F469711

General Info

Members Datasets Scaffolds Average Seq Length
618 244 1236 147

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10008845|Ga0070692_100088454
Length 167
Sequence VTRQILPNPSPSRGRELREGELIRLSGPDETEALGRRLAPSLRPGDVVALYGDLGAGKTTLARGMLRGLGFEGDVASPTFPIVQPYEDLAPPLWHVDLYRIEDPAEIEELALDEALEAGALVIEWPERLGGALWPEALRLTLARDGDGARALTAIVPPAWEGRWPPR

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
172 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
173 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
174 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
221 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
222 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
230 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
231 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
232 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
242 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
243 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
244 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.16
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 0
Rhizoplane 2.27
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 5.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10008845 3300005345 Bacteria 4510
2 JGI24736J21556_1004979 3300001904 Bacteria 2252
3 JGI24741J21665_1018108 3300001915 Bacteria 1129
4 JGI24740J21852_10115798 3300001979 Bacteria 673
5 JGI24739J22299_10001228 3300001989 Bacteria 9627
6 JGI24737J22298_10010473 3300001990 Bacteria 3059
7 JGI24737J22298_10040196 3300001990 Bacteria 1436
8 JGI24735J21928_10001378 3300002067 Bacteria 8600
9 JGI24735J21928_10003986 3300002067 Bacteria 4995
10 JGI24735J21928_10014805 3300002067 Bacteria 2440
11 JGI24735J21928_10038163 3300002067 Bacteria 1407
12 JGI24738J21930_10000034 3300002075 Bacteria 25867
13 JGI24738J21930_10009234 3300002075 Bacteria 2224
14 JGI24738J21930_10125346 3300002075 Bacteria 560
15 JGI24749J21850_1000556 3300002076 Bacteria 5463
16 JGI24744J21845_10002365 3300002077 Bacteria 3847
17 JGI24751J29686_10000052 3300002459 Bacteria 65492
18 JGI24751J29686_10005711 3300002459 Bacteria 2535
19 rootH1_10068420 3300003316 Bacteria 2041
20 rootH2_10238528 3300003320 Bacteria 1433
21 rootL2_10039164 3300003322 Bacteria 2426
22 rootL2_10158042 3300003322 Bacteria 3677
23 rootL2_10171994 3300003322 Bacteria 2170
24 Ga0070658_10000001 3300005327 Bacteria 856789
25 Ga0070658_10002836 3300005327 Bacteria 14404
26 Ga0070676_10000562 3300005328 Bacteria 17974
27 Ga0070676_10043555 3300005328 Bacteria 2609
28 Ga0070683_100247208 3300005329 Bacteria 1696
29 Ga0070670_100000024 3300005331 Bacteria 189811
30 Ga0070670_100004229 3300005331 Bacteria 12012
31 Ga0070670_100124836 3300005331 Bacteria 2221
32 Ga0070670_100308445 3300005331 Bacteria 1385
33 Ga0070670_101046580 3300005331 Bacteria 743
34 Ga0070677_10360072 3300005333 Bacteria 756
35 Ga0068869_100000014 3300005334 Bacteria 73206
36 Ga0070666_10233636 3300005335 Bacteria 1299
37 Ga0070680_100028390 3300005336 Bacteria 4487
38 Ga0070680_100123898 3300005336 Bacteria 2159
39 Ga0070680_100163421 3300005336 Bacteria 1871
40 Ga0068868_100000015 3300005338 Bacteria 104058
41 Ga0068868_100006236 3300005338 Bacteria 8440
42 Ga0070660_100000654 3300005339 Bacteria 22931
43 Ga0070660_100009011 3300005339 Bacteria 7001
44 Ga0070660_100010042 3300005339 Bacteria 6677
45 Ga0070660_100068975 3300005339 Bacteria 2757
46 Ga0070660_100128450 3300005339 Bacteria 2027
47 Ga0070660_100324219 3300005339 Bacteria 1266
48 Ga0070660_100872809 3300005339 Bacteria 758
49 Ga0070691_10154098 3300005341 Bacteria 1180
50 Ga0070687_100699328 3300005343 Bacteria 708
51 Ga0070661_100061242 3300005344 Bacteria 2762
52 Ga0070661_100201912 3300005344 Bacteria 1519
53 Ga0070661_100286181 3300005344 Bacteria 1280
54 Ga0070661_100368945 3300005344 Bacteria 1130
55 Ga0070661_100379824 3300005344 Bacteria 1113
56 Ga0070661_100520400 3300005344 Bacteria 954
57 Ga0070661_100782192 3300005344 Unclassified 782
58 Ga0070692_10004362 3300005345 Bacteria 5897
59 Ga0070668_100000027 3300005347 Bacteria 89913
60 Ga0070668_100000068 3300005347 Bacteria 64209
61 Ga0070668_100160853 3300005347 Bacteria 1822
62 Ga0070668_100200628 3300005347 Bacteria 1638
63 Ga0070668_100581268 3300005347 Bacteria 978
64 Ga0070669_100000047 3300005353 Bacteria 118892
65 Ga0070669_100027253 3300005353 Bacteria 4112
66 Ga0070669_101369803 3300005353 Bacteria 613
67 Ga0070675_100008377 3300005354 Bacteria 8022
68 Ga0070671_100000733 3300005355 Bacteria 23484
69 Ga0070671_100001270 3300005355 Bacteria 18917
70 Ga0070671_100013227 3300005355 Bacteria 6649
71 Ga0070671_100027080 3300005355 Bacteria 4716
72 Ga0070671_100336722 3300005355 Bacteria 1287
73 Ga0070671_100408577 3300005355 Bacteria 1162
74 Ga0070671_101555519 3300005355 Bacteria 586
75 Ga0070674_100023488 3300005356 Bacteria 3992
76 Ga0070673_100000039 3300005364 Bacteria 54634
77 Ga0070673_100169051 3300005364 Bacteria 1865
78 Ga0070659_100011451 3300005366 Bacteria 6562
79 Ga0070659_100057749 3300005366 Bacteria 3060
80 Ga0070659_100079767 3300005366 Bacteria 2613
81 Ga0070659_100094161 3300005366 Bacteria 2405
82 Ga0070659_100154902 3300005366 Bacteria 1871
83 Ga0070659_100335150 3300005366 Bacteria 1267
84 Ga0070659_100477874 3300005366 Bacteria 1060
85 Ga0070659_100537303 3300005366 Unclassified 1000
86 Ga0070659_100593982 3300005366 Bacteria 951
87 Ga0070667_100000017 3300005367 Bacteria 230531
88 Ga0070667_100000066 3300005367 Bacteria 134529
89 Ga0070667_100000480 3300005367 Bacteria 40910
90 Ga0070667_100003468 3300005367 Bacteria 13431
91 Ga0070667_100057508 3300005367 Bacteria 3287
92 Ga0070667_100071420 3300005367 Bacteria 2956
93 Ga0070667_100499856 3300005367 Bacteria 1114
94 Ga0070714_100567764 3300005435 Unclassified 1087
95 Ga0070663_100021579 3300005455 Bacteria 4286
96 Ga0070663_100043725 3300005455 Bacteria 3154
97 Ga0070663_100081048 3300005455 Bacteria 2385
98 Ga0070663_100277479 3300005455 Bacteria 1334
99 Ga0070663_100666083 3300005455 Bacteria 882
100 Ga0070678_100053091 3300005456 Bacteria 2946
101 Ga0070662_100018199 3300005457 Bacteria 4749
102 Ga0070662_100029571 3300005457 Bacteria 3825
103 Ga0070662_100057409 3300005457 Bacteria 2828
104 Ga0070662_100094197 3300005457 Bacteria 2254
105 Ga0070662_100859763 3300005457 Bacteria 773
106 Ga0070662_101408769 3300005457 Bacteria 600
107 Ga0070681_10217812 3300005458 Bacteria 1825
108 Ga0068867_100000008 3300005459 Bacteria 143488
109 Ga0068867_100621992 3300005459 Bacteria 944
110 Ga0070679_100181338 3300005530 Bacteria 2078
111 Ga0070679_100219252 3300005530 Bacteria 1864
112 Ga0070684_100094891 3300005535 Bacteria 2658
113 Ga0068853_100006948 3300005539 Bacteria 9038
114 Ga0068853_100016726 3300005539 Bacteria 6040
115 Ga0068853_100051519 3300005539 Bacteria 3543
116 Ga0068853_100342589 3300005539 Bacteria 1389
117 Ga0068853_100354478 3300005539 Bacteria 1365
118 Ga0068853_100883284 3300005539 Bacteria 858
119 Ga0070672_100069674 3300005543 Bacteria 2793
120 Ga0070672_100283048 3300005543 Bacteria 1402
121 Ga0070695_100181596 3300005545 Bacteria 1491
122 Ga0070696_100169946 3300005546 Bacteria 1611
123 Ga0070693_100144489 3300005547 Bacteria 1501
124 Ga0070665_100181392 3300005548 Bacteria 2106
125 Ga0068855_100115457 3300005563 Bacteria 3078
126 Ga0068855_100714899 3300005563 Bacteria 1071
127 Ga0070664_100103421 3300005564 Bacteria 2479
128 Ga0070664_100248837 3300005564 Bacteria 1597
129 Ga0070664_101007583 3300005564 Bacteria 783
130 Ga0070664_101733201 3300005564 Bacteria 592
131 Ga0068857_100308781 3300005577 Bacteria 1459
132 Ga0068857_100393493 3300005577 Bacteria 1289
133 Ga0068857_100807164 3300005577 Bacteria 896
134 Ga0068854_100000808 3300005578 Bacteria 18660
135 Ga0068854_100001210 3300005578 Bacteria 15469
136 Ga0068854_100001591 3300005578 Bacteria 13812
137 Ga0068854_100063731 3300005578 Bacteria 2676
138 Ga0068854_100268116 3300005578 Bacteria 1370
139 Ga0068856_100007687 3300005614 Bacteria 10517
140 Ga0068856_100027683 3300005614 Bacteria 5530
141 Ga0068856_100326253 3300005614 Bacteria 1553
142 Ga0068856_100407246 3300005614 Bacteria 1380
143 Ga0068856_101033678 3300005614 Unclassified 840
144 Ga0068856_102206561 3300005614 Unclassified 559
145 Ga0068852_100001982 3300005616 Bacteria 13963
146 Ga0068852_100002908 3300005616 Bacteria 11893
147 Ga0068852_100251862 3300005616 Bacteria 1692
148 Ga0068852_100859485 3300005616 Bacteria 923
149 Ga0068859_100006146 3300005617 Bacteria 12204
150 Ga0068859_100027157 3300005617 Bacteria 5743
151 Ga0068859_100100876 3300005617 Bacteria 2943
152 Ga0068859_100323019 3300005617 Bacteria 1637
153 Ga0068859_101752741 3300005617 Bacteria 686
154 Ga0068864_100000036 3300005618 Bacteria 189811
155 Ga0068864_100001696 3300005618 Bacteria 18112
156 Ga0068864_100043324 3300005618 Bacteria 3854
157 Ga0068866_10067132 3300005718 Bacteria 1882
158 Ga0068861_100115502 3300005719 Bacteria 2157
159 Ga0068863_100000001 3300005841 Bacteria 581116
160 Ga0068863_100000603 3300005841 Bacteria 36544
161 Ga0068863_100002760 3300005841 Bacteria 17396
162 Ga0068863_100111214 3300005841 Bacteria 2609
163 Ga0068863_100207199 3300005841 Bacteria 1888
164 Ga0068863_100541855 3300005841 Bacteria 1148
165 Ga0068858_100000103 3300005842 Bacteria 88754
166 Ga0068858_100118980 3300005842 Bacteria 2469
167 Ga0068860_100000013 3300005843 Bacteria 323055
168 Ga0068860_100000056 3300005843 Bacteria 202751
169 Ga0068860_100204098 3300005843 Bacteria 1916
170 Ga0068860_100415704 3300005843 Bacteria 1332
171 Ga0068862_100000033 3300005844 Bacteria 176515
172 Ga0068862_100000520 3300005844 Bacteria 40702
173 Ga0068862_100005609 3300005844 Bacteria 10490
174 Ga0068862_100053073 3300005844 Bacteria 3469
175 Ga0068862_100101913 3300005844 Bacteria 2512
176 Ga0068862_100376760 3300005844 Bacteria 1323
177 Ga0068862_100586757 3300005844 Bacteria 1068
178 Ga0075364_10085481 3300006051 Bacteria 2089
179 Ga0075366_10185821 3300006195 Bacteria 1263
180 Ga0075366_10224421 3300006195 Bacteria 1145
181 Ga0097621_100145548 3300006237 Bacteria 2028
182 Ga0075370_10098188 3300006353 Bacteria 1693
183 Ga0075370_10701837 3300006353 Bacteria 615
184 Ga0068871_100217140 3300006358 Bacteria 1655
185 Ga0075428_100756169 3300006844 Bacteria 1034
186 Ga0068865_100000036 3300006881 Bacteria 82943
187 Ga0097620_100006146 3300006931 Bacteria 12204
188 Ga0097620_100027157 3300006931 Bacteria 5743
189 Ga0097620_100100880 3300006931 Bacteria 2943
190 Ga0097620_100323021 3300006931 Bacteria 1637
191 Ga0097620_101752591 3300006931 Bacteria 686
192 Ga0105240_10013600 3300009093 Bacteria 11164
193 Ga0105240_10505763 3300009093 Bacteria 1343
194 Ga0105240_10998969 3300009093 Unclassified 895
195 Ga0105245_10010996 3300009098 Bacteria 7876
196 Ga0105245_10016123 3300009098 Bacteria 6511
197 Ga0105243_10000290 3300009148 Bacteria 55415
198 Ga0105241_10167494 3300009174 Bacteria 1812
199 Ga0105241_10953030 3300009174 Bacteria 800
200 Ga0105242_10003550 3300009176 Bacteria 12123
201 Ga0105248_10000091 3300009177 Bacteria 101191
202 Ga0105248_10003858 3300009177 Bacteria 16588
203 Ga0105248_10368116 3300009177 Bacteria 1618
204 Ga0105237_12090297 3300009545 Bacteria 575
205 Ga0105238_10017742 3300009551 Bacteria 7236
206 Ga0105238_10114763 3300009551 Bacteria 2672
207 Ga0105238_10115127 3300009551 Bacteria 2668
208 Ga0105238_10693096 3300009551 Bacteria 1030
209 Ga0105238_11004399 3300009551 Unclassified 855
210 Ga0105249_10057140 3300009553 Bacteria 3573
211 Ga0105249_10220261 3300009553 Bacteria 1867
212 Ga0105249_12275809 3300009553 Unclassified 615
213 Ga0105239_10032585 3300010375 Bacteria 5726
214 Ga0105239_10096445 3300010375 Bacteria 3267
215 Ga0105239_11170312 3300010375 Bacteria 886
216 Ga0105246_10022819 3300011119 Bacteria 4044
217 Ga0157326_1003394 3300012513 Bacteria 1678
218 Ga0157373_10026015 3300013100 Bacteria 4229
219 Ga0157373_10150007 3300013100 Bacteria 1640
220 Ga0157373_10161709 3300013100 Bacteria 1575
221 Ga0157373_10455722 3300013100 Bacteria 921
222 Ga0157373_10487527 3300013100 Bacteria 890
223 Ga0157373_10490718 3300013100 Bacteria 887
224 Ga0157371_10083890 3300013102 Bacteria 2256
225 Ga0157371_10119437 3300013102 Bacteria 1874
226 Ga0157371_10152929 3300013102 Bacteria 1646
227 Ga0157371_10550349 3300013102 Bacteria 855
228 Ga0157370_10013287 3300013104 Bacteria 8486
229 Ga0157370_10212075 3300013104 Bacteria 1795
230 Ga0157369_10042310 3300013105 Bacteria 4970
231 Ga0157369_10095993 3300013105 Bacteria 3163
232 Ga0157369_10240599 3300013105 Unclassified 1891
233 Ga0157369_11183459 3300013105 Bacteria 780
234 Ga0157369_11263534 3300013105 Bacteria 753
235 Ga0157369_11322393 3300013105 Bacteria 734
236 Ga0157369_11933058 3300013105 Bacteria 599
237 Ga0157374_10006908 3300013296 Bacteria 9651
238 Ga0157374_10124209 3300013296 Bacteria 2493
239 Ga0157374_10144523 3300013296 Bacteria 2310
240 Ga0157378_10007766 3300013297 Bacteria 9364
241 Ga0163162_10086025 3300013306 Bacteria 3221
242 Ga0163162_10968870 3300013306 Bacteria 961
243 Ga0157372_10004497 3300013307 Bacteria 14871
244 Ga0157372_10076468 3300013307 Bacteria 3780
245 Ga0157372_10112123 3300013307 Bacteria 3125
246 Ga0157372_10173347 3300013307 Bacteria 2496
247 Ga0157372_10176686 3300013307 Bacteria 2471
248 Ga0157375_10007663 3300013308 Bacteria 9445
249 Ga0157375_10030428 3300013308 Bacteria 5091
250 Ga0157375_11259124 3300013308 Bacteria 869
251 Ga0157380_10000217 3300014326 Bacteria 34251
252 Ga0157379_12350917 3300014968 Unclassified 531
253 Ga0157376_10000033 3300014969 Bacteria 163952
254 Ga0163161_10905376 3300017792 Bacteria 748
255 Ga0206353_11696242 3300020082 Bacteria 1415
256 Ga0213876_10032858 3300021384 Bacteria 2735
257 Ga0207656_10247098 3300025321 Bacteria 873
258 Ga0207642_10040120 3300025899 Bacteria 2040
259 Ga0207688_10449492 3300025901 Bacteria 803
260 Ga0207680_10105261 3300025903 Bacteria 1820
261 Ga0207647_10001041 3300025904 Bacteria 21470
262 Ga0207647_10005846 3300025904 Bacteria 8972
263 Ga0207647_10007479 3300025904 Bacteria 7891
264 Ga0207647_10172251 3300025904 Bacteria 1260
265 Ga0207647_10299351 3300025904 Bacteria 916
266 Ga0207645_10002984 3300025907 Bacteria 13077
267 Ga0207645_10072233 3300025907 Bacteria 2208
268 Ga0207645_10114610 3300025907 Bacteria 1747
269 Ga0207705_10000002 3300025909 Bacteria 2046852
270 Ga0207705_10000027 3300025909 Bacteria 248863
271 Ga0207705_10607824 3300025909 Bacteria 850
272 Ga0207707_10369865 3300025912 Bacteria 1233
273 Ga0207707_10402429 3300025912 Bacteria 1175
274 Ga0207671_11012775 3300025914 Bacteria 654
275 Ga0207660_10301744 3300025917 Bacteria 1275
276 Ga0207657_10000589 3300025919 Bacteria 38460
277 Ga0207657_10004490 3300025919 Bacteria 14749
278 Ga0207657_10039877 3300025919 Bacteria 4168
279 Ga0207657_10115282 3300025919 Bacteria 2215
280 Ga0207657_10291673 3300025919 Bacteria 1294
281 Ga0207657_10323068 3300025919 Bacteria 1220
282 Ga0207657_10699472 3300025919 Unclassified 787
283 Ga0207657_11479358 3300025919 Bacteria 508
284 Ga0207649_10177027 3300025920 Bacteria 1490
285 Ga0207649_10295903 3300025920 Unclassified 1182
286 Ga0207649_10431469 3300025920 Bacteria 991
287 Ga0207649_10587301 3300025920 Bacteria 856
288 Ga0207649_10681183 3300025920 Unclassified 796
289 Ga0207652_10055328 3300025921 Bacteria 3412
290 Ga0207652_10319354 3300025921 Bacteria 1402
291 Ga0207681_10000014 3300025923 Bacteria 353422
292 Ga0207681_10016823 3300025923 Bacteria 4584
293 Ga0207681_10017568 3300025923 Bacteria 4494
294 Ga0207681_10160266 3300025923 Bacteria 1695
295 Ga0207681_10762549 3300025923 Bacteria 807
296 Ga0207694_10021464 3300025924 Bacteria 4893
297 Ga0207694_10218536 3300025924 Bacteria 1554
298 Ga0207650_10000015 3300025925 Bacteria 369173
299 Ga0207650_10015922 3300025925 Bacteria 5246
300 Ga0207650_10873677 3300025925 Unclassified 763
301 Ga0207659_10005527 3300025926 Bacteria 7667
302 Ga0207659_11123998 3300025926 Bacteria 676
303 Ga0207687_10005287 3300025927 Bacteria 8555
304 Ga0207644_10000352 3300025931 Bacteria 29800
305 Ga0207644_10000574 3300025931 Bacteria 23595
306 Ga0207644_10035012 3300025931 Bacteria 3516
307 Ga0207644_10044425 3300025931 Bacteria 3157
308 Ga0207644_10896369 3300025931 Bacteria 743
309 Ga0207690_10006916 3300025932 Bacteria 6724
310 Ga0207690_10021927 3300025932 Bacteria 3968
311 Ga0207690_10037194 3300025932 Bacteria 3159
312 Ga0207690_10060331 3300025932 Bacteria 2574
313 Ga0207690_10132968 3300025932 Bacteria 1823
314 Ga0207690_10228720 3300025932 Bacteria 1426
315 Ga0207690_10479537 3300025932 Bacteria 1004
316 Ga0207690_10489157 3300025932 Bacteria 994
317 Ga0207690_10840216 3300025932 Bacteria 760
318 Ga0207706_10011036 3300025933 Bacteria 8235
319 Ga0207706_10012682 3300025933 Bacteria 7670
320 Ga0207706_10024933 3300025933 Bacteria 5361
321 Ga0207706_10215925 3300025933 Bacteria 1680
322 Ga0207706_10468648 3300025933 Bacteria 1089
323 Ga0207706_10830479 3300025933 Bacteria 783
324 Ga0207706_10843927 3300025933 Bacteria 776
325 Ga0207686_10003646 3300025934 Bacteria 8251
326 Ga0207709_10000102 3300025935 Bacteria 132562
327 Ga0207669_10068618 3300025937 Bacteria 2215
328 Ga0207704_10000014 3300025938 Bacteria 164052
329 Ga0207691_10015474 3300025940 Bacteria 7252
330 Ga0207711_10000252 3300025941 Bacteria 57840
331 Ga0207711_10007874 3300025941 Bacteria 8913
332 Ga0207711_10063974 3300025941 Bacteria 3176
333 Ga0207689_10001559 3300025942 Bacteria 21725
334 Ga0207689_10576720 3300025942 Bacteria 946
335 Ga0207661_10408400 3300025944 Bacteria 1232
336 Ga0207661_10466002 3300025944 Bacteria 1152
337 Ga0207679_10091711 3300025945 Bacteria 2352
338 Ga0207679_10450622 3300025945 Bacteria 1141
339 Ga0207679_10541027 3300025945 Bacteria 1044
340 Ga0207667_10010487 3300025949 Bacteria 10832
341 Ga0207667_10497246 3300025949 Bacteria 1237
342 Ga0207667_10619592 3300025949 Bacteria 1090
343 Ga0207651_10000015 3300025960 Bacteria 164178
344 Ga0207712_10067119 3300025961 Bacteria 2566
345 Ga0207712_10067835 3300025961 Bacteria 2554
346 Ga0207712_10138016 3300025961 Bacteria 1867
347 Ga0207712_11184235 3300025961 Bacteria 681
348 Ga0207668_10000012 3300025972 Bacteria 182541
349 Ga0207668_10000860 3300025972 Bacteria 18295
350 Ga0207668_10122941 3300025972 Bacteria 1968
351 Ga0207640_10001247 3300025981 Bacteria 13862
352 Ga0207640_10091573 3300025981 Bacteria 2107
353 Ga0207640_10155802 3300025981 Bacteria 1684
354 Ga0207640_10160483 3300025981 Bacteria 1663
355 Ga0207658_10000011 3300025986 Bacteria 239620
356 Ga0207658_10000132 3300025986 Bacteria 80078
357 Ga0207658_10002473 3300025986 Bacteria 13492
358 Ga0207658_10021469 3300025986 Bacteria 4483
359 Ga0207658_10042716 3300025986 Bacteria 3290
360 Ga0207658_10416730 3300025986 Bacteria 1183
361 Ga0207658_10841936 3300025986 Bacteria 834
362 Ga0207677_10000062 3300026023 Bacteria 92263
363 Ga0207677_10002143 3300026023 Bacteria 10373
364 Ga0207703_10004987 3300026035 Bacteria 10774
365 Ga0207703_10227333 3300026035 Bacteria 1671
366 Ga0207639_10011893 3300026041 Bacteria 6054
367 Ga0207639_10389253 3300026041 Bacteria 1254
368 Ga0207639_10456947 3300026041 Bacteria 1160
369 Ga0207639_11015288 3300026041 Bacteria 777
370 Ga0207639_11798190 3300026041 Bacteria 573
371 Ga0207678_10003150 3300026067 Bacteria 14918
372 Ga0207678_10032283 3300026067 Bacteria 4563
373 Ga0207678_10047022 3300026067 Bacteria 3732
374 Ga0207678_10152379 3300026067 Bacteria 1974
375 Ga0207678_10344288 3300026067 Unclassified 1285
376 Ga0207678_10374805 3300026067 Bacteria 1230
377 Ga0207702_10136367 3300026078 Bacteria 2215
378 Ga0207702_10283800 3300026078 Bacteria 1566
379 Ga0207702_10463119 3300026078 Bacteria 1232
380 Ga0207702_11632364 3300026078 Bacteria 638
381 Ga0207702_12251204 3300026078 Unclassified 533
382 Ga0207641_10000001 3300026088 Bacteria 1180841
383 Ga0207641_10001074 3300026088 Bacteria 27484
384 Ga0207641_10002229 3300026088 Bacteria 18169
385 Ga0207641_10014310 3300026088 Bacteria 6501
386 Ga0207641_10062752 3300026088 Bacteria 3172
387 Ga0207641_10182300 3300026088 Bacteria 1924
388 Ga0207648_10000014 3300026089 Bacteria 163862
389 Ga0207676_10000021 3300026095 Bacteria 296572
390 Ga0207676_10001148 3300026095 Bacteria 19958
391 Ga0207674_10004695 3300026116 Bacteria 16389
392 Ga0207674_10013992 3300026116 Bacteria 8871
393 Ga0207674_10213536 3300026116 Bacteria 1878
394 Ga0207674_10502298 3300026116 Bacteria 1172
395 Ga0207675_100004785 3300026118 Bacteria 13038
396 Ga0207675_100241300 3300026118 Bacteria 1746
397 Ga0207675_100863737 3300026118 Bacteria 920
398 Ga0207698_10000219 3300026142 Bacteria 35572
399 Ga0207698_10003278 3300026142 Bacteria 9725
400 Ga0207698_10153486 3300026142 Bacteria 2003
401 Ga0207698_10178348 3300026142 Bacteria 1879
402 Ga0207698_11118539 3300026142 Unclassified 801
403 Ga0207698_11627372 3300026142 Bacteria 661
404 Ga0268266_10061141 3300028379 Bacteria 3248
405 Ga0268265_10000013 3300028380 Bacteria 341536
406 Ga0268265_10003988 3300028380 Bacteria 10393
407 Ga0268265_10033833 3300028380 Bacteria 3720
408 Ga0268265_10063221 3300028380 Bacteria 2847
409 Ga0268265_10074933 3300028380 Bacteria 2649
410 Ga0268265_10315057 3300028380 Bacteria 1414
411 Ga0268264_10000039 3300028381 Bacteria 376641
412 Ga0268264_10000089 3300028381 Bacteria 234760
413 Ga0268264_10093188 3300028381 Bacteria 2602
414 Ga0268264_10225287 3300028381 Bacteria 1728
415 Ga0268264_10512062 3300028381 Bacteria 1172
416 Ga0268264_10518621 3300028381 Unclassified 1165
417 Ga0268264_10949961 3300028381 Bacteria 865
418 Ga0316177_1048219 3300030731 Bacteria 905
419 Ga0307408_100089775 3300031548 Bacteria 2317
420 Ga0307408_100291393 3300031548 Bacteria 1363
421 Ga0307405_10085110 3300031731 Bacteria 2077
422 Ga0307405_10427606 3300031731 Bacteria 1044
423 Ga0307405_10716567 3300031731 Bacteria 830
424 Ga0307405_11970941 3300031731 Bacteria 522
425 Ga0307413_10013879 3300031824 Bacteria 4071
426 Ga0307413_10066132 3300031824 Bacteria 2255
427 Ga0307413_10586675 3300031824 Unclassified 910
428 Ga0307413_10834349 3300031824 Bacteria 777
429 Ga0307413_11598243 3300031824 Unclassified 579
430 Ga0307410_10018420 3300031852 Bacteria 4220
431 Ga0307410_10072582 3300031852 Bacteria 2390
432 Ga0307410_10145777 3300031852 Bacteria 1757
433 Ga0307410_10603546 3300031852 Bacteria 916
434 Ga0307406_11256733 3300031901 Bacteria 645
435 Ga0307407_10711187 3300031903 Bacteria 757
436 Ga0307412_10016083 3300031911 Bacteria 4447
437 Ga0307412_10029610 3300031911 Bacteria 3438
438 Ga0307412_10207025 3300031911 Bacteria 1494
439 Ga0307412_10241415 3300031911 Bacteria 1397
440 Ga0307412_10498066 3300031911 Bacteria 1014
441 Ga0307412_11138505 3300031911 Bacteria 696
442 Ga0307412_11769937 3300031911 Bacteria 568
443 Ga0307409_100004160 3300031995 Bacteria 8059
444 Ga0307409_100099594 3300031995 Bacteria 2407
445 Ga0307414_10080961 3300032004 Bacteria 2376
446 Ga0307414_10235392 3300032004 Bacteria 1513
447 Ga0307414_10249002 3300032004 Bacteria 1476
448 Ga0307414_10481082 3300032004 Bacteria 1095
449 Ga0307414_10571509 3300032004 Unclassified 1010
450 Ga0307414_10789327 3300032004 Bacteria 865
451 Ga0307414_10997833 3300032004 Bacteria 770
452 Ga0307411_10030476 3300032005 Bacteria 3307
453 Ga0307411_10085251 3300032005 Bacteria 2187
454 Ga0307411_10156127 3300032005 Bacteria 1702
455 Ga0307415_100053649 3300032126 Bacteria 2748
456 Ga0307415_100183388 3300032126 Bacteria 1644
457 Ga0307415_101310026 3300032126 Bacteria 686
458 Ga0373961_0328416 3300035241 Bacteria 572
459 Ga0373931_1008996 3300035691 Unclassified 563
460 Ga0395899_0301252 3300037312 Bacteria 1084
461 Ga0395899_0700020 3300037312 Bacteria 635
462 Ga0395900_0056681 3300037418 Bacteria 4033
463 Ga0395900_0064371 3300037418 Bacteria 3768
464 Ga0395900_0138403 3300037418 Bacteria 2494
465 Ga0395900_0191342 3300037418 Bacteria 2075
466 Ga0395900_0295943 3300037418 Bacteria 1606
467 Ga0395900_0329843 3300037418 Bacteria 1504
468 Ga0395900_0553324 3300037418 Bacteria 1095
469 Ga0395900_0665424 3300037418 Bacteria 977
470 Ga0395900_0702024 3300037418 Bacteria 945
471 Ga0395900_0731276 3300037418 Unclassified 921
472 Ga0395900_0955186 3300037418 Unclassified 778
473 Ga0395898_0127127 3300037466 Bacteria 2442
474 Ga0395898_0839670 3300037466 Bacteria 858
475 Ga0395898_1142529 3300037466 Bacteria 711
476 Ga0395905_0001695 3300037471 Bacteria 25987
477 Ga0395905_0002087 3300037471 Bacteria 22724
478 Ga0395905_0005056 3300037471 Bacteria 13581
479 Ga0395905_0015780 3300037471 Bacteria 7176
480 Ga0395905_0023084 3300037471 Bacteria 5881
481 Ga0395905_0042593 3300037471 Bacteria 4260
482 Ga0395905_0055718 3300037471 Bacteria 3700
483 Ga0395905_0086809 3300037471 Bacteria 2933
484 Ga0395905_0098874 3300037471 Bacteria 2740
485 Ga0395905_0188336 3300037471 Bacteria 1936
486 Ga0395905_0199826 3300037471 Bacteria 1874
487 Ga0395905_0219589 3300037471 Bacteria 1779
488 Ga0395905_0237940 3300037471 Bacteria 1702
489 Ga0395905_0552669 3300037471 Unclassified 1052
490 Ga0395905_0615265 3300037471 Bacteria 988
491 Ga0395905_0802263 3300037471 Bacteria 844
492 Ga0395905_1641161 3300037471 Bacteria 548
493 Ga0395901_0014144 3300038443 Bacteria 8124
494 Ga0395901_0118480 3300038443 Bacteria 2782
495 Ga0395901_0336322 3300038443 Bacteria 1560
496 Ga0395901_0396515 3300038443 Bacteria 1418
497 Ga0395901_0430888 3300038443 Bacteria 1351
498 Ga0395901_0513453 3300038443 Bacteria 1218
499 Ga0395901_0672331 3300038443 Bacteria 1036
500 Ga0395901_1462447 3300038443 Bacteria 640
501 Ga0436365_0511741 3300039437 Bacteria 4102
502 Ga0451806_639614 3300041462 Bacteria 1917
503 Ga0451807_1483067 3300041486 Bacteria 1761
504 Ga0451839_0002752 3300041496 Bacteria 659
505 Ga0451845_0811241 3300041501 Bacteria 1684
506 Ga0451849_0347419 3300041505 Bacteria 628
507 Ga0439445_0120037 3300042004 Bacteria 754
508 Ga0439448_0000586 3300042005 Bacteria 8542
509 Ga0439448_0011584 3300042005 Bacteria 2629
510 Ga0439448_0035421 3300042005 Bacteria 1598
511 Ga0439448_0051742 3300042005 Unclassified 1345
512 Ga0439455_0000235 3300042012 Bacteria 6615
513 Ga0439455_0005590 3300042012 Bacteria 2560
514 Ga0439455_0022539 3300042012 Bacteria 1510
515 Ga0439455_0086093 3300042012 Bacteria 858
516 Ga0450923_062512 3300042125 Bacteria 814
517 Ga0439458_0002431 3300042157 Bacteria 4548
518 Ga0439458_0003898 3300042157 Bacteria 3449
519 Ga0439458_0007698 3300042157 Bacteria 2399
520 Ga0466972_0032882 3300044658 Bacteria 2545
521 Ga0466972_0239772 3300044658 Bacteria 848
522 Ga0466972_0290349 3300044658 Bacteria 764
523 Ga0466965_0088076 3300044683 Bacteria 1576
524 Ga0466965_0197923 3300044683 Bacteria 1065
525 Ga0466966_0066459 3300044684 Bacteria 2266
526 Ga0466961_0050831 3300044693 Bacteria 2647
527 Ga0466961_0132881 3300044693 Bacteria 1559
528 Ga0466961_0585440 3300044693 Bacteria 671
529 Ga0466963_0007655 3300044694 Bacteria 6448
530 Ga0466963_0213591 3300044694 Bacteria 1350
531 Ga0466964_0019508 3300044706 Bacteria 2606
532 Ga0466964_0028140 3300044706 Bacteria 2212
533 Ga0466971_0010736 3300044719 Bacteria 4007
534 Ga0466971_0168210 3300044719 Bacteria 1028
535 Ga0466968_0027156 3300044735 Bacteria 2354
536 Ga0466970_0067257 3300044765 Bacteria 1924
537 Ga0466957_0035597 3300044842 Bacteria 2988
538 Ga0466957_0207386 3300044842 Bacteria 1289
539 Ga0466957_1352599 3300044842 Unclassified 518
540 Ga0466960_0091602 3300044901 Bacteria 1550
541 Ga0466960_0459784 3300044901 Bacteria 741
542 Ga0466959_0009647 3300045049 Bacteria 6869
543 Ga0466959_0057357 3300045049 Bacteria 2839
544 Ga0466958_0089777 3300045836 Bacteria 1900
545 Ga0466958_0125520 3300045836 Bacteria 1609
546 Ga0466958_0151364 3300045836 Bacteria 1463
547 Ga0466967_0111431 3300045976 Bacteria 2515
548 Ga0466967_0185789 3300045976 Bacteria 1963
549 Ga0466967_0269760 3300045976 Bacteria 1630
550 Ga0466967_0296862 3300045976 Bacteria 1554
551 Ga0495582_0463096 3300046473 Unclassified 732
552 Ga0495606_0074401 3300046507 Bacteria 2128
553 Ga0495663_0044561 3300046525 Bacteria 1358
554 Ga0495642_0032657 3300046528 Bacteria 2089
555 Ga0495642_0054383 3300046528 Bacteria 1651
556 Ga0495659_0143365 3300046664 Bacteria 955
557 Ga0495669_0007129 3300046684 Bacteria 4683
558 Ga0495669_0028764 3300046684 Bacteria 2435
559 Ga0495669_0318684 3300046684 Bacteria 750
560 Ga0495670_0099521 3300046691 Bacteria 1496
561 Ga0495683_0067188 3300047323 Bacteria 1765
562 Ga0495677_0014913 3300047445 Bacteria 2826
563 Ga0496100_0146154 3300048903 Bacteria 1681
564 Ga0496102_0188048 3300048905 Bacteria 1946
565 Ga0496105_0550222 3300048908 Bacteria 901
566 Ga0496106_0134864 3300048909 Bacteria 1938
567 Ga0496107_0214506 3300048910 Bacteria 1431
568 Ga0496112_0190678 3300048915 Bacteria 2012
569 Ga0496112_0588805 3300048915 Unclassified 1045
570 Ga0496112_1553730 3300048915 Unclassified 575
571 Ga0496113_1222969 3300048916 Bacteria 586
572 Ga0496114_0017195 3300048917 Bacteria 5833
573 Ga0496114_0043418 3300048917 Bacteria 3728
574 Ga0496115_0000335 3300048918 Bacteria 40051
575 Ga0496117_0021124 3300048920 Bacteria 5283
576 Ga0496117_0134416 3300048920 Bacteria 1493
577 Ga0496118_0018932 3300048921 Bacteria 6173
578 Ga0496118_0047592 3300048921 Bacteria 3321
579 Ga0496118_0073577 3300048921 Bacteria 2447
580 Ga0496120_0026371 3300048923 Bacteria 3589
581 Ga0496120_0298688 3300048923 Unclassified 738
582 Ga0496121_0054157 3300048924 Bacteria 3355
583 Ga0496122_0017193 3300048925 Bacteria 6779
584 Ga0496123_0015289 3300048926 Bacteria 6305
585 Ga0496124_0335254 3300048927 Bacteria 1077
586 Ga0496124_0375715 3300048927 Bacteria 996
587 Ga0496125_0016561 3300048928 Bacteria 7072
588 Ga0496126_0152879 3300048929 Bacteria 1977
589 Ga0501293_038738 3300049516 Unclassified 535
590 Ga0501298_011638 3300049521 Bacteria 1531
591 Ga0501299_083557 3300049522 Bacteria 714
592 Ga0501034_0417587 3300049571 Bacteria 1263
593 Ga0501034_0564600 3300049571 Bacteria 1046
594 Ga0501043_0017871 3300049579 Bacteria 5560
595 Ga0501046_0074643 3300049580 Bacteria 2631
596 Ga0501047_0003003 3300049581 Bacteria 16017
597 Ga0501068_0113526 3300049584 Bacteria 1686
598 Ga0501069_0090841 3300049585 Bacteria 1727
599 Ga0501227_064902 3300049665 Bacteria 941
600 Ga0501249_000162 3300049679 Bacteria 20650
601 Ga0501257_000079 3300049686 Bacteria 24588
602 Ga0501266_027002 3300049763 Bacteria 806
603 Ga0501035_0143214 3300049822 Bacteria 2077
604 nmdc:mga00v17_80378_c1 3300050491 Bacteria 2034
605 nmdc:mga00v17_842331_c1 3300050491 Bacteria 583
606 nmdc:mga0k408_283527_c1 3300050493 Bacteria 989
607 nmdc:mga07m45_92437_c1 3300050496 Bacteria 1734
608 Ga0500643_017689 3300053087 Bacteria 2382
609 Ga0500566_0075996 3300053094 Bacteria 1878
610 Ga0500566_0401646 3300053094 Bacteria 613
611 Ga0500616_0006790 3300053153 Bacteria 7411
612 Ga0466962_0012266 3300061719 Bacteria 4119
613 Ga0466962_0198566 3300061719 Bacteria 980
614 Ga0466962_0260320 3300061719 Bacteria 854
615 2643726842 2643221541 Bacteria 5498788
616 2644040753 2643221605 Bacteria 4772303
617 2644046117 2643221606 Bacteria 5588032
618 2644393072 2643221671 Bacteria 5496681
619 Ga0070692_10008845
620 JGI24736J21556_1004979
621 JGI24741J21665_1018108
622 JGI24740J21852_10115798
623 JGI24739J22299_10001228
624 JGI24737J22298_10010473
625 JGI24737J22298_10040196
626 JGI24735J21928_10001378
627 JGI24735J21928_10003986
628 JGI24735J21928_10014805
629 JGI24735J21928_10038163
630 JGI24738J21930_10000034
631 JGI24738J21930_10009234
632 JGI24738J21930_10125346
633 JGI24749J21850_1000556
634 JGI24744J21845_10002365
635 JGI24751J29686_10000052
636 JGI24751J29686_10005711
637 rootH1_10068420
638 rootH2_10238528
639 rootL2_10039164
640 rootL2_10158042
641 rootL2_10171994
642 Ga0070658_10000001
643 Ga0070658_10002836
644 Ga0070676_10000562
645 Ga0070676_10043555
646 Ga0070683_100247208
647 Ga0070670_100000024
648 Ga0070670_100004229
649 Ga0070670_100124836
650 Ga0070670_100308445
651 Ga0070670_101046580
652 Ga0070677_10360072
653 Ga0068869_100000014
654 Ga0070666_10233636
655 Ga0070680_100028390
656 Ga0070680_100123898
657 Ga0070680_100163421
658 Ga0068868_100000015
659 Ga0068868_100006236
660 Ga0070660_100000654
661 Ga0070660_100009011
662 Ga0070660_100010042
663 Ga0070660_100068975
664 Ga0070660_100128450
665 Ga0070660_100324219
666 Ga0070660_100872809
667 Ga0070691_10154098
668 Ga0070687_100699328
669 Ga0070661_100061242
670 Ga0070661_100201912
671 Ga0070661_100286181
672 Ga0070661_100368945
673 Ga0070661_100379824
674 Ga0070661_100520400
675 Ga0070661_100782192
676 Ga0070692_10004362
677 Ga0070668_100000027
678 Ga0070668_100000068
679 Ga0070668_100160853
680 Ga0070668_100200628
681 Ga0070668_100581268
682 Ga0070669_100000047
683 Ga0070669_100027253
684 Ga0070669_101369803
685 Ga0070675_100008377
686 Ga0070671_100000733
687 Ga0070671_100001270
688 Ga0070671_100013227
689 Ga0070671_100027080
690 Ga0070671_100336722
691 Ga0070671_100408577
692 Ga0070671_101555519
693 Ga0070674_100023488
694 Ga0070673_100000039
695 Ga0070673_100169051
696 Ga0070659_100011451
697 Ga0070659_100057749
698 Ga0070659_100079767
699 Ga0070659_100094161
700 Ga0070659_100154902
701 Ga0070659_100335150
702 Ga0070659_100477874
703 Ga0070659_100537303
704 Ga0070659_100593982
705 Ga0070667_100000017
706 Ga0070667_100000066
707 Ga0070667_100000480
708 Ga0070667_100003468
709 Ga0070667_100057508
710 Ga0070667_100071420
711 Ga0070667_100499856
712 Ga0070714_100567764
713 Ga0070663_100021579
714 Ga0070663_100043725
715 Ga0070663_100081048
716 Ga0070663_100277479
717 Ga0070663_100666083
718 Ga0070678_100053091
719 Ga0070662_100018199
720 Ga0070662_100029571
721 Ga0070662_100057409
722 Ga0070662_100094197
723 Ga0070662_100859763
724 Ga0070662_101408769
725 Ga0070681_10217812
726 Ga0068867_100000008
727 Ga0068867_100621992
728 Ga0070679_100181338
729 Ga0070679_100219252
730 Ga0070684_100094891
731 Ga0068853_100006948
732 Ga0068853_100016726
733 Ga0068853_100051519
734 Ga0068853_100342589
735 Ga0068853_100354478
736 Ga0068853_100883284
737 Ga0070672_100069674
738 Ga0070672_100283048
739 Ga0070695_100181596
740 Ga0070696_100169946
741 Ga0070693_100144489
742 Ga0070665_100181392
743 Ga0068855_100115457
744 Ga0068855_100714899
745 Ga0070664_100103421
746 Ga0070664_100248837
747 Ga0070664_101007583
748 Ga0070664_101733201
749 Ga0068857_100308781
750 Ga0068857_100393493
751 Ga0068857_100807164
752 Ga0068854_100000808
753 Ga0068854_100001210
754 Ga0068854_100001591
755 Ga0068854_100063731
756 Ga0068854_100268116
757 Ga0068856_100007687
758 Ga0068856_100027683
759 Ga0068856_100326253
760 Ga0068856_100407246
761 Ga0068856_101033678
762 Ga0068856_102206561
763 Ga0068852_100001982
764 Ga0068852_100002908
765 Ga0068852_100251862
766 Ga0068852_100859485
767 Ga0068859_100006146
768 Ga0068859_100027157
769 Ga0068859_100100876
770 Ga0068859_100323019
771 Ga0068859_101752741
772 Ga0068864_100000036
773 Ga0068864_100001696
774 Ga0068864_100043324
775 Ga0068866_10067132
776 Ga0068861_100115502
777 Ga0068863_100000001
778 Ga0068863_100000603
779 Ga0068863_100002760
780 Ga0068863_100111214
781 Ga0068863_100207199
782 Ga0068863_100541855
783 Ga0068858_100000103
784 Ga0068858_100118980
785 Ga0068860_100000013
786 Ga0068860_100000056
787 Ga0068860_100204098
788 Ga0068860_100415704
789 Ga0068862_100000033
790 Ga0068862_100000520
791 Ga0068862_100005609
792 Ga0068862_100053073
793 Ga0068862_100101913
794 Ga0068862_100376760
795 Ga0068862_100586757
796 Ga0075364_10085481
797 Ga0075366_10185821
798 Ga0075366_10224421
799 Ga0097621_100145548
800 Ga0075370_10098188
801 Ga0075370_10701837
802 Ga0068871_100217140
803 Ga0075428_100756169
804 Ga0068865_100000036
805 Ga0097620_100006146
806 Ga0097620_100027157
807 Ga0097620_100100880
808 Ga0097620_100323021
809 Ga0097620_101752591
810 Ga0105240_10013600
811 Ga0105240_10505763
812 Ga0105240_10998969
813 Ga0105245_10010996
814 Ga0105245_10016123
815 Ga0105243_10000290
816 Ga0105241_10167494
817 Ga0105241_10953030
818 Ga0105242_10003550
819 Ga0105248_10000091
820 Ga0105248_10003858
821 Ga0105248_10368116
822 Ga0105237_12090297
823 Ga0105238_10017742
824 Ga0105238_10114763
825 Ga0105238_10115127
826 Ga0105238_10693096
827 Ga0105238_11004399
828 Ga0105249_10057140
829 Ga0105249_10220261
830 Ga0105249_12275809
831 Ga0105239_10032585
832 Ga0105239_10096445
833 Ga0105239_11170312
834 Ga0105246_10022819
835 Ga0157326_1003394
836 Ga0157373_10026015
837 Ga0157373_10150007
838 Ga0157373_10161709
839 Ga0157373_10455722
840 Ga0157373_10487527
841 Ga0157373_10490718
842 Ga0157371_10083890
843 Ga0157371_10119437
844 Ga0157371_10152929
845 Ga0157371_10550349
846 Ga0157370_10013287
847 Ga0157370_10212075
848 Ga0157369_10042310
849 Ga0157369_10095993
850 Ga0157369_10240599
851 Ga0157369_11183459
852 Ga0157369_11263534
853 Ga0157369_11322393
854 Ga0157369_11933058
855 Ga0157374_10006908
856 Ga0157374_10124209
857 Ga0157374_10144523
858 Ga0157378_10007766
859 Ga0163162_10086025
860 Ga0163162_10968870
861 Ga0157372_10004497
862 Ga0157372_10076468
863 Ga0157372_10112123
864 Ga0157372_10173347
865 Ga0157372_10176686
866 Ga0157375_10007663
867 Ga0157375_10030428
868 Ga0157375_11259124
869 Ga0157380_10000217
870 Ga0157379_12350917
871 Ga0157376_10000033
872 Ga0163161_10905376
873 Ga0206353_11696242
874 Ga0213876_10032858
875 Ga0207656_10247098
876 Ga0207642_10040120
877 Ga0207688_10449492
878 Ga0207680_10105261
879 Ga0207647_10001041
880 Ga0207647_10005846
881 Ga0207647_10007479
882 Ga0207647_10172251
883 Ga0207647_10299351
884 Ga0207645_10002984
885 Ga0207645_10072233
886 Ga0207645_10114610
887 Ga0207705_10000002
888 Ga0207705_10000027
889 Ga0207705_10607824
890 Ga0207707_10369865
891 Ga0207707_10402429
892 Ga0207671_11012775
893 Ga0207660_10301744
894 Ga0207657_10000589
895 Ga0207657_10004490
896 Ga0207657_10039877
897 Ga0207657_10115282
898 Ga0207657_10291673
899 Ga0207657_10323068
900 Ga0207657_10699472
901 Ga0207657_11479358
902 Ga0207649_10177027
903 Ga0207649_10295903
904 Ga0207649_10431469
905 Ga0207649_10587301
906 Ga0207649_10681183
907 Ga0207652_10055328
908 Ga0207652_10319354
909 Ga0207681_10000014
910 Ga0207681_10016823
911 Ga0207681_10017568
912 Ga0207681_10160266
913 Ga0207681_10762549
914 Ga0207694_10021464
915 Ga0207694_10218536
916 Ga0207650_10000015
917 Ga0207650_10015922
918 Ga0207650_10873677
919 Ga0207659_10005527
920 Ga0207659_11123998
921 Ga0207687_10005287
922 Ga0207644_10000352
923 Ga0207644_10000574
924 Ga0207644_10035012
925 Ga0207644_10044425
926 Ga0207644_10896369
927 Ga0207690_10006916
928 Ga0207690_10021927
929 Ga0207690_10037194
930 Ga0207690_10060331
931 Ga0207690_10132968
932 Ga0207690_10228720
933 Ga0207690_10479537
934 Ga0207690_10489157
935 Ga0207690_10840216
936 Ga0207706_10011036
937 Ga0207706_10012682
938 Ga0207706_10024933
939 Ga0207706_10215925
940 Ga0207706_10468648
941 Ga0207706_10830479
942 Ga0207706_10843927
943 Ga0207686_10003646
944 Ga0207709_10000102
945 Ga0207669_10068618
946 Ga0207704_10000014
947 Ga0207691_10015474
948 Ga0207711_10000252
949 Ga0207711_10007874
950 Ga0207711_10063974
951 Ga0207689_10001559
952 Ga0207689_10576720
953 Ga0207661_10408400
954 Ga0207661_10466002
955 Ga0207679_10091711
956 Ga0207679_10450622
957 Ga0207679_10541027
958 Ga0207667_10010487
959 Ga0207667_10497246
960 Ga0207667_10619592
961 Ga0207651_10000015
962 Ga0207712_10067119
963 Ga0207712_10067835
964 Ga0207712_10138016
965 Ga0207712_11184235
966 Ga0207668_10000012
967 Ga0207668_10000860
968 Ga0207668_10122941
969 Ga0207640_10001247
970 Ga0207640_10091573
971 Ga0207640_10155802
972 Ga0207640_10160483
973 Ga0207658_10000011
974 Ga0207658_10000132
975 Ga0207658_10002473
976 Ga0207658_10021469
977 Ga0207658_10042716
978 Ga0207658_10416730
979 Ga0207658_10841936
980 Ga0207677_10000062
981 Ga0207677_10002143
982 Ga0207703_10004987
983 Ga0207703_10227333
984 Ga0207639_10011893
985 Ga0207639_10389253
986 Ga0207639_10456947
987 Ga0207639_11015288
988 Ga0207639_11798190
989 Ga0207678_10003150
990 Ga0207678_10032283
991 Ga0207678_10047022
992 Ga0207678_10152379
993 Ga0207678_10344288
994 Ga0207678_10374805
995 Ga0207702_10136367
996 Ga0207702_10283800
997 Ga0207702_10463119
998 Ga0207702_11632364
999 Ga0207702_12251204
1000 Ga0207641_10000001
1001 Ga0207641_10001074
1002 Ga0207641_10002229
1003 Ga0207641_10014310
1004 Ga0207641_10062752
1005 Ga0207641_10182300
1006 Ga0207648_10000014
1007 Ga0207676_10000021
1008 Ga0207676_10001148
1009 Ga0207674_10004695
1010 Ga0207674_10013992
1011 Ga0207674_10213536
1012 Ga0207674_10502298
1013 Ga0207675_100004785
1014 Ga0207675_100241300
1015 Ga0207675_100863737
1016 Ga0207698_10000219
1017 Ga0207698_10003278
1018 Ga0207698_10153486
1019 Ga0207698_10178348
1020 Ga0207698_11118539
1021 Ga0207698_11627372
1022 Ga0268266_10061141
1023 Ga0268265_10000013
1024 Ga0268265_10003988
1025 Ga0268265_10033833
1026 Ga0268265_10063221
1027 Ga0268265_10074933
1028 Ga0268265_10315057
1029 Ga0268264_10000039
1030 Ga0268264_10000089
1031 Ga0268264_10093188
1032 Ga0268264_10225287
1033 Ga0268264_10512062
1034 Ga0268264_10518621
1035 Ga0268264_10949961
1036 Ga0316177_1048219
1037 Ga0307408_100089775
1038 Ga0307408_100291393
1039 Ga0307405_10085110
1040 Ga0307405_10427606
1041 Ga0307405_10716567
1042 Ga0307405_11970941
1043 Ga0307413_10013879
1044 Ga0307413_10066132
1045 Ga0307413_10586675
1046 Ga0307413_10834349
1047 Ga0307413_11598243
1048 Ga0307410_10018420
1049 Ga0307410_10072582
1050 Ga0307410_10145777
1051 Ga0307410_10603546
1052 Ga0307406_11256733
1053 Ga0307407_10711187
1054 Ga0307412_10016083
1055 Ga0307412_10029610
1056 Ga0307412_10207025
1057 Ga0307412_10241415
1058 Ga0307412_10498066
1059 Ga0307412_11138505
1060 Ga0307412_11769937
1061 Ga0307409_100004160
1062 Ga0307409_100099594
1063 Ga0307414_10080961
1064 Ga0307414_10235392
1065 Ga0307414_10249002
1066 Ga0307414_10481082
1067 Ga0307414_10571509
1068 Ga0307414_10789327
1069 Ga0307414_10997833
1070 Ga0307411_10030476
1071 Ga0307411_10085251
1072 Ga0307411_10156127
1073 Ga0307415_100053649
1074 Ga0307415_100183388
1075 Ga0307415_101310026
1076 Ga0373961_0328416
1077 Ga0373931_1008996
1078 Ga0395899_0301252
1079 Ga0395899_0700020
1080 Ga0395900_0056681
1081 Ga0395900_0064371
1082 Ga0395900_0138403
1083 Ga0395900_0191342
1084 Ga0395900_0295943
1085 Ga0395900_0329843
1086 Ga0395900_0553324
1087 Ga0395900_0665424
1088 Ga0395900_0702024
1089 Ga0395900_0731276
1090 Ga0395900_0955186
1091 Ga0395898_0127127
1092 Ga0395898_0839670
1093 Ga0395898_1142529
1094 Ga0395905_0001695
1095 Ga0395905_0002087
1096 Ga0395905_0005056
1097 Ga0395905_0015780
1098 Ga0395905_0023084
1099 Ga0395905_0042593
1100 Ga0395905_0055718
1101 Ga0395905_0086809
1102 Ga0395905_0098874
1103 Ga0395905_0188336
1104 Ga0395905_0199826
1105 Ga0395905_0219589
1106 Ga0395905_0237940
1107 Ga0395905_0552669
1108 Ga0395905_0615265
1109 Ga0395905_0802263
1110 Ga0395905_1641161
1111 Ga0395901_0014144
1112 Ga0395901_0118480
1113 Ga0395901_0336322
1114 Ga0395901_0396515
1115 Ga0395901_0430888
1116 Ga0395901_0513453
1117 Ga0395901_0672331
1118 Ga0395901_1462447
1119 Ga0436365_0511741
1120 Ga0451806_639614
1121 Ga0451807_1483067
1122 Ga0451839_0002752
1123 Ga0451845_0811241
1124 Ga0451849_0347419
1125 Ga0439445_0120037
1126 Ga0439448_0000586
1127 Ga0439448_0011584
1128 Ga0439448_0035421
1129 Ga0439448_0051742
1130 Ga0439455_0000235
1131 Ga0439455_0005590
1132 Ga0439455_0022539
1133 Ga0439455_0086093
1134 Ga0450923_062512
1135 Ga0439458_0002431
1136 Ga0439458_0003898
1137 Ga0439458_0007698
1138 Ga0466972_0032882
1139 Ga0466972_0239772
1140 Ga0466972_0290349
1141 Ga0466965_0088076
1142 Ga0466965_0197923
1143 Ga0466966_0066459
1144 Ga0466961_0050831
1145 Ga0466961_0132881
1146 Ga0466961_0585440
1147 Ga0466963_0007655
1148 Ga0466963_0213591
1149 Ga0466964_0019508
1150 Ga0466964_0028140
1151 Ga0466971_0010736
1152 Ga0466971_0168210
1153 Ga0466968_0027156
1154 Ga0466970_0067257
1155 Ga0466957_0035597
1156 Ga0466957_0207386
1157 Ga0466957_1352599
1158 Ga0466960_0091602
1159 Ga0466960_0459784
1160 Ga0466959_0009647
1161 Ga0466959_0057357
1162 Ga0466958_0089777
1163 Ga0466958_0125520
1164 Ga0466958_0151364
1165 Ga0466967_0111431
1166 Ga0466967_0185789
1167 Ga0466967_0269760
1168 Ga0466967_0296862
1169 Ga0495582_0463096
1170 Ga0495606_0074401
1171 Ga0495663_0044561
1172 Ga0495642_0032657
1173 Ga0495642_0054383
1174 Ga0495659_0143365
1175 Ga0495669_0007129
1176 Ga0495669_0028764
1177 Ga0495669_0318684
1178 Ga0495670_0099521
1179 Ga0495683_0067188
1180 Ga0495677_0014913
1181 Ga0496100_0146154
1182 Ga0496102_0188048
1183 Ga0496105_0550222
1184 Ga0496106_0134864
1185 Ga0496107_0214506
1186 Ga0496112_0190678
1187 Ga0496112_0588805
1188 Ga0496112_1553730
1189 Ga0496113_1222969
1190 Ga0496114_0017195
1191 Ga0496114_0043418
1192 Ga0496115_0000335
1193 Ga0496117_0021124
1194 Ga0496117_0134416
1195 Ga0496118_0018932
1196 Ga0496118_0047592
1197 Ga0496118_0073577
1198 Ga0496120_0026371
1199 Ga0496120_0298688
1200 Ga0496121_0054157
1201 Ga0496122_0017193
1202 Ga0496123_0015289
1203 Ga0496124_0335254
1204 Ga0496124_0375715
1205 Ga0496125_0016561
1206 Ga0496126_0152879
1207 Ga0501293_038738
1208 Ga0501298_011638
1209 Ga0501299_083557
1210 Ga0501034_0417587
1211 Ga0501034_0564600
1212 Ga0501043_0017871
1213 Ga0501046_0074643
1214 Ga0501047_0003003
1215 Ga0501068_0113526
1216 Ga0501069_0090841
1217 Ga0501227_064902
1218 Ga0501249_000162
1219 Ga0501257_000079
1220 Ga0501266_027002
1221 Ga0501035_0143214
1222 nmdc:mga00v17_80378_c1
1223 nmdc:mga00v17_842331_c1
1224 nmdc:mga0k408_283527_c1
1225 nmdc:mga07m45_92437_c1
1226 Ga0500643_017689
1227 Ga0500566_0075996
1228 Ga0500566_0401646
1229 Ga0500616_0006790
1230 Ga0466962_0012266
1231 Ga0466962_0198566
1232 Ga0466962_0260320
1233 2643726842
1234 2644040753
1235 2644046117
1236 2644393072

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02367

TsaE

Threonylcarbamoyl adenosine biosynthesis protein TsaE

25

152

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mvr-assembly1.cif.gz_A crystal structure of bacillus subtilus ydib 0.9283 2 148
6n9a-assembly1.cif.gz_E-2 crystal structure of thermotoga maritima threonylcarbamoyladenosine biosynthesis complex tsab2d2e2 bound to atp and carboxy-amp 0.9106 2 148
5np9-assembly1.cif.gz_A crystal structure of bacillus subtilis ydib in complex with adp 0.9064 1 149
1fl9-assembly3.cif.gz_C the yjee protein 0.8698 1 147
6n9a-assembly1.cif.gz_E-2 crystal structure of thermotoga maritima threonylcarbamoyladenosine biosynthesis complex tsab2d2e2 bound to atp and carboxy-amp 0.8601 2 148
ID Description Score Start End Superfamily
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9134 2 148 3.40.50.300
af_Q2FWK9_1_139_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8949 15 148 3.40.50.300
af_P9WFS7_20_166_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8887 4 140 3.40.50.300
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8681 2 148 3.40.50.300
2xzoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8588 30 53 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3G2UZB2-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9819 6 149 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A537MGH8-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9806 6 153 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A5C6TY53-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9794 6 150 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A4P6FSB6-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.973 6 153 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A841J3K2-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9692 4 152 GO:0002949
GO:0005524
GO:0005737
GO:0016020

Map