F469760

General Info

Members Datasets Scaffolds Average Seq Length
618 443 1236 112

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0072784|Ga0466968_0072784_1007_1402
Length 131
Sequence LREPIAQHYIATMSRDLRPPVDILHYEIVQEQASALGRMGRTLEQALTRLREFDTAHASPEVPASMQPARRKLVLEAGQALWMFVVQREATGLRDSRHIMRTYNVPGEVQRCMGLAPAPAKPARRDDGSAR

Samples

Sample ID Description Type Environment
1 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
41 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
64 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
65 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
66 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
113 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
114 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
130 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
131 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
132 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
133 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
134 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
200 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
242 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
249 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
253 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
254 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
255 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
256 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
257 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
258 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
259 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
260 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
261 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
262 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
263 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
267 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
272 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
273 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
274 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
275 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
276 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
277 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
278 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
279 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
280 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
281 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
282 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
283 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
284 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
285 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
286 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
287 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
288 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
289 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
290 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
291 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
292 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
293 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
294 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
295 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
296 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
297 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
298 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
299 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
300 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
301 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
302 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
303 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
304 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
305 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
306 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
307 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
308 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
309 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
310 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
311 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
312 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
313 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
314 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
315 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
316 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
317 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
318 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
319 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
320 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
321 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
322 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
323 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
324 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
325 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
326 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
327 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
328 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
329 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
330 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
331 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
332 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
333 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
334 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
335 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
336 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
337 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
338 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
339 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
340 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
341 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
342 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
343 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
344 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
345 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
346 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
347 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
348 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
349 2922368715
350 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
351 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
352 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
353 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
354 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
355 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
356 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
357 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
358 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
359 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
360 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
361 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
362 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
363 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
364 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
365 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
366 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
367 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
368 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
369 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
370 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
371 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
372 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
373 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
374 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
375 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
376 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
377 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
378 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
379 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
380 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
381 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
382 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
383 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
384 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
385 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
386 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
387 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
388 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
389 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
390 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
391 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
392 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
393 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
394 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
395 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
396 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
397 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
398 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
399 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
400 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
401 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
402 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
403 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
404 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
405 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
406 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
407 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
408 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
409 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
410 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
411 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
412 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
413 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
414 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
415 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
416 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
417 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
418 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
419 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
420 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
421 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
422 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
423 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
424 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
425 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
426 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
427 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
428 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
429 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
430 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
431 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
432 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
433 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
434 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
435 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
436 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
437 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
438 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
439 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
440 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
441 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
442 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
443 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.26
Metatranscriptomes 0
Isolates 26.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.58
Nodule 22.17
Rhizoplane 6.47
Rhizosphere 39.64
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466968_0072784 3300044735 Bacteria 1499
2 JGI25153J46596_10010980 3300003215 Bacteria 4043
3 JGI25153J46596_10011918 3300003215 Bacteria 3804
4 JGI25153J46596_10061672 3300003215 Bacteria 1014
5 JGI25160J50197_1002906 3300003354 Bacteria 7842
6 JGI25160J50197_1017407 3300003354 Bacteria 2277
7 Ga0055539_1010155 3300003752 Bacteria 1167
8 Ga0055525_1002356 3300003759 Bacteria 1986
9 Ga0055526_1028840 3300003771 Bacteria 1666
10 Ga0055531_10006503 3300003794 Bacteria 6625
11 Ga0065165_1001395 3300005262 Bacteria 26423
12 Ga0065165_1015596 3300005262 Bacteria 2890
13 Ga0065165_1040515 3300005262 Bacteria 1389
14 Ga0065165_1067086 3300005262 Bacteria 964
15 Ga0068869_100760051 3300005334 Bacteria 830
16 Ga0070666_10073988 3300005335 Bacteria 2321
17 Ga0070666_10296705 3300005335 Bacteria 1150
18 Ga0068868_101822589 3300005338 Bacteria 575
19 Ga0070661_101080899 3300005344 Bacteria 668
20 Ga0070668_100027764 3300005347 Bacteria 4296
21 Ga0070668_100434888 3300005347 Bacteria 1125
22 Ga0070675_100630995 3300005354 Bacteria 973
23 Ga0070671_100124451 3300005355 Bacteria 2170
24 Ga0070671_101103812 3300005355 Bacteria 697
25 Ga0070673_100772140 3300005364 Bacteria 886
26 Ga0070667_100185735 3300005367 Bacteria 1840
27 Ga0070709_11124471 3300005434 Bacteria 629
28 Ga0070713_101591624 3300005436 Bacteria 634
29 Ga0070663_100134783 3300005455 Bacteria 1879
30 Ga0070663_100426663 3300005455 Bacteria 1088
31 Ga0070663_100525376 3300005455 Bacteria 986
32 Ga0070662_100028122 3300005457 Bacteria 3910
33 Ga0070662_100121513 3300005457 Bacteria 2002
34 Ga0070662_100536931 3300005457 Bacteria 979
35 Ga0068853_100642385 3300005539 Bacteria 1010
36 Ga0070693_100331630 3300005547 Bacteria 1036
37 Ga0070665_101577198 3300005548 Bacteria 664
38 Ga0070664_101216627 3300005564 Bacteria 711
39 Ga0068857_100878507 3300005577 Bacteria 859
40 Ga0068856_100070929 3300005614 Bacteria 3448
41 Ga0068856_100752084 3300005614 Bacteria 995
42 Ga0068852_100120791 3300005616 Bacteria 2398
43 Ga0068852_100309778 3300005616 Bacteria 1530
44 Ga0068852_101434026 3300005616 Bacteria 713
45 Ga0068864_100771004 3300005618 Bacteria 944
46 Ga0068861_102452341 3300005719 Bacteria 525
47 Ga0068858_100321935 3300005842 Bacteria 1478
48 Ga0068862_100393692 3300005844 Bacteria 1295
49 Ga0068862_101948843 3300005844 Bacteria 598
50 Ga0075365_10111210 3300006038 Bacteria 1882
51 Ga0075365_10154557 3300006038 Bacteria 1597
52 Ga0075368_10014957 3300006042 Bacteria 2872
53 Ga0075364_10105727 3300006051 Bacteria 1875
54 Ga0075364_10248709 3300006051 Bacteria 1208
55 Ga0075364_10373351 3300006051 Bacteria 973
56 Ga0075367_10108388 3300006178 Bacteria 1703
57 Ga0075367_10317575 3300006178 Bacteria 981
58 Ga0075369_10011806 3300006186 Bacteria 3440
59 Ga0075369_10199837 3300006186 Bacteria 922
60 Ga0075369_10231612 3300006186 Bacteria 856
61 Ga0075369_10445660 3300006186 Bacteria 613
62 Ga0075366_10026004 3300006195 Bacteria 3425
63 Ga0075370_10113781 3300006353 Bacteria 1572
64 Ga0075370_10183377 3300006353 Bacteria 1232
65 Ga0075370_10880649 3300006353 Bacteria 547
66 Ga0099824_1007956 3300006942 Bacteria 13779
67 Ga0099823_1017926 3300006944 Bacteria 6862
68 Ga0105250_10105156 3300009092 Bacteria 1154
69 Ga0105240_10010499 3300009093 Bacteria 13016
70 Ga0105240_10764807 3300009093 Bacteria 1049
71 Ga0105247_10080245 3300009101 Bacteria 2055
72 Ga0105247_10207633 3300009101 Bacteria 1319
73 Ga0105243_10089985 3300009148 Bacteria 2525
74 Ga0105243_10564416 3300009148 Bacteria 1090
75 Ga0105243_12950677 3300009148 Bacteria 516
76 Ga0105241_10006264 3300009174 Bacteria 8774
77 Ga0105242_13027722 3300009176 Bacteria 520
78 Ga0105248_10521402 3300009177 Bacteria 1340
79 Ga0105237_10003992 3300009545 Bacteria 17249
80 Ga0105237_10871524 3300009545 Bacteria 907
81 Ga0105237_11224974 3300009545 Bacteria 757
82 Ga0105249_10350850 3300009553 Bacteria 1495
83 Ga0105239_10008897 3300010375 Bacteria 11366
84 Ga0105239_10013956 3300010375 Bacteria 8921
85 Ga0105239_10341188 3300010375 Bacteria 1691
86 Ga0105239_10349014 3300010375 Bacteria 1670
87 Ga0105246_10092081 3300011119 Bacteria 2187
88 Ga0157373_10940893 3300013100 Bacteria 642
89 Ga0157370_10454605 3300013104 Bacteria 1177
90 Ga0157374_10503802 3300013296 Bacteria 1215
91 Ga0157374_10847651 3300013296 Bacteria 931
92 Ga0163163_10159300 3300014325 Bacteria 2302
93 Ga0163163_10327673 3300014325 Bacteria 1585
94 Ga0182008_10311036 3300014497 Bacteria 827
95 Ga0157377_10371854 3300014745 Bacteria 965
96 Ga0157379_10180280 3300014968 Bacteria 1908
97 Ga0157376_10830638 3300014969 Bacteria 938
98 Ga0182005_1237672 3300015265 Bacteria 559
99 Ga0163161_11434361 3300017792 Bacteria 604
100 Ga0214544_1000001 3300021320 Bacteria 783667
101 Ga0214544_1037329 3300021320 Bacteria 1203
102 Ga0214542_1000005 3300021321 Bacteria 389646
103 Ga0214542_1040315 3300021321 Bacteria 1204
104 Ga0214545_1000003 3300021324 Bacteria 720274
105 Ga0214545_1041787 3300021324 Bacteria 1185
106 Ga0214543_1000002 3300021327 Bacteria 712733
107 Ga0214543_1045898 3300021327 Bacteria 980
108 Ga0213876_10698863 3300021384 Bacteria 540
109 Ga0213875_10298510 3300021388 Unclassified 762
110 Ga0209563_102615 3300025230 Bacteria 3996
111 Ga0209026_1046474 3300025250 Bacteria 623
112 Ga0209677_106331 3300025253 Bacteria 2826
113 Ga0209148_1000424 3300025254 Bacteria 47087
114 Ga0209233_1023143 3300025261 Bacteria 1578
115 Ga0209455_1006192 3300025272 Bacteria 3569
116 Ga0209564_1012198 3300025295 Bacteria 3768
117 Ga0209564_1049031 3300025295 Bacteria 1049
118 Ga0209758_1000026 3300025297 Bacteria 582706
119 Ga0209758_1000880 3300025297 Bacteria 41231
120 Ga0209758_1002083 3300025297 Bacteria 21266
121 Ga0209758_1002329 3300025297 Bacteria 19615
122 Ga0209758_1023282 3300025297 Bacteria 2807
123 Ga0209758_1029399 3300025297 Bacteria 2299
124 Ga0209758_1079777 3300025297 Bacteria 995
125 Ga0209256_1001638 3300025299 Bacteria 21788
126 Ga0209256_1006024 3300025299 Bacteria 6628
127 Ga0207426_1000425 3300025302 Bacteria 69088
128 Ga0207426_1001569 3300025302 Bacteria 18443
129 Ga0207426_1003144 3300025302 Bacteria 9400
130 Ga0207426_1010480 3300025302 Bacteria 3592
131 Ga0207426_1024623 3300025302 Bacteria 2040
132 Ga0209051_1026462 3300025303 Bacteria 2337
133 Ga0209257_1000426 3300025304 Bacteria 81095
134 Ga0209257_1022198 3300025304 Bacteria 2273
135 Ga0209257_1067506 3300025304 Bacteria 953
136 Ga0207656_10101393 3300025321 Bacteria 1320
137 Ga0207642_10655643 3300025899 Bacteria 658
138 Ga0207710_10111767 3300025900 Bacteria 1298
139 Ga0207680_10399216 3300025903 Bacteria 971
140 Ga0207680_10467002 3300025903 Bacteria 897
141 Ga0207647_10008631 3300025904 Bacteria 7289
142 Ga0207654_10274077 3300025911 Bacteria 1139
143 Ga0207695_10000062 3300025913 Bacteria 351979
144 Ga0207695_10655750 3300025913 Bacteria 930
145 Ga0207671_10003738 3300025914 Bacteria 14995
146 Ga0207671_11389846 3300025914 Bacteria 544
147 Ga0207649_10329142 3300025920 Bacteria 1125
148 Ga0207694_10826124 3300025924 Bacteria 783
149 Ga0207659_11065067 3300025926 Bacteria 696
150 Ga0207706_10154147 3300025933 Bacteria 2021
151 Ga0207706_10378166 3300025933 Bacteria 1229
152 Ga0207706_11168911 3300025933 Bacteria 640
153 Ga0207709_10156493 3300025935 Bacteria 1584
154 Ga0207665_11427923 3300025939 Bacteria 551
155 Ga0207711_11022256 3300025941 Bacteria 766
156 Ga0207689_10398461 3300025942 Bacteria 1147
157 Ga0207651_10533228 3300025960 Bacteria 1019
158 Ga0207712_10570977 3300025961 Bacteria 975
159 Ga0207668_10015726 3300025972 Bacteria 4708
160 Ga0207640_10256849 3300025981 Bacteria 1359
161 Ga0207658_10081122 3300025986 Bacteria 2487
162 Ga0207677_11165034 3300026023 Bacteria 705
163 Ga0207703_10775508 3300026035 Bacteria 914
164 Ga0207678_10018158 3300026067 Bacteria 6178
165 Ga0207678_10177946 3300026067 Bacteria 1816
166 Ga0207678_10524274 3300026067 Bacteria 1034
167 Ga0207678_11585582 3300026067 Bacteria 577
168 Ga0207702_10163602 3300026078 Bacteria 2034
169 Ga0207702_10180512 3300026078 Bacteria 1943
170 Ga0207702_10222644 3300026078 Bacteria 1759
171 Ga0207648_10557202 3300026089 Bacteria 1053
172 Ga0207676_10657757 3300026095 Bacteria 1012
173 Ga0207674_10056545 3300026116 Bacteria 3983
174 Ga0207675_101145455 3300026118 Bacteria 798
175 Ga0207683_10654696 3300026121 Bacteria 973
176 Ga0207698_10191046 3300026142 Bacteria 1824
177 Ga0207698_10320582 3300026142 Bacteria 1451
178 Ga0207698_10966294 3300026142 Bacteria 861
179 Ga0207698_12121959 3300026142 Bacteria 575
180 Ga0209389_1000090 3300027296 Bacteria 83470
181 Ga0209489_100385 3300027361 Bacteria 79532
182 Ga0209700_100013 3300027363 Bacteria 341906
183 Ga0209813_10080140 3300027866 Bacteria 1078
184 Ga0209813_10362490 3300027866 Bacteria 576
185 Ga0268266_10548966 3300028379 Bacteria 1107
186 Ga0268266_11155548 3300028379 Bacteria 749
187 Ga0268265_11572212 3300028380 Bacteria 662
188 Ga0268264_10113984 3300028381 Bacteria 2373
189 Ga0307508_10377826 3300031616 Bacteria 1008
190 Ga0307510_10020561 3300033180 Bacteria 7711
191 Ga0307510_10365953 3300033180 Bacteria 889
192 Ga0395899_0146406 3300037312 Bacteria 1677
193 Ga0395900_0001231 3300037418 Bacteria 31462
194 Ga0395900_0071574 3300037418 Bacteria 3565
195 Ga0395900_0107105 3300037418 Bacteria 2872
196 Ga0395898_0042321 3300037466 Bacteria 4495
197 Ga0395898_0143819 3300037466 Bacteria 2283
198 Ga0395898_0337988 3300037466 Bacteria 1436
199 Ga0395905_0004246 3300037471 Bacteria 14969
200 Ga0395905_0517202 3300037471 Bacteria 1094
201 Ga0436364_0094964 3300037853 Bacteria 1244
202 Ga0436364_0658147 3300037853 Bacteria 1087
203 Ga0395901_0060962 3300038443 Bacteria 3926
204 Ga0395901_0069755 3300038443 Bacteria 3661
205 Ga0395901_0196204 3300038443 Bacteria 2117
206 Ga0436365_0080544 3300039437 Bacteria 865
207 Ga0436365_1627524 3300039437 Bacteria 1242
208 Ga0436360_0877519 3300039438 Bacteria 1524
209 Ga0439465_0232478 3300041413 Bacteria 678
210 Ga0451797_1102106 3300041453 Bacteria 716
211 Ga0451800_0307868 3300041459 Bacteria 656
212 Ga0451802_1818308 3300041460 Bacteria 831
213 Ga0451835_0806133 3300041492 Bacteria 898
214 Ga0451841_1030901 3300041498 Bacteria 500
215 Ga0451853_2671108 3300041512 Bacteria 1244
216 Ga0466972_0000090 3300044658 Bacteria 82487
217 Ga0466972_0027740 3300044658 Bacteria 2799
218 Ga0466972_0075222 3300044658 Bacteria 1610
219 Ga0466972_0140038 3300044658 Bacteria 1138
220 Ga0466965_0055510 3300044683 Bacteria 1971
221 Ga0466965_0065810 3300044683 Bacteria 1816
222 Ga0466965_0100247 3300044683 Bacteria 1481
223 Ga0466966_0001198 3300044684 Bacteria 16633
224 Ga0466961_0000081 3300044693 Bacteria 59450
225 Ga0466964_0097051 3300044706 Bacteria 1293
226 Ga0466964_0111797 3300044706 Bacteria 1219
227 Ga0466968_0001389 3300044735 Bacteria 8648
228 Ga0466970_0043945 3300044765 Bacteria 2379
229 Ga0466970_0750552 3300044765 Bacteria 570
230 Ga0466957_0436250 3300044842 Bacteria 901
231 Ga0466960_0021385 3300044901 Bacteria 2879
232 Ga0466959_0015201 3300045049 Bacteria 5606
233 Ga0466959_0234296 3300045049 Bacteria 1270
234 Ga0495592_0225813 3300046454 Bacteria 1249
235 Ga0495629_0040256 3300046459 Bacteria 3287
236 Ga0495638_0025365 3300046460 Bacteria 3855
237 Ga0495651_0008507 3300046462 Bacteria 7862
238 Ga0495653_0096304 3300046463 Bacteria 2152
239 Ga0495653_0906868 3300046463 Bacteria 525
240 Ga0495605_0234069 3300046474 Bacteria 790
241 Ga0495605_0432729 3300046474 Bacteria 544
242 Ga0495639_0339979 3300046475 Bacteria 753
243 Ga0495662_0023617 3300046476 Bacteria 2969
244 Ga0495662_0107837 3300046476 Bacteria 1364
245 Ga0495664_0020394 3300046477 Bacteria 3823
246 Ga0495584_0105907 3300046491 Bacteria 1422
247 Ga0495585_0247396 3300046492 Bacteria 891
248 Ga0495594_0090661 3300046499 Bacteria 1713
249 Ga0495596_0039705 3300046500 Bacteria 1859
250 Ga0495607_0287693 3300046501 Bacteria 778
251 Ga0495607_0325384 3300046501 Bacteria 716
252 Ga0495583_0076082 3300046506 Bacteria 1467
253 Ga0495583_0289373 3300046506 Bacteria 652
254 Ga0495606_0037075 3300046507 Bacteria 3313
255 Ga0495606_0278112 3300046507 Bacteria 916
256 Ga0495606_0382388 3300046507 Bacteria 738
257 Ga0495606_0526603 3300046507 Bacteria 592
258 Ga0495608_0061403 3300046511 Bacteria 2471
259 Ga0495616_0044841 3300046513 Bacteria 2241
260 Ga0495618_0823270 3300046514 Bacteria 539
261 Ga0495620_0112805 3300046515 Bacteria 1076
262 Ga0495628_0029809 3300046516 Bacteria 4421
263 Ga0495628_0376231 3300046516 Bacteria 1041
264 Ga0495632_0302691 3300046519 Bacteria 709
265 Ga0495643_0089588 3300046522 Bacteria 1589
266 Ga0495643_0094395 3300046522 Bacteria 1540
267 Ga0495648_0132697 3300046524 Bacteria 1322
268 Ga0495648_0154279 3300046524 Bacteria 1194
269 Ga0495648_0471012 3300046524 Bacteria 545
270 Ga0495652_0015351 3300046529 Bacteria 6855
271 Ga0495652_0185474 3300046529 Bacteria 1592
272 Ga0495640_0021097 3300046533 Bacteria 4788
273 Ga0495640_0161504 3300046533 Bacteria 1435
274 Ga0495587_0008333 3300046536 Bacteria 6674
275 Ga0495609_0070716 3300046538 Bacteria 1534
276 Ga0495645_0034123 3300046543 Bacteria 3713
277 Ga0495622_0014054 3300046557 Bacteria 3714
278 Ga0495622_0026469 3300046557 Bacteria 2708
279 Ga0495622_0063789 3300046557 Bacteria 1704
280 Ga0495622_0153398 3300046557 Bacteria 1041
281 Ga0495667_0353186 3300046559 Bacteria 928
282 Ga0495667_0411066 3300046559 Bacteria 852
283 Ga0495634_0014475 3300046642 Bacteria 5687
284 Ga0495634_0053330 3300046642 Bacteria 2709
285 Ga0495611_0029501 3300046648 Bacteria 2406
286 Ga0495625_0445416 3300046660 Bacteria 801
287 Ga0495635_0042381 3300046663 Bacteria 3143
288 Ga0495635_0053955 3300046663 Bacteria 2769
289 Ga0495661_0440836 3300046665 Bacteria 628
290 Ga0495588_0013565 3300046674 Bacteria 3885
291 Ga0495657_0001697 3300046675 Bacteria 18874
292 Ga0495657_0022029 3300046675 Bacteria 4568
293 Ga0495599_0024633 3300046678 Bacteria 3763
294 Ga0495623_0001818 3300046679 Bacteria 14319
295 Ga0495623_0558300 3300046679 Bacteria 599
296 Ga0495646_0166441 3300046680 Bacteria 1217
297 Ga0495658_0688198 3300046683 Bacteria 655
298 Ga0495624_0227757 3300046690 Bacteria 1129
299 Ga0495624_0261507 3300046690 Bacteria 1046
300 Ga0495649_0062598 3300046694 Bacteria 2000
301 Ga0495649_0095069 3300046694 Bacteria 1586
302 Ga0495600_0018918 3300046809 Bacteria 4395
303 Ga0495600_0042925 3300046809 Bacteria 2948
304 Ga0495581_0205467 3300047315 Bacteria 1152
305 Ga0495604_0018118 3300047317 Bacteria 5637
306 Ga0495604_0255309 3300047317 Bacteria 1193
307 Ga0495674_0099755 3300047319 Bacteria 2472
308 Ga0495672_0421390 3300047320 Bacteria 607
309 Ga0495676_0506295 3300047321 Bacteria 792
310 Ga0495680_0008019 3300047322 Bacteria 9629
311 Ga0495683_0072783 3300047323 Bacteria 1686
312 Ga0495687_028538 3300047443 Bacteria 2595
313 Ga0495675_0012583 3300047444 Bacteria 5325
314 Ga0495679_105809 3300047446 Bacteria 778
315 Ga0495673_0077869 3300047469 Bacteria 1380
316 Ga0495684_0074738 3300047471 Bacteria 2575
317 Ga0495686_0042702 3300047472 Bacteria 2880
318 Ga0495686_0047673 3300047472 Bacteria 2705
319 Ga0495686_0360690 3300047472 Bacteria 788
320 Ga0495593_0084452 3300047673 Bacteria 1639
321 Ga0495593_0193767 3300047673 Bacteria 1022
322 Ga0495602_0046633 3300048088 Bacteria 3912
323 Ga0495602_0269837 3300048088 Bacteria 1258
324 Ga0495614_0100119 3300048089 Bacteria 1266
325 Ga0496100_0277502 3300048903 Bacteria 1248
326 Ga0496100_0401188 3300048903 Bacteria 1044
327 Ga0496101_0033645 3300048904 Bacteria 3616
328 Ga0496101_0274384 3300048904 Bacteria 1317
329 Ga0496101_0287547 3300048904 Bacteria 1286
330 Ga0496102_0344196 3300048905 Bacteria 1404
331 Ga0496102_0494743 3300048905 Bacteria 1144
332 Ga0496102_0495203 3300048905 Bacteria 1144
333 Ga0496103_0052077 3300048906 Bacteria 2535
334 Ga0496103_0217574 3300048906 Bacteria 1228
335 Ga0496104_0013116 3300048907 Bacteria 7468
336 Ga0496104_0132107 3300048907 Bacteria 2398
337 Ga0496105_0010335 3300048908 Bacteria 7338
338 Ga0496105_0029238 3300048908 Bacteria 4510
339 Ga0496105_0171893 3300048908 Bacteria 1776
340 Ga0496105_1069330 3300048908 Bacteria 600
341 Ga0496106_0022626 3300048909 Bacteria 4671
342 Ga0496106_0126073 3300048909 Bacteria 2005
343 Ga0496107_0032698 3300048910 Bacteria 3718
344 Ga0496108_0028078 3300048911 Bacteria 4655
345 Ga0496108_1525500 3300048911 Bacteria 555
346 Ga0496109_0057054 3300048912 Bacteria 3563
347 Ga0496109_0543423 3300048912 Bacteria 1096
348 Ga0496110_0093669 3300048913 Bacteria 2689
349 Ga0496110_0577806 3300048913 Bacteria 1020
350 Ga0496111_0102776 3300048914 Bacteria 2101
351 Ga0496111_0273992 3300048914 Bacteria 1252
352 Ga0496111_0977343 3300048914 Bacteria 607
353 Ga0496112_0164555 3300048915 Bacteria 2184
354 Ga0496113_0041326 3300048916 Bacteria 3402
355 Ga0496113_0095714 3300048916 Bacteria 2295
356 Ga0496113_0362217 3300048916 Bacteria 1163
357 Ga0496113_0461512 3300048916 Bacteria 1020
358 Ga0496114_0080981 3300048917 Bacteria 2742
359 Ga0496115_0050211 3300048918 Bacteria 3341
360 Ga0496115_0725744 3300048918 Bacteria 779
361 Ga0496115_0921934 3300048918 Bacteria 672
362 Ga0496116_0059809 3300048919 Bacteria 2475
363 Ga0496116_0262618 3300048919 Bacteria 850
364 Ga0496117_0237571 3300048920 Bacteria 1003
365 Ga0496118_0089851 3300048921 Bacteria 2119
366 Ga0496118_0206799 3300048921 Bacteria 1156
367 Ga0496118_0618477 3300048921 Bacteria 515
368 Ga0496119_0005987 3300048922 Bacteria 11424
369 Ga0496119_0202420 3300048922 Bacteria 1026
370 Ga0496119_0226417 3300048922 Bacteria 954
371 Ga0496120_0044814 3300048923 Bacteria 2567
372 Ga0496121_0005046 3300048924 Bacteria 17245
373 Ga0496121_0251641 3300048924 Bacteria 1225
374 Ga0496122_0327494 3300048925 Bacteria 811
375 Ga0496124_0262994 3300048927 Bacteria 1268
376 Ga0496124_0574220 3300048927 Bacteria 739
377 Ga0496125_0045503 3300048928 Bacteria 3692
378 Ga0496125_0072499 3300048928 Bacteria 2683
379 Ga0496125_0111536 3300048928 Bacteria 1979
380 Ga0496126_0017322 3300048929 Bacteria 7180
381 Ga0496126_0139954 3300048929 Bacteria 2084
382 Ga0496126_0547063 3300048929 Bacteria 919
383 Ga0495682_0029151 3300049460 Bacteria 2044
384 Ga0495682_0143863 3300049460 Bacteria 851
385 nmdc:mga03n38_330646_c1 3300050490 Bacteria 825
386 nmdc:mga00v17_152498_c1 3300050491 Bacteria 1485
387 nmdc:mga00v17_286917_c1 3300050491 Bacteria 1069
388 nmdc:mga0yw44_205458_c1 3300050492 Bacteria 1302
389 nmdc:mga0yw44_30813_c1 3300050492 Bacteria 3113
390 nmdc:mga0yw44_4083_c1 3300050492 Bacteria 6617
391 nmdc:mga0yw44_658151_c1 3300050492 Bacteria 712
392 nmdc:mga0k408_484606_c1 3300050493 Bacteria 733
393 nmdc:mga0k408_9996_c1 3300050493 Bacteria 5123
394 nmdc:mga06z11_181787_c1 3300050494 Bacteria 1213
395 nmdc:mga06z11_367945_c1 3300050494 Bacteria 862
396 nmdc:mga06z11_492120_c1 3300050494 Bacteria 743
397 nmdc:mga04h51_1462_c1 3300050495 Bacteria 5468
398 nmdc:mga04h51_181926_c1 3300050495 Bacteria 819
399 nmdc:mga04h51_400069_c1 3300050495 Bacteria 575
400 nmdc:mga07m45_197830_c1 3300050496 Bacteria 1169
401 nmdc:mga07m45_214812_c1 3300050496 Bacteria 1119
402 nmdc:mga07m45_449029_c1 3300050496 Bacteria 748
403 nmdc:mga07m45_702795_c1 3300050496 Bacteria 581
404 nmdc:mga07m45_798249_c1 3300050496 Bacteria 541
405 nmdc:mga0sz30_131878_c1 3300050516 Bacteria 1101
406 nmdc:mga0sz30_43985_c1 3300050516 Bacteria 1881
407 nmdc:mga0sz30_495263_c1 3300050516 Bacteria 550
408 nmdc:mga0sz30_80049_c1 3300050516 Bacteria 1413
409 Ga0500610_0209690 3300053079 Bacteria 932
410 Ga0500635_0169250 3300053080 Bacteria 841
411 Ga0495655_0004857 3300053083 Bacteria 2334
412 Ga0495595_0060046 3300053084 Bacteria 1779
413 Ga0495619_0887772 3300053085 Bacteria 600
414 Ga0500578_0145074 3300053086 Bacteria 1482
415 Ga0500578_0308624 3300053086 Bacteria 936
416 Ga0500643_000267 3300053087 Bacteria 46005
417 Ga0500646_0055261 3300053090 Bacteria 1155
418 Ga0500583_0011984 3300053092 Bacteria 3291
419 Ga0500651_0165670 3300053093 Bacteria 1320
420 Ga0500651_0301119 3300053093 Bacteria 920
421 Ga0500566_0120512 3300053094 Bacteria 1415
422 Ga0500640_175075 3300053095 Bacteria 785
423 Ga0500641_0005268 3300053096 Bacteria 4581
424 Ga0500555_007154 3300053103 Bacteria 3172
425 Ga0500562_113521 3300053108 Bacteria 738
426 Ga0500569_289047 3300053109 Bacteria 553
427 Ga0500572_014945 3300053111 Bacteria 1949
428 Ga0500592_007349 3300053116 Bacteria 1753
429 Ga0500594_0291613 3300053118 Bacteria 546
430 Ga0500595_043587 3300053119 Bacteria 1427
431 Ga0500595_082649 3300053119 Bacteria 938
432 Ga0500608_116593 3300053122 Bacteria 1217
433 Ga0500642_0003348 3300053130 Bacteria 4833
434 Ga0500652_208767 3300053131 Bacteria 790
435 Ga0500652_216307 3300053131 Bacteria 772
436 Ga0500559_0243934 3300053136 Bacteria 847
437 Ga0500568_0027039 3300053139 Bacteria 2402
438 Ga0500568_0094541 3300053139 Bacteria 1125
439 Ga0500577_0393791 3300053142 Bacteria 606
440 Ga0500588_0231363 3300053146 Bacteria 691
441 Ga0500588_0298434 3300053146 Bacteria 609
442 Ga0500616_0091986 3300053153 Bacteria 1500
443 Ga0500619_165581 3300053154 Bacteria 749
444 Ga0500622_0133906 3300053156 Bacteria 1188
445 Ga0500633_0153386 3300053160 Bacteria 864
446 Ga0500638_039435 3300053162 Bacteria 2293
447 Ga0500638_200481 3300053162 Bacteria 845
448 Ga0500636_0000324 3300053177 Bacteria 26370
449 Ga0500649_087403 3300053722 Bacteria 1257
450 Ga0500599_037693 3300053736 Bacteria 737
451 Ga0500601_000256 3300053737 Bacteria 10118
452 Ga0500661_105992 3300055283 Bacteria 536
453 2507511036 2507262055 Bacteria 8048963
454 2508544857 2508501009 Bacteria 7784016
455 2508696915 2508501042 Bacteria 8719808
456 2511400372 2511231028 Bacteria 8046582
457 2513637446 2513237094 Bacteria 8789602
458 2513649705 2513237095 Bacteria 8976980
459 2513660971 2513237096 Bacteria 8722461
460 2513716943 2513237104 Bacteria 10034502
461 2513922713 2513237145 Bacteria 8979722
462 2514010608 2513237161 Bacteria 8871253
463 2515625412 2515154112 Bacteria 8294334
464 2524438163 2524023205 Bacteria 8918781
465 2528855907 2528768022 Bacteria 10457665
466 2617373168 2617270741 Bacteria 8201522
467 2745076956 2744054633 Bacteria 8678936
468 2805916672 2802429603 Bacteria 8777136
469 2818238176 2816332527 Bacteria 8933356
470 2824609255 2824600985 Bacteria 8488197
471 2824617108 2824609381 Bacteria 8672835
472 2824658736 2824653114 Bacteria 8493680
473 2824668291 2824661429 Bacteria 9877870
474 2824676203 2824671348 Bacteria 8369588
475 2824692339 2824687955 Bacteria 8360029
476 2824704053 2824696289 Bacteria 8335049
477 2824711494 2824704595 Bacteria 9667483
478 2824738459 2824732956 Bacteria 7810675
479 2824751562 2824746037 Bacteria 7911610
480 2824761248 2824753945 Bacteria 9787441
481 2824771827 2824763712 Bacteria 9792355
482 2824780518 2824773399 Bacteria 8360218
483 2838127919 2838122688 Bacteria 8803140
484 2841943213 2841941048 Bacteria 8688029
485 2841954056 2841949485 Bacteria 8680857
486 2841960196 2841957949 Bacteria 8652217
487 2841968147 2841966195 Bacteria 8673214
488 2841976644 2841974524 Bacteria 8931498
489 2841988016 2841983080 Bacteria 8395090
490 2842042681 2842038055 Bacteria 8002051
491 2842050724 2842045827 Bacteria 8006841
492 2844316888 2844315083 Bacteria 8138177
493 2847938586 2847930680 Bacteria 9342022
494 2847944214 2847939898 Bacteria 8606328
495 2849081554 2849076700 Bacteria 7039503
496 2874597773 2874590934 Bacteria 8299676
497 2874617671 2874612657 Bacteria 8252029
498 2874623412 2874620515 Bacteria 8290088
499 2874634172 2874628541 Bacteria 8630250
500 2874651302 2874645413 Bacteria 8214782
501 2876776373 2876771140 Bacteria 8287509
502 2876820941 2876818435 Bacteria 8274608
503 2879081764 2879074833 Bacteria 8279565
504 2879086169 2879083081 Bacteria 8587928
505 2879101323 2879099564 Bacteria 10442239
506 2879146365 2879142872 Bacteria 8267021
507 2881370705 2881364244 Bacteria 7710352
508 2881671310 2881665667 Bacteria 8175609
509 2885366911 2885366525 Bacteria 8326213
510 2885376929 2885374607 Bacteria 8927485
511 2885413409 2885409591 Bacteria 9235467
512 2888381501 2888378607 Bacteria 9652610
513 2888389140 2888388044 Bacteria 7304136
514 2888421904 2888419890 Bacteria 7857137
515 2903733938 2903727486 Bacteria 8281579
516 2904667357 2904666416 Bacteria 8226587
517 2904719252 2904711408 Bacteria 9771557
518 2906604554 2906602504 Bacteria 8295279
519 2906635200 2906626472 Bacteria 8826946
520 2906640088 2906635258 Bacteria 8601019
521 2906650939 2906643746 Bacteria 8722424
522 2906667482 2906660503 Bacteria 8595048
523 2908781623 2908775508 Bacteria 8092255
524 2922371167
525 2922393541 2922393267 Bacteria 8285685
526 2929619552 2929615660 Bacteria 9193770
527 2929627978 2929624759 Bacteria 9339455
528 2932785879 2932784394 Bacteria 9704911
529 2932798337 2932794094 Bacteria 7915132
530 2932804133 2932801729 Bacteria 7987968
531 2932817251 2932809354 Bacteria 9135765
532 2932826739 2932818245 Bacteria 9955613
533 2932830924 2932828146 Bacteria 9745859
534 2933581472 2933577622 Bacteria 9116884
535 2935612728 2935608549 Bacteria 8203142
536 2935620990 2935616580 Bacteria 9032984
537 2935640065 2935638405 Bacteria 10015038
538 2935655152 2935648319 Bacteria 8801166
539 2935664033 2935656913 Bacteria 8965014
540 2935667096 2935665750 Bacteria 9571747
541 2935680262 2935675223 Bacteria 9928132
542 2935690227 2935684952 Bacteria 9590419
543 2935699686 2935694250 Bacteria 9291695
544 2935704852 2935703347 Bacteria 10242284
545 2935718076 2935713505 Bacteria 9608509
546 2935726774 2935722832 Bacteria 9608746
547 2935735543 2935732158 Bacteria 9706831
548 2935745186 2935741537 Bacteria 9707219
549 2935755238 2935750917 Bacteria 9590372
550 2935762244 2935760218 Bacteria 9817913
551 2935773634 2935769743 Bacteria 7878163
552 2935780189 2935777560 Bacteria 8077691
553 2935788461 2935785616 Bacteria 7962367
554 2935796617 2935793552 Bacteria 8012592
555 2935803746 2935801545 Bacteria 9301974
556 2935811662 2935810662 Bacteria 9401221
557 2935824217 2935819856 Bacteria 8261050
558 2935829548 2935827899 Bacteria 10038562
559 2935842490 2935837841 Bacteria 9454360
560 2935852636 2935847175 Bacteria 8228321
561 2935858797 2935855204 Bacteria 9035059
562 2935866805 2935864058 Bacteria 9784707
563 2935876936 2935873716 Bacteria 9632195
564 2935884061 2935883170 Bacteria 7964738
565 2935912218 2935908558 Bacteria 8568796
566 2935922430 2935916978 Bacteria 9113783
567 2935929247 2935926038 Bacteria 8601059
568 2935935878 2935934488 Bacteria 8602579
569 2935947444 2935942939 Bacteria 8599779
570 2935953461 2935951376 Bacteria 8602333
571 2935962018 2935959822 Bacteria 7869783
572 2935968487 2935967501 Bacteria 8603075
573 2935976677 2935975950 Bacteria 8347125
574 2935990699 2935984226 Bacteria 8302647
575 2935993426 2935992306 Bacteria 9802711
576 2936004321 2936002035 Bacteria 9362176
577 2936015469 2936011229 Bacteria 8801034
578 2936024103 2936019824 Bacteria 8804134
579 2936033118 2936028420 Bacteria 8965941
580 2936038244 2936037263 Bacteria 9446081
581 2936051211 2936046547 Bacteria 8903709
582 2936058584 2936055302 Bacteria 8785755
583 2940561481 2940556831 Bacteria 9590747
584 2941533669 2941531003 Bacteria 7653939
585 2941547397 2941538514 Bacteria 9402094
586 3005486161 3005483717 Bacteria 7877331
587 3005507103 3005506211 Bacteria 6943378
588 3005593062 3005587118 Bacteria 7794411
589 3005596523 3005594810 Bacteria 8716512
590 8016516462 8016511872 Bacteria 9921665
591 8016523860 8016522445 Bacteria 8156687
592 8016537390 8016530956 Bacteria 8155261
593 8016541663 8016539877 Bacteria 8155419
594 8016559991 8016557553 Bacteria 8154380
595 8016567047 8016566248 Bacteria 8158151
596 8016579767 8016575299 Bacteria 8154085
597 8016597918 8016595262 Bacteria 8149947
598 8016604056 8016603502 Bacteria 8731218
599 8016620640 8016613128 Bacteria 8794220
600 8016629357 8016622563 Bacteria 7999408
601 8016633875 8016630954 Bacteria 9217207
602 8017060076 8017057580 Bacteria 10023680
603 8019537076 8019530166 Bacteria 8155624
604 8019542466 8019538911 Bacteria 7872763
605 8019548290 8019547302 Bacteria 7996444
606 8019579585 8019576017 Bacteria 10049540
607 8019587295 8019586578 Bacteria 10212056
608 8019604047 8019597564 Bacteria 10041141
609 8019614482 8019608314 Bacteria 10042931
610 8019625110 8019619141 Bacteria 9218857
611 8019637070 8019629233 Bacteria 8687553
612 8019650051 8019648815 Bacteria 10014479
613 8019664915 8019659431 Bacteria 8577854
614 8019674472 8019668869 Bacteria 8791617
615 8019681632 8019678201 Bacteria 8863603
616 8019694137 8019687851 Bacteria 8712826
617 8055749190 8055742211 Bacteria 9226248
618 8056969695 8056967851 Bacteria 9038162
619 Ga0466968_0072784
620 JGI25153J46596_10010980
621 JGI25153J46596_10011918
622 JGI25153J46596_10061672
623 JGI25160J50197_1002906
624 JGI25160J50197_1017407
625 Ga0055539_1010155
626 Ga0055525_1002356
627 Ga0055526_1028840
628 Ga0055531_10006503
629 Ga0065165_1001395
630 Ga0065165_1015596
631 Ga0065165_1040515
632 Ga0065165_1067086
633 Ga0068869_100760051
634 Ga0070666_10073988
635 Ga0070666_10296705
636 Ga0068868_101822589
637 Ga0070661_101080899
638 Ga0070668_100027764
639 Ga0070668_100434888
640 Ga0070675_100630995
641 Ga0070671_100124451
642 Ga0070671_101103812
643 Ga0070673_100772140
644 Ga0070667_100185735
645 Ga0070709_11124471
646 Ga0070713_101591624
647 Ga0070663_100134783
648 Ga0070663_100426663
649 Ga0070663_100525376
650 Ga0070662_100028122
651 Ga0070662_100121513
652 Ga0070662_100536931
653 Ga0068853_100642385
654 Ga0070693_100331630
655 Ga0070665_101577198
656 Ga0070664_101216627
657 Ga0068857_100878507
658 Ga0068856_100070929
659 Ga0068856_100752084
660 Ga0068852_100120791
661 Ga0068852_100309778
662 Ga0068852_101434026
663 Ga0068864_100771004
664 Ga0068861_102452341
665 Ga0068858_100321935
666 Ga0068862_100393692
667 Ga0068862_101948843
668 Ga0075365_10111210
669 Ga0075365_10154557
670 Ga0075368_10014957
671 Ga0075364_10105727
672 Ga0075364_10248709
673 Ga0075364_10373351
674 Ga0075367_10108388
675 Ga0075367_10317575
676 Ga0075369_10011806
677 Ga0075369_10199837
678 Ga0075369_10231612
679 Ga0075369_10445660
680 Ga0075366_10026004
681 Ga0075370_10113781
682 Ga0075370_10183377
683 Ga0075370_10880649
684 Ga0099824_1007956
685 Ga0099823_1017926
686 Ga0105250_10105156
687 Ga0105240_10010499
688 Ga0105240_10764807
689 Ga0105247_10080245
690 Ga0105247_10207633
691 Ga0105243_10089985
692 Ga0105243_10564416
693 Ga0105243_12950677
694 Ga0105241_10006264
695 Ga0105242_13027722
696 Ga0105248_10521402
697 Ga0105237_10003992
698 Ga0105237_10871524
699 Ga0105237_11224974
700 Ga0105249_10350850
701 Ga0105239_10008897
702 Ga0105239_10013956
703 Ga0105239_10341188
704 Ga0105239_10349014
705 Ga0105246_10092081
706 Ga0157373_10940893
707 Ga0157370_10454605
708 Ga0157374_10503802
709 Ga0157374_10847651
710 Ga0163163_10159300
711 Ga0163163_10327673
712 Ga0182008_10311036
713 Ga0157377_10371854
714 Ga0157379_10180280
715 Ga0157376_10830638
716 Ga0182005_1237672
717 Ga0163161_11434361
718 Ga0214544_1000001
719 Ga0214544_1037329
720 Ga0214542_1000005
721 Ga0214542_1040315
722 Ga0214545_1000003
723 Ga0214545_1041787
724 Ga0214543_1000002
725 Ga0214543_1045898
726 Ga0213876_10698863
727 Ga0213875_10298510
728 Ga0209563_102615
729 Ga0209026_1046474
730 Ga0209677_106331
731 Ga0209148_1000424
732 Ga0209233_1023143
733 Ga0209455_1006192
734 Ga0209564_1012198
735 Ga0209564_1049031
736 Ga0209758_1000026
737 Ga0209758_1000880
738 Ga0209758_1002083
739 Ga0209758_1002329
740 Ga0209758_1023282
741 Ga0209758_1029399
742 Ga0209758_1079777
743 Ga0209256_1001638
744 Ga0209256_1006024
745 Ga0207426_1000425
746 Ga0207426_1001569
747 Ga0207426_1003144
748 Ga0207426_1010480
749 Ga0207426_1024623
750 Ga0209051_1026462
751 Ga0209257_1000426
752 Ga0209257_1022198
753 Ga0209257_1067506
754 Ga0207656_10101393
755 Ga0207642_10655643
756 Ga0207710_10111767
757 Ga0207680_10399216
758 Ga0207680_10467002
759 Ga0207647_10008631
760 Ga0207654_10274077
761 Ga0207695_10000062
762 Ga0207695_10655750
763 Ga0207671_10003738
764 Ga0207671_11389846
765 Ga0207649_10329142
766 Ga0207694_10826124
767 Ga0207659_11065067
768 Ga0207706_10154147
769 Ga0207706_10378166
770 Ga0207706_11168911
771 Ga0207709_10156493
772 Ga0207665_11427923
773 Ga0207711_11022256
774 Ga0207689_10398461
775 Ga0207651_10533228
776 Ga0207712_10570977
777 Ga0207668_10015726
778 Ga0207640_10256849
779 Ga0207658_10081122
780 Ga0207677_11165034
781 Ga0207703_10775508
782 Ga0207678_10018158
783 Ga0207678_10177946
784 Ga0207678_10524274
785 Ga0207678_11585582
786 Ga0207702_10163602
787 Ga0207702_10180512
788 Ga0207702_10222644
789 Ga0207648_10557202
790 Ga0207676_10657757
791 Ga0207674_10056545
792 Ga0207675_101145455
793 Ga0207683_10654696
794 Ga0207698_10191046
795 Ga0207698_10320582
796 Ga0207698_10966294
797 Ga0207698_12121959
798 Ga0209389_1000090
799 Ga0209489_100385
800 Ga0209700_100013
801 Ga0209813_10080140
802 Ga0209813_10362490
803 Ga0268266_10548966
804 Ga0268266_11155548
805 Ga0268265_11572212
806 Ga0268264_10113984
807 Ga0307508_10377826
808 Ga0307510_10020561
809 Ga0307510_10365953
810 Ga0395899_0146406
811 Ga0395900_0001231
812 Ga0395900_0071574
813 Ga0395900_0107105
814 Ga0395898_0042321
815 Ga0395898_0143819
816 Ga0395898_0337988
817 Ga0395905_0004246
818 Ga0395905_0517202
819 Ga0436364_0094964
820 Ga0436364_0658147
821 Ga0395901_0060962
822 Ga0395901_0069755
823 Ga0395901_0196204
824 Ga0436365_0080544
825 Ga0436365_1627524
826 Ga0436360_0877519
827 Ga0439465_0232478
828 Ga0451797_1102106
829 Ga0451800_0307868
830 Ga0451802_1818308
831 Ga0451835_0806133
832 Ga0451841_1030901
833 Ga0451853_2671108
834 Ga0466972_0000090
835 Ga0466972_0027740
836 Ga0466972_0075222
837 Ga0466972_0140038
838 Ga0466965_0055510
839 Ga0466965_0065810
840 Ga0466965_0100247
841 Ga0466966_0001198
842 Ga0466961_0000081
843 Ga0466964_0097051
844 Ga0466964_0111797
845 Ga0466968_0001389
846 Ga0466970_0043945
847 Ga0466970_0750552
848 Ga0466957_0436250
849 Ga0466960_0021385
850 Ga0466959_0015201
851 Ga0466959_0234296
852 Ga0495592_0225813
853 Ga0495629_0040256
854 Ga0495638_0025365
855 Ga0495651_0008507
856 Ga0495653_0096304
857 Ga0495653_0906868
858 Ga0495605_0234069
859 Ga0495605_0432729
860 Ga0495639_0339979
861 Ga0495662_0023617
862 Ga0495662_0107837
863 Ga0495664_0020394
864 Ga0495584_0105907
865 Ga0495585_0247396
866 Ga0495594_0090661
867 Ga0495596_0039705
868 Ga0495607_0287693
869 Ga0495607_0325384
870 Ga0495583_0076082
871 Ga0495583_0289373
872 Ga0495606_0037075
873 Ga0495606_0278112
874 Ga0495606_0382388
875 Ga0495606_0526603
876 Ga0495608_0061403
877 Ga0495616_0044841
878 Ga0495618_0823270
879 Ga0495620_0112805
880 Ga0495628_0029809
881 Ga0495628_0376231
882 Ga0495632_0302691
883 Ga0495643_0089588
884 Ga0495643_0094395
885 Ga0495648_0132697
886 Ga0495648_0154279
887 Ga0495648_0471012
888 Ga0495652_0015351
889 Ga0495652_0185474
890 Ga0495640_0021097
891 Ga0495640_0161504
892 Ga0495587_0008333
893 Ga0495609_0070716
894 Ga0495645_0034123
895 Ga0495622_0014054
896 Ga0495622_0026469
897 Ga0495622_0063789
898 Ga0495622_0153398
899 Ga0495667_0353186
900 Ga0495667_0411066
901 Ga0495634_0014475
902 Ga0495634_0053330
903 Ga0495611_0029501
904 Ga0495625_0445416
905 Ga0495635_0042381
906 Ga0495635_0053955
907 Ga0495661_0440836
908 Ga0495588_0013565
909 Ga0495657_0001697
910 Ga0495657_0022029
911 Ga0495599_0024633
912 Ga0495623_0001818
913 Ga0495623_0558300
914 Ga0495646_0166441
915 Ga0495658_0688198
916 Ga0495624_0227757
917 Ga0495624_0261507
918 Ga0495649_0062598
919 Ga0495649_0095069
920 Ga0495600_0018918
921 Ga0495600_0042925
922 Ga0495581_0205467
923 Ga0495604_0018118
924 Ga0495604_0255309
925 Ga0495674_0099755
926 Ga0495672_0421390
927 Ga0495676_0506295
928 Ga0495680_0008019
929 Ga0495683_0072783
930 Ga0495687_028538
931 Ga0495675_0012583
932 Ga0495679_105809
933 Ga0495673_0077869
934 Ga0495684_0074738
935 Ga0495686_0042702
936 Ga0495686_0047673
937 Ga0495686_0360690
938 Ga0495593_0084452
939 Ga0495593_0193767
940 Ga0495602_0046633
941 Ga0495602_0269837
942 Ga0495614_0100119
943 Ga0496100_0277502
944 Ga0496100_0401188
945 Ga0496101_0033645
946 Ga0496101_0274384
947 Ga0496101_0287547
948 Ga0496102_0344196
949 Ga0496102_0494743
950 Ga0496102_0495203
951 Ga0496103_0052077
952 Ga0496103_0217574
953 Ga0496104_0013116
954 Ga0496104_0132107
955 Ga0496105_0010335
956 Ga0496105_0029238
957 Ga0496105_0171893
958 Ga0496105_1069330
959 Ga0496106_0022626
960 Ga0496106_0126073
961 Ga0496107_0032698
962 Ga0496108_0028078
963 Ga0496108_1525500
964 Ga0496109_0057054
965 Ga0496109_0543423
966 Ga0496110_0093669
967 Ga0496110_0577806
968 Ga0496111_0102776
969 Ga0496111_0273992
970 Ga0496111_0977343
971 Ga0496112_0164555
972 Ga0496113_0041326
973 Ga0496113_0095714
974 Ga0496113_0362217
975 Ga0496113_0461512
976 Ga0496114_0080981
977 Ga0496115_0050211
978 Ga0496115_0725744
979 Ga0496115_0921934
980 Ga0496116_0059809
981 Ga0496116_0262618
982 Ga0496117_0237571
983 Ga0496118_0089851
984 Ga0496118_0206799
985 Ga0496118_0618477
986 Ga0496119_0005987
987 Ga0496119_0202420
988 Ga0496119_0226417
989 Ga0496120_0044814
990 Ga0496121_0005046
991 Ga0496121_0251641
992 Ga0496122_0327494
993 Ga0496124_0262994
994 Ga0496124_0574220
995 Ga0496125_0045503
996 Ga0496125_0072499
997 Ga0496125_0111536
998 Ga0496126_0017322
999 Ga0496126_0139954
1000 Ga0496126_0547063
1001 Ga0495682_0029151
1002 Ga0495682_0143863
1003 nmdc:mga03n38_330646_c1
1004 nmdc:mga00v17_152498_c1
1005 nmdc:mga00v17_286917_c1
1006 nmdc:mga0yw44_205458_c1
1007 nmdc:mga0yw44_30813_c1
1008 nmdc:mga0yw44_4083_c1
1009 nmdc:mga0yw44_658151_c1
1010 nmdc:mga0k408_484606_c1
1011 nmdc:mga0k408_9996_c1
1012 nmdc:mga06z11_181787_c1
1013 nmdc:mga06z11_367945_c1
1014 nmdc:mga06z11_492120_c1
1015 nmdc:mga04h51_1462_c1
1016 nmdc:mga04h51_181926_c1
1017 nmdc:mga04h51_400069_c1
1018 nmdc:mga07m45_197830_c1
1019 nmdc:mga07m45_214812_c1
1020 nmdc:mga07m45_449029_c1
1021 nmdc:mga07m45_702795_c1
1022 nmdc:mga07m45_798249_c1
1023 nmdc:mga0sz30_131878_c1
1024 nmdc:mga0sz30_43985_c1
1025 nmdc:mga0sz30_495263_c1
1026 nmdc:mga0sz30_80049_c1
1027 Ga0500610_0209690
1028 Ga0500635_0169250
1029 Ga0495655_0004857
1030 Ga0495595_0060046
1031 Ga0495619_0887772
1032 Ga0500578_0145074
1033 Ga0500578_0308624
1034 Ga0500643_000267
1035 Ga0500646_0055261
1036 Ga0500583_0011984
1037 Ga0500651_0165670
1038 Ga0500651_0301119
1039 Ga0500566_0120512
1040 Ga0500640_175075
1041 Ga0500641_0005268
1042 Ga0500555_007154
1043 Ga0500562_113521
1044 Ga0500569_289047
1045 Ga0500572_014945
1046 Ga0500592_007349
1047 Ga0500594_0291613
1048 Ga0500595_043587
1049 Ga0500595_082649
1050 Ga0500608_116593
1051 Ga0500642_0003348
1052 Ga0500652_208767
1053 Ga0500652_216307
1054 Ga0500559_0243934
1055 Ga0500568_0027039
1056 Ga0500568_0094541
1057 Ga0500577_0393791
1058 Ga0500588_0231363
1059 Ga0500588_0298434
1060 Ga0500616_0091986
1061 Ga0500619_165581
1062 Ga0500622_0133906
1063 Ga0500633_0153386
1064 Ga0500638_039435
1065 Ga0500638_200481
1066 Ga0500636_0000324
1067 Ga0500649_087403
1068 Ga0500599_037693
1069 Ga0500601_000256
1070 Ga0500661_105992
1071 2507511036
1072 2508544857
1073 2508696915
1074 2511400372
1075 2513637446
1076 2513649705
1077 2513660971
1078 2513716943
1079 2513922713
1080 2514010608
1081 2515625412
1082 2524438163
1083 2528855907
1084 2617373168
1085 2745076956
1086 2805916672
1087 2818238176
1088 2824609255
1089 2824617108
1090 2824658736
1091 2824668291
1092 2824676203
1093 2824692339
1094 2824704053
1095 2824711494
1096 2824738459
1097 2824751562
1098 2824761248
1099 2824771827
1100 2824780518
1101 2838127919
1102 2841943213
1103 2841954056
1104 2841960196
1105 2841968147
1106 2841976644
1107 2841988016
1108 2842042681
1109 2842050724
1110 2844316888
1111 2847938586
1112 2847944214
1113 2849081554
1114 2874597773
1115 2874617671
1116 2874623412
1117 2874634172
1118 2874651302
1119 2876776373
1120 2876820941
1121 2879081764
1122 2879086169
1123 2879101323
1124 2879146365
1125 2881370705
1126 2881671310
1127 2885366911
1128 2885376929
1129 2885413409
1130 2888381501
1131 2888389140
1132 2888421904
1133 2903733938
1134 2904667357
1135 2904719252
1136 2906604554
1137 2906635200
1138 2906640088
1139 2906650939
1140 2906667482
1141 2908781623
1142 2922371167
1143 2922393541
1144 2929619552
1145 2929627978
1146 2932785879
1147 2932798337
1148 2932804133
1149 2932817251
1150 2932826739
1151 2932830924
1152 2933581472
1153 2935612728
1154 2935620990
1155 2935640065
1156 2935655152
1157 2935664033
1158 2935667096
1159 2935680262
1160 2935690227
1161 2935699686
1162 2935704852
1163 2935718076
1164 2935726774
1165 2935735543
1166 2935745186
1167 2935755238
1168 2935762244
1169 2935773634
1170 2935780189
1171 2935788461
1172 2935796617
1173 2935803746
1174 2935811662
1175 2935824217
1176 2935829548
1177 2935842490
1178 2935852636
1179 2935858797
1180 2935866805
1181 2935876936
1182 2935884061
1183 2935912218
1184 2935922430
1185 2935929247
1186 2935935878
1187 2935947444
1188 2935953461
1189 2935962018
1190 2935968487
1191 2935976677
1192 2935990699
1193 2935993426
1194 2936004321
1195 2936015469
1196 2936024103
1197 2936033118
1198 2936038244
1199 2936051211
1200 2936058584
1201 2940561481
1202 2941533669
1203 2941547397
1204 3005486161
1205 3005507103
1206 3005593062
1207 3005596523
1208 8016516462
1209 8016523860
1210 8016537390
1211 8016541663
1212 8016559991
1213 8016567047
1214 8016579767
1215 8016597918
1216 8016604056
1217 8016620640
1218 8016629357
1219 8016633875
1220 8017060076
1221 8019537076
1222 8019542466
1223 8019548290
1224 8019579585
1225 8019587295
1226 8019604047
1227 8019614482
1228 8019625110
1229 8019637070
1230 8019650051
1231 8019664915
1232 8019674472
1233 8019681632
1234 8019694137
1235 8055749190
1236 8056969695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20370

DUF6665

Family of unknown function (DUF6665)

12

121

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6msr-assembly1.cif.gz_C crystal structure of pro-2.5 0.8215 13 87
6msr-assembly1.cif.gz_B crystal structure of pro-2.5 0.8213 13 87
5o66-assembly1.cif.gz_F asymmetric acrabz-tolc 0.81 11 85
5ofa-assembly1.cif.gz_A crystal structure of human morc2 (residues 1-603) with spinal muscular atrophy mutation t424r 0.8011 14 94
5of9-assembly1.cif.gz_B crystal structure of human morc2 (residues 1-603) 0.7971 14 94
ID Description Score Start End Superfamily
3okqA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Actin interacting protein 3, C-terminal domain 0.6959 14 92 1.20.58.1540
af_G5EF26_216_316_1.20.81.10 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain 0.6701 4 93 1.20.81.10
af_Q4D4Y3_28_264_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.6626 9 101 1.20.1270.60
1ez3B00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6603 14 100 1.20.58.70
af_Q8TDU9_38_331_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6575 19 79 1.20.1070.10
ID Description Score Start End GO Terms
AF-I7ZBW4-F1-model_v4 Uncharacterized protein 0.9561 18 105
AF-A0A0E4BLQ1-F1-model_v4 Uncharacterized protein 0.9547 28 113
AF-A0A0E4BLQ1-F1-model_v4 Uncharacterized protein 0.9334 28 113
AF-A0A418W829-F1-model_v4 Uncharacterized protein 0.9319 9 104
AF-A0A0Q8N3U3-F1-model_v4 Uncharacterized protein 0.9304 3 102

Map