria 2884852848 2884855403 293
581 iso_pu_bacteria 2896154374 2896159090 293
582 3300044842 Ga0466957_0010474 Ga0466957_0010474_2572_3543 294
583 3300002737 JGI25162J39368_1009031 JGI25162J39368_10090312 296
584 3300005331 Ga0070670_100052233 Ga0070670_1000522334 296
585 3300005539 Ga0068853_100347458 Ga0068853_1003474582 296
586 3300005614 Ga0068856_100097587 Ga0068856_1000975873 296
587 3300005616 Ga0068852_100001944 Ga0068852_1000019448 296
588 3300005834 Ga0068851_10040656 Ga0068851_100406562 296
589 3300009093 Ga0105240_10001776 Ga0105240_1000177615 296
590 3300009545 Ga0105237_10056248 Ga0105237_100562482 296
591 3300014497 Ga0182008_10029801 Ga0182008_100298012 296
592 3300025233 Ga0209437_101120 Ga0209437_1011203 296
593 3300025913 Ga0207695_10003255 Ga0207695_1000325513 296
594 3300025924 Ga0207694_10045910 Ga0207694_100459101 296
595 3300025925 Ga0207650_10037641 Ga0207650_100376412 296
596 3300026078 Ga0207702_10073449 Ga0207702_100734492 296
597 3300026142 Ga0207698_10008488 Ga0207698_100084885 296
598 3300048924 Ga0496121_0247150 Ga0496121_0247150_22_936 296
599 3300048925 Ga0496122_0000249 Ga0496122_0000249_115978_116892 296
600 3300048926 Ga0496123_0000347 Ga0496123_0000347_81629_82543 296
601 3300048928 Ga0496125_0001876 Ga0496125_0001876_2414_3328 296
602 3300048928 Ga0496125_0080641 Ga0496125_0080641_530_1444 296
603 3300002704 JGI25155J39150_1000231 JGI25155J39150_100023111 297
604 3300002705 JGI25156J39149_1000254 JGI25156J39149_100025426 297
605 3300002738 JGI25154J39366_1000216 JGI25154J39366_10002167 297
606 3300002741 JGI25157J39369_1000337 JGI25157J39369_10003374 297
607 3300003758 Ga0055532_1000005 Ga0055532_1000005271 297
608 3300003761 Ga0055535_1005468 Ga0055535_10054682 297
609 3300005563 Ga0068855_100033505 Ga0068855_1000335054 297
610 3300025206 Ga0209435_100004 Ga0209435_10000465 297
611 3300025229 Ga0209147_100011 Ga0209147_100011163 297
612 3300025242 Ga0209258_100441 Ga0209258_1004412 297
613 3300025246 Ga0209646_1000032 Ga0209646_1000032297 297
614 3300025250 Ga0209026_1000062 Ga0209026_1000062157 297
615 3300025256 Ga0209759_1000054 Ga0209759_1000054142 297
616 3300025272 Ga0209455_1010438 Ga0209455_10104382 297
617 3300025949 Ga0207667_10045349 Ga0207667_100453494 297
618 3300046660 Ga0495625_0003638 Ga0495625_0003638_11934_12827 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00749

tRNA-synt_1c

tRNA synthetases class I (E and Q), catalytic domain

68

343

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a91-assembly1.cif.gz_A crystal structure of the glutamyl-queuosine trnaasp synthetase from e. coli complexed with l-glutamate 0.8807 6 293
1nzj-assembly1.cif.gz_A crystal structure and activity studies of escherichia coli yadb orf 0.8583 6 293
1g59-assembly1.cif.gz_A glutamyl-trna synthetase complexed with trna(glu). 0.8337 7 284
6brl-assembly1.cif.gz_A crystal structure of a glutamate trna ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid 0.8271 6 247
2cv1-assembly1.cif.gz_A glutamyl-trna synthetase from thermus thermophilus in complex with trna(glu), atp, and an analog of l-glutamate: a quaternary complex 0.8234 7 284
ID Description Score Start End Superfamily
4a91A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9913 6 81 3.40.50.620
1nzjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9806 6 81 3.40.50.620
3akzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9463 6 235 3.40.50.620
3akzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9314 6 235 3.40.50.620
2hz7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9193 8 230 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A0N1B4D0-F1-model_v4 Glutamyl-Q tRNA(Asp) synthetase (Glu-Q-RSs) (EC 6.1.1.-) 0.9741 6 292 GO:0004818
GO:0005524
GO:0005829
GO:0006400
GO:0006424
GO:0008270
AF-A0A2J4Z095-F1-model_v4 tRNA glutamyl-Q(34) synthetase GluQRS (EC 6.1.1.-) 0.9718 6 107 GO:0004818
GO:0005524
GO:0005829
GO:0006424
AF-A0A656JX93-F1-model_v4 Glutamyl-Q tRNA(Asp) ligase (EC 6.1.1.-) 0.9718 7 95 GO:0004818
GO:0005524
GO:0005829
GO:0006424
AF-A0A1I9Y1G4-F1-model_v4 Glutamyl-Q tRNA(Asp) synthetase (Glu-Q-RSs) (EC 6.1.1.-) 0.9698 6 295 GO:0004818
GO:0005524
GO:0005829
GO:0006400
GO:0006424
GO:0008270
AF-A0A2W5HBD2-F1-model_v4 deleted 0.9685 6 110

Feature Viewer

pLDDT pTM Quality
92.53 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map