F469708

General Info

Members Datasets Scaffolds Average Seq Length
618 304 1236 141

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100310146|Ga0070682_1003101461
Length 147
Sequence MAGLMAVELDHTFTTERALDDSYATTLDLERVVPCVEGASVLERTGPDSVRAEIKVKMGAMSMTFTGTLDITEQDPAAHRIVLTVKSKEAGGQGFANATIAFDLTEGGGNIHTSAQITGKAASMGEGVVIGVLDALIKDFAGKLSKL

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
160 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
161 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
162 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
163 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
198 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 11.81
Rhizosphere 87.06
Stem 0
Stem Tuber 0
Unclassified 15.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100310146 3300005337 Unclassified 1161
2 JGI24738J21930_10043301 3300002075 Bacteria 915
3 JGI24744J21845_10041472 3300002077 Bacteria 860
4 Ga0070683_100915640 3300005329 Unclassified 841
5 Ga0068869_100039228 3300005334 Bacteria 3380
6 Ga0070680_100301162 3300005336 Bacteria 1360
7 Ga0070682_100067762 3300005337 Bacteria 2274
8 Ga0070682_100103635 3300005337 Bacteria 1883
9 Ga0070682_100144629 3300005337 Bacteria 1625
10 Ga0070682_100792793 3300005337 Bacteria 769
11 Ga0068868_100001984 3300005338 Bacteria 14061
12 Ga0068868_100244086 3300005338 Bacteria 1510
13 Ga0068868_100387732 3300005338 Bacteria 1203
14 Ga0070660_100566607 3300005339 Bacteria 948
15 Ga0070689_100388487 3300005340 Bacteria 1177
16 Ga0070691_10021585 3300005341 Bacteria 2980
17 Ga0070687_100181424 3300005343 Bacteria 1261
18 Ga0070687_100821589 3300005343 Bacteria 660
19 Ga0070661_100180874 3300005344 Bacteria 1604
20 Ga0070661_101179276 3300005344 Bacteria 640
21 Ga0070692_10775944 3300005345 Bacteria 652
22 Ga0070668_100032709 3300005347 Bacteria 3957
23 Ga0070668_100053296 3300005347 Bacteria 3119
24 Ga0070671_100036727 3300005355 Bacteria 4063
25 Ga0070671_100208832 3300005355 Bacteria 1656
26 Ga0070674_100078634 3300005356 Bacteria 2351
27 Ga0070674_100483708 3300005356 Bacteria 1028
28 Ga0070674_100909307 3300005356 Bacteria 767
29 Ga0070674_101340220 3300005356 Unclassified 639
30 Ga0070673_100375818 3300005364 Bacteria 1266
31 Ga0070673_101128362 3300005364 Unclassified 733
32 Ga0070688_100063706 3300005365 Bacteria 2338
33 Ga0070688_100133969 3300005365 Bacteria 1675
34 Ga0070659_100388134 3300005366 Bacteria 1177
35 Ga0070659_100906133 3300005366 Bacteria 771
36 Ga0070659_101157847 3300005366 Bacteria 683
37 Ga0070667_100969395 3300005367 Bacteria 793
38 Ga0070714_100003099 3300005435 Bacteria 12346
39 Ga0070714_101682410 3300005435 Unclassified 620
40 Ga0070713_100041474 3300005436 Bacteria 3750
41 Ga0070713_100519802 3300005436 Bacteria 1125
42 Ga0070710_10040149 3300005437 Bacteria 2579
43 Ga0070710_10188706 3300005437 Bacteria 1295
44 Ga0070710_10231788 3300005437 Unclassified 1179
45 Ga0070710_10950662 3300005437 Unclassified 623
46 Ga0070711_100025636 3300005439 Bacteria 3859
47 Ga0070711_100136225 3300005439 Bacteria 1835
48 Ga0070711_100210051 3300005439 Bacteria 1507
49 Ga0070711_100220104 3300005439 Unclassified 1475
50 Ga0070711_100227479 3300005439 Bacteria 1453
51 Ga0070711_100228440 3300005439 Bacteria 1450
52 Ga0070711_100304891 3300005439 Bacteria 1267
53 Ga0070705_100017337 3300005440 Bacteria 3759
54 Ga0070705_100723618 3300005440 Unclassified 784
55 Ga0070700_100001106 3300005441 Bacteria 13344
56 Ga0070700_100253240 3300005441 Bacteria 1264
57 Ga0070700_100659885 3300005441 Bacteria 827
58 Ga0070694_101180078 3300005444 Bacteria 641
59 Ga0070708_100972896 3300005445 Bacteria 796
60 Ga0070663_100027740 3300005455 Bacteria 3849
61 Ga0070663_100585127 3300005455 Unclassified 937
62 Ga0070678_100011077 3300005456 Bacteria 5543
63 Ga0070678_100045406 3300005456 Bacteria 3143
64 Ga0070662_100054441 3300005457 Bacteria 2899
65 Ga0070662_100210468 3300005457 Bacteria 1547
66 Ga0070681_10030062 3300005458 Bacteria 5451
67 Ga0070681_10041065 3300005458 Bacteria 4635
68 Ga0070681_10174388 3300005458 Bacteria 2072
69 Ga0070681_10386216 3300005458 Bacteria 1311
70 Ga0068867_100128251 3300005459 Bacteria 1968
71 Ga0068867_100324356 3300005459 Bacteria 1277
72 Ga0068867_100757122 3300005459 Bacteria 862
73 Ga0070685_10096565 3300005466 Bacteria 1798
74 Ga0070698_100409551 3300005471 Bacteria 1290
75 Ga0070699_100179749 3300005518 Bacteria 1877
76 Ga0070679_100026432 3300005530 Bacteria 5702
77 Ga0070679_100265327 3300005530 Bacteria 1672
78 Ga0070679_100467846 3300005530 Bacteria 1205
79 Ga0070679_100596539 3300005530 Bacteria 1048
80 Ga0070684_100006386 3300005535 Bacteria 9116
81 Ga0070684_100008992 3300005535 Bacteria 7848
82 Ga0070684_100065704 3300005535 Bacteria 3184
83 Ga0070684_100106609 3300005535 Bacteria 2509
84 Ga0068853_100770812 3300005539 Bacteria 920
85 Ga0070686_100050418 3300005544 Bacteria 2645
86 Ga0070686_100089996 3300005544 Bacteria 2051
87 Ga0070686_100177040 3300005544 Bacteria 1513
88 Ga0070686_100194614 3300005544 Unclassified 1449
89 Ga0070686_100385240 3300005544 Unclassified 1062
90 Ga0070695_100810360 3300005545 Bacteria 751
91 Ga0070696_100021224 3300005546 Bacteria 4403
92 Ga0070696_100047166 3300005546 Bacteria 2989
93 Ga0070693_100022849 3300005547 Bacteria 3333
94 Ga0070693_100246567 3300005547 Bacteria 1182
95 Ga0070693_100473085 3300005547 Bacteria 884
96 Ga0070665_100153705 3300005548 Bacteria 2303
97 Ga0070704_100219411 3300005549 Bacteria 1545
98 Ga0070704_100929132 3300005549 Bacteria 784
99 Ga0070704_101321384 3300005549 Unclassified 660
100 Ga0068855_100290519 3300005563 Bacteria 1812
101 Ga0068855_101012266 3300005563 Unclassified 872
102 Ga0068855_101048066 3300005563 Bacteria 855
103 Ga0070664_100028477 3300005564 Bacteria 4647
104 Ga0068854_100037103 3300005578 Bacteria 3419
105 Ga0068854_101124171 3300005578 Bacteria 701
106 Ga0068856_100064219 3300005614 Bacteria 3627
107 Ga0070702_100027315 3300005615 Bacteria 3077
108 Ga0070702_100040550 3300005615 Bacteria 2605
109 Ga0070702_100053194 3300005615 Unclassified 2325
110 Ga0068852_100104417 3300005616 Bacteria 2565
111 Ga0068852_102582623 3300005616 Unclassified 528
112 Ga0068864_100023860 3300005618 Bacteria 5140
113 Ga0068866_10038107 3300005718 Bacteria 2365
114 Ga0068866_10221572 3300005718 Bacteria 1142
115 Ga0068861_100000901 3300005719 Bacteria 18048
116 Ga0068861_100591588 3300005719 Unclassified 1017
117 Ga0068858_100175146 3300005842 Bacteria 2024
118 Ga0068858_100716405 3300005842 Unclassified 974
119 Ga0068858_100885035 3300005842 Bacteria 873
120 Ga0068860_100015334 3300005843 Bacteria 7485
121 Ga0068860_101554856 3300005843 Bacteria 683
122 Ga0068862_100339905 3300005844 Bacteria 1390
123 Ga0068862_100360403 3300005844 Bacteria 1351
124 Ga0081455_10080750 3300005937 Bacteria 2665
125 Ga0081455_10081444 3300005937 Unclassified 2651
126 Ga0081538_10007840 3300005981 Bacteria 9159
127 Ga0081538_10036083 3300005981 Bacteria 3234
128 Ga0081538_10060970 3300005981 Unclassified 2163
129 Ga0081539_10139909 3300005985 Unclassified 1177
130 Ga0070717_10065902 3300006028 Bacteria 3011
131 Ga0070717_10079291 3300006028 Bacteria 2753
132 Ga0070717_10650129 3300006028 Bacteria 957
133 Ga0070717_10747828 3300006028 Bacteria 889
134 Ga0070715_10027493 3300006163 Bacteria 2272
135 Ga0070716_100228501 3300006173 Bacteria 1254
136 Ga0070716_101494269 3300006173 Unclassified 552
137 Ga0070712_100007279 3300006175 Bacteria 6906
138 Ga0070712_100015114 3300006175 Bacteria 4964
139 Ga0070712_100088929 3300006175 Bacteria 2258
140 Ga0070712_100150191 3300006175 Bacteria 1788
141 Ga0070712_100434010 3300006175 Unclassified 1091
142 Ga0070712_100570731 3300006175 Unclassified 955
143 Ga0097621_100009042 3300006237 Bacteria 7216
144 Ga0097621_100370175 3300006237 Unclassified 1278
145 Ga0068871_100191513 3300006358 Bacteria 1762
146 Ga0068871_100540665 3300006358 Bacteria 1054
147 Ga0075433_10880487 3300006852 Bacteria 781
148 Ga0075434_100009741 3300006871 Bacteria 8981
149 Ga0075434_100060563 3300006871 Bacteria 3765
150 Ga0075434_100631423 3300006871 Bacteria 1090
151 Ga0068865_100085131 3300006881 Bacteria 2280
152 Ga0068865_101169713 3300006881 Bacteria 680
153 Ga0075436_100009143 3300006914 Bacteria 6778
154 Ga0075436_100176028 3300006914 Unclassified 1511
155 Ga0075435_100005424 3300007076 Bacteria 8900
156 Ga0105251_10305955 3300009011 Bacteria 721
157 Ga0105240_10004256 3300009093 Bacteria 21886
158 Ga0111539_10159693 3300009094 Bacteria 2637
159 Ga0105245_10013727 3300009098 Bacteria 7056
160 Ga0105245_10047104 3300009098 Bacteria 3853
161 Ga0105245_10078973 3300009098 Bacteria 3004
162 Ga0105245_10247081 3300009098 Bacteria 1732
163 Ga0105245_11004802 3300009098 Bacteria 879
164 Ga0105245_12468431 3300009098 Bacteria 573
165 Ga0105245_12703488 3300009098 Unclassified 549
166 Ga0105247_10048222 3300009101 Bacteria 2616
167 Ga0105247_10250833 3300009101 Bacteria 1210
168 Ga0105247_10534680 3300009101 Bacteria 859
169 Ga0114129_10429080 3300009147 Bacteria 1737
170 Ga0114129_10712756 3300009147 Bacteria 1288
171 Ga0114129_10809738 3300009147 Bacteria 1194
172 Ga0105243_10092076 3300009148 Bacteria 2498
173 Ga0105243_10227682 3300009148 Bacteria 1652
174 Ga0105243_10391675 3300009148 Unclassified 1288
175 Ga0105243_10407593 3300009148 Bacteria 1264
176 Ga0105243_10772077 3300009148 Unclassified 944
177 Ga0105241_10114948 3300009174 Bacteria 2159
178 Ga0105242_10010591 3300009176 Bacteria 7080
179 Ga0105242_10087802 3300009176 Bacteria 2611
180 Ga0105242_11118717 3300009176 Bacteria 803
181 Ga0105248_10261295 3300009177 Bacteria 1949
182 Ga0105248_10318954 3300009177 Bacteria 1750
183 Ga0105248_10759087 3300009177 Bacteria 1094
184 Ga0105248_12726831 3300009177 Bacteria 564
185 Ga0105237_10121922 3300009545 Bacteria 2602
186 Ga0105238_10075561 3300009551 Bacteria 3361
187 Ga0105238_10093387 3300009551 Bacteria 2997
188 Ga0105238_10819206 3300009551 Bacteria 947
189 Ga0105238_10964145 3300009551 Bacteria 873
190 Ga0105249_10003767 3300009553 Bacteria 13086
191 Ga0105249_10062351 3300009553 Bacteria 3423
192 Ga0105249_10258285 3300009553 Bacteria 1730
193 Ga0105239_10008213 3300010375 Bacteria 11907
194 Ga0105239_10665766 3300010375 Bacteria 1189
195 Ga0105246_10167886 3300011119 Bacteria 1678
196 Ga0105246_10745122 3300011119 Unclassified 863
197 Ga0157371_10822417 3300013102 Bacteria 701
198 Ga0157370_10047372 3300013104 Bacteria 4121
199 Ga0157369_10046910 3300013105 Bacteria 4694
200 Ga0157374_10047947 3300013296 Bacteria 3962
201 Ga0157374_10050475 3300013296 Bacteria 3867
202 Ga0157374_10397287 3300013296 Bacteria 1375
203 Ga0157378_10013326 3300013297 Bacteria 7186
204 Ga0163162_10426264 3300013306 Bacteria 1459
205 Ga0163162_11133012 3300013306 Bacteria 887
206 Ga0157372_10038710 3300013307 Bacteria 5262
207 Ga0157372_10151799 3300013307 Bacteria 2674
208 Ga0157372_10281207 3300013307 Bacteria 1935
209 Ga0157375_10051006 3300013308 Bacteria 4061
210 Ga0157375_11353627 3300013308 Bacteria 838
211 Ga0157375_11916852 3300013308 Unclassified 704
212 Ga0163163_10011750 3300014325 Bacteria 7956
213 Ga0157380_10742371 3300014326 Bacteria 992
214 Ga0157377_10001428 3300014745 Bacteria 10306
215 Ga0157377_10039298 3300014745 Bacteria 2616
216 Ga0157379_10239985 3300014968 Bacteria 1644
217 Ga0157376_10124358 3300014969 Bacteria 2291
218 Ga0163161_10228718 3300017792 Bacteria 1443
219 Ga0163161_10345341 3300017792 Bacteria 1182
220 Ga0206356_11450398 3300020070 Bacteria 1295
221 Ga0206350_10472421 3300020080 Unclassified 500
222 Ga0206353_11963338 3300020082 Bacteria 563
223 Ga0213876_10012651 3300021384 Bacteria 4489
224 Ga0207692_10220643 3300025898 Unclassified 1124
225 Ga0207642_10137091 3300025899 Bacteria 1285
226 Ga0207642_10515506 3300025899 Bacteria 734
227 Ga0207642_10550465 3300025899 Bacteria 712
228 Ga0207710_10038277 3300025900 Bacteria 2120
229 Ga0207710_10241599 3300025900 Bacteria 901
230 Ga0207710_10499881 3300025900 Unclassified 631
231 Ga0207688_10013672 3300025901 Bacteria 4412
232 Ga0207688_10048318 3300025901 Bacteria 2377
233 Ga0207688_10065354 3300025901 Bacteria 2055
234 Ga0207680_10100758 3300025903 Bacteria 1855
235 Ga0207685_10861758 3300025905 Bacteria 502
236 Ga0207699_10452580 3300025906 Bacteria 921
237 Ga0207654_10077750 3300025911 Bacteria 1990
238 Ga0207654_10705564 3300025911 Bacteria 725
239 Ga0207707_10072908 3300025912 Bacteria 2994
240 Ga0207707_10283948 3300025912 Bacteria 1433
241 Ga0207707_10294032 3300025912 Bacteria 1405
242 Ga0207707_10333210 3300025912 Bacteria 1309
243 Ga0207695_10018489 3300025913 Bacteria 8056
244 Ga0207671_10183300 3300025914 Bacteria 1630
245 Ga0207693_10011778 3300025915 Bacteria 7069
246 Ga0207693_10044509 3300025915 Bacteria 3489
247 Ga0207693_10122284 3300025915 Bacteria 2044
248 Ga0207693_10307272 3300025915 Unclassified 1242
249 Ga0207693_11186081 3300025915 Bacteria 576
250 Ga0207663_10052119 3300025916 Unclassified 2551
251 Ga0207663_10078953 3300025916 Bacteria 2147
252 Ga0207663_10112469 3300025916 Unclassified 1850
253 Ga0207663_10139383 3300025916 Bacteria 1687
254 Ga0207663_10534473 3300025916 Bacteria 915
255 Ga0207663_10858087 3300025916 Unclassified 725
256 Ga0207660_10004428 3300025917 Bacteria 9157
257 Ga0207660_10060984 3300025917 Bacteria 2714
258 Ga0207662_10201623 3300025918 Bacteria 1288
259 Ga0207657_10337677 3300025919 Bacteria 1189
260 Ga0207652_10042115 3300025921 Bacteria 3885
261 Ga0207652_10384884 3300025921 Bacteria 1266
262 Ga0207652_10726890 3300025921 Bacteria 885
263 Ga0207694_10580826 3300025924 Unclassified 942
264 Ga0207659_10103589 3300025926 Bacteria 2150
265 Ga0207687_10021995 3300025927 Bacteria 4241
266 Ga0207687_10081684 3300025927 Unclassified 2336
267 Ga0207687_10095941 3300025927 Bacteria 2172
268 Ga0207687_10104687 3300025927 Bacteria 2089
269 Ga0207687_10117396 3300025927 Bacteria 1984
270 Ga0207687_10435418 3300025927 Bacteria 1085
271 Ga0207687_10772855 3300025927 Bacteria 818
272 Ga0207700_10223227 3300025928 Bacteria 1598
273 Ga0207700_10830642 3300025928 Unclassified 827
274 Ga0207700_10868174 3300025928 Bacteria 807
275 Ga0207664_10141256 3300025929 Unclassified 2037
276 Ga0207664_10412274 3300025929 Bacteria 1203
277 Ga0207664_10599186 3300025929 Bacteria 989
278 Ga0207644_10314449 3300025931 Unclassified 1265
279 Ga0207644_10350096 3300025931 Bacteria 1199
280 Ga0207644_10431939 3300025931 Bacteria 1080
281 Ga0207644_10813889 3300025931 Unclassified 781
282 Ga0207690_10129902 3300025932 Bacteria 1842
283 Ga0207690_10183662 3300025932 Bacteria 1577
284 Ga0207690_10561356 3300025932 Bacteria 929
285 Ga0207690_10568508 3300025932 Unclassified 923
286 Ga0207706_10002741 3300025933 Bacteria 17121
287 Ga0207706_10009700 3300025933 Bacteria 8836
288 Ga0207686_10016674 3300025934 Bacteria 4125
289 Ga0207686_10183054 3300025934 Unclassified 1487
290 Ga0207709_10028119 3300025935 Bacteria 3248
291 Ga0207709_10160547 3300025935 Bacteria 1567
292 Ga0207670_10127995 3300025936 Bacteria 1856
293 Ga0207669_10086290 3300025937 Bacteria 2029
294 Ga0207669_10094942 3300025937 Bacteria 1953
295 Ga0207669_10299331 3300025937 Bacteria 1222
296 Ga0207704_10083960 3300025938 Bacteria 2069
297 Ga0207704_10672675 3300025938 Bacteria 854
298 Ga0207704_10855485 3300025938 Bacteria 762
299 Ga0207665_10662150 3300025939 Bacteria 819
300 Ga0207691_10580801 3300025940 Bacteria 949
301 Ga0207711_10162061 3300025941 Bacteria 2025
302 Ga0207711_10165914 3300025941 Bacteria 2002
303 Ga0207689_10804290 3300025942 Bacteria 793
304 Ga0207661_10035686 3300025944 Bacteria 3877
305 Ga0207661_10396810 3300025944 Bacteria 1250
306 Ga0207661_10814057 3300025944 Unclassified 860
307 Ga0207667_10660748 3300025949 Bacteria 1050
308 Ga0207667_12107603 3300025949 Unclassified 522
309 Ga0207712_10021752 3300025961 Bacteria 4214
310 Ga0207668_10027981 3300025972 Bacteria 3680
311 Ga0207668_10036877 3300025972 Bacteria 3267
312 Ga0207668_10052405 3300025972 Bacteria 2823
313 Ga0207640_10225657 3300025981 Unclassified 1437
314 Ga0207640_10248085 3300025981 Bacteria 1380
315 Ga0207640_10446053 3300025981 Bacteria 1065
316 Ga0207640_10511833 3300025981 Bacteria 1001
317 Ga0207658_10538385 3300025986 Bacteria 1044
318 Ga0207677_10183081 3300026023 Bacteria 1649
319 Ga0207677_10221549 3300026023 Bacteria 1517
320 Ga0207677_10362157 3300026023 Bacteria 1218
321 Ga0207703_10093596 3300026035 Bacteria 2531
322 Ga0207703_10571599 3300026035 Unclassified 1067
323 Ga0207639_11494811 3300026041 Unclassified 634
324 Ga0207678_10213794 3300026067 Bacteria 1650
325 Ga0207678_10509456 3300026067 Bacteria 1049
326 Ga0207708_10000610 3300026075 Bacteria 27534
327 Ga0207702_10040691 3300026078 Bacteria 3896
328 Ga0207702_10090358 3300026078 Bacteria 2680
329 Ga0207702_10167709 3300026078 Bacteria 2010
330 Ga0207648_10044516 3300026089 Bacteria 3894
331 Ga0207648_10094471 3300026089 Bacteria 2615
332 Ga0207648_10686009 3300026089 Bacteria 948
333 Ga0207648_10717016 3300026089 Bacteria 927
334 Ga0207674_10223836 3300026116 Bacteria 1830
335 Ga0207674_10717480 3300026116 Bacteria 965
336 Ga0207675_100002561 3300026118 Bacteria 18007
337 Ga0207683_10000098 3300026121 Bacteria 71739
338 Ga0207698_10164235 3300026142 Bacteria 1946
339 Ga0207698_11140648 3300026142 Bacteria 793
340 Ga0268266_10041473 3300028379 Bacteria 3928
341 Ga0268266_10268303 3300028379 Bacteria 1584
342 Ga0268265_10610064 3300028380 Bacteria 1044
343 Ga0268264_10093314 3300028381 Bacteria 2600
344 Ga0268264_10262669 3300028381 Bacteria 1609
345 Ga0265319_1032924 3300028563 Bacteria 1793
346 Ga0265319_1042417 3300028563 Unclassified 1530
347 Ga0265334_10028877 3300028573 Bacteria 2224
348 Ga0265334_10066401 3300028573 Bacteria 1350
349 Ga0265318_10000296 3300028577 Bacteria 40669
350 Ga0265318_10026778 3300028577 Bacteria 2269
351 Ga0265318_10078042 3300028577 Bacteria 1224
352 Ga0265323_10145174 3300028653 Bacteria 762
353 Ga0265336_10103438 3300028666 Bacteria 848
354 Ga0265338_10007027 3300028800 Bacteria 14127
355 Ga0265338_10051655 3300028800 Bacteria 3698
356 Ga0265338_10075279 3300028800 Bacteria 2865
357 Ga0265338_10168712 3300028800 Bacteria 1681
358 Ga0265330_10064476 3300031235 Bacteria 1591
359 Ga0265332_10060292 3300031238 Bacteria 1623
360 Ga0265320_10159228 3300031240 Bacteria 1017
361 Ga0265325_10000309 3300031241 Bacteria 34328
362 Ga0265325_10474932 3300031241 Unclassified 543
363 Ga0265329_10022793 3300031242 Bacteria 2091
364 Ga0265340_10010810 3300031247 Bacteria 4874
365 Ga0265340_10172729 3300031247 Bacteria 979
366 Ga0265339_10157539 3300031249 Unclassified 1144
367 Ga0265331_10018529 3300031250 Bacteria 3607
368 Ga0265327_10004386 3300031251 Bacteria 12523
369 Ga0265327_10004579 3300031251 Bacteria 12173
370 Ga0265327_10119355 3300031251 Unclassified 1251
371 Ga0265327_10169924 3300031251 Unclassified 1002
372 Ga0265316_10002547 3300031344 Bacteria 18835
373 Ga0265316_10508316 3300031344 Unclassified 860
374 Ga0265313_10032353 3300031595 Bacteria 2671
375 Ga0265314_10014307 3300031711 Bacteria 6359
376 Ga0265314_10072155 3300031711 Unclassified 2307
377 Ga0265314_10130962 3300031711 Bacteria 1565
378 Ga0265314_10485376 3300031711 Bacteria 653
379 Ga0265342_10041626 3300031712 Bacteria 2780
380 Ga0265342_10051737 3300031712 Unclassified 2449
381 Ga0307415_102109146 3300032126 Bacteria 550
382 Ga0373938_0093731 3300034957 Unclassified 746
383 Ga0373934_0151226 3300035086 Bacteria 951
384 Ga0373923_0406847 3300035111 Bacteria 656
385 Ga0373953_0072524 3300035117 Bacteria 1422
386 Ga0373956_0274181 3300035119 Bacteria 803
387 Ga0373955_0257937 3300035172 Bacteria 1046
388 Ga0373962_0057297 3300035242 Bacteria 1137
389 Ga0316574_0251030 3300035398 Unclassified 1130
390 Ga0373937_0071241 3300036401 Bacteria 3206
391 Ga0373937_0213907 3300036401 Bacteria 1814
392 Ga0373937_1134621 3300036401 Bacteria 730
393 Ga0373925_0206480 3300037068 Bacteria 1564
394 Ga0395898_1169645 3300037466 Bacteria 701
395 Ga0242420_055133 3300038996 Bacteria 784
396 Ga0436365_1292416 3300039437 Bacteria 21351
397 Ga0436360_0948485 3300039438 Unclassified 890
398 Ga0436362_1286410 3300039453 Bacteria 1127
399 Ga0451851_0547637 3300041507 Bacteria 604
400 Ga0451853_3545930 3300041512 Unclassified 595
401 Ga0439448_0110140 3300042005 Unclassified 940
402 Ga0439463_038654 3300042016 Bacteria 1211
403 Ga0439440_0046126 3300042993 Bacteria 1076
404 Ga0466963_0012848 3300044694 Bacteria 5131
405 Ga0466963_0202868 3300044694 Unclassified 1387
406 Ga0466964_0128155 3300044706 Bacteria 1152
407 Ga0466964_0253666 3300044706 Bacteria 868
408 Ga0466971_0009765 3300044719 Bacteria 4190
409 Ga0466968_0095297 3300044735 Bacteria 1324
410 Ga0466957_0016056 3300044842 Bacteria 4377
411 Ga0466960_0248916 3300044901 Bacteria 986
412 Ga0466958_0028571 3300045836 Bacteria 3307
413 Ga0466967_0001714 3300045976 Bacteria 13059
414 Ga0466967_0050202 3300045976 Bacteria 3652
415 Ga0466967_0414128 3300045976 Bacteria 1313
416 Ga0466967_0423638 3300045976 Bacteria 1298
417 Ga0495592_0058195 3300046454 Unclassified 2851
418 Ga0495603_0072488 3300046455 Unclassified 2023
419 Ga0495629_0950344 3300046459 Bacteria 561
420 Ga0495641_0284211 3300046461 Bacteria 745
421 Ga0495651_0012763 3300046462 Bacteria 6486
422 Ga0495653_0331423 3300046463 Unclassified 984
423 Ga0495639_0080298 3300046475 Bacteria 1518
424 Ga0495662_0146884 3300046476 Bacteria 1161
425 Ga0495664_0036607 3300046477 Bacteria 2893
426 Ga0495584_0189317 3300046491 Bacteria 1046
427 Ga0495596_0170925 3300046500 Bacteria 845
428 Ga0495607_0315754 3300046501 Bacteria 731
429 Ga0495607_0332775 3300046501 Bacteria 705
430 Ga0495608_0053417 3300046511 Bacteria 2673
431 Ga0495608_0268936 3300046511 Bacteria 1060
432 Ga0495618_0007884 3300046514 Bacteria 6445
433 Ga0495628_0009380 3300046516 Bacteria 8353
434 Ga0495630_0004756 3300046517 Bacteria 9527
435 Ga0495630_0551295 3300046517 Unclassified 884
436 Ga0495652_0054116 3300046529 Bacteria 3419
437 Ga0495652_0445850 3300046529 Bacteria 907
438 Ga0495640_0019889 3300046533 Bacteria 4952
439 Ga0495645_0789631 3300046543 Bacteria 570
440 Ga0495667_0056270 3300046559 Bacteria 2586
441 Ga0495667_0385950 3300046559 Unclassified 883
442 Ga0495656_0213670 3300046615 Bacteria 962
443 Ga0495634_0121249 3300046642 Bacteria 1674
444 Ga0495611_0221718 3300046648 Bacteria 880
445 Ga0495588_0346344 3300046674 Bacteria 781
446 Ga0495623_0256278 3300046679 Bacteria 982
447 Ga0495646_0173975 3300046680 Bacteria 1185
448 Ga0495658_0199137 3300046683 Bacteria 1248
449 Ga0495658_0352970 3300046683 Bacteria 935
450 Ga0495658_1051701 3300046683 Unclassified 519
451 Ga0495624_0240700 3300046690 Bacteria 1095
452 Ga0495624_0428955 3300046690 Bacteria 793
453 Ga0495589_0166227 3300046794 Bacteria 1050
454 Ga0495600_0407802 3300046809 Bacteria 845
455 Ga0495600_0461815 3300046809 Bacteria 784
456 Ga0495600_0511517 3300046809 Bacteria 737
457 Ga0495581_0183800 3300047315 Bacteria 1223
458 Ga0495581_0660241 3300047315 Unclassified 604
459 Ga0495604_0174587 3300047317 Bacteria 1508
460 Ga0495604_0259444 3300047317 Bacteria 1182
461 Ga0495604_0323668 3300047317 Unclassified 1030
462 Ga0495674_0001934 3300047319 Bacteria 20441
463 Ga0495674_0364043 3300047319 Unclassified 1172
464 Ga0495674_0448591 3300047319 Bacteria 1037
465 Ga0495674_0662502 3300047319 Bacteria 822
466 Ga0495680_0081775 3300047322 Bacteria 2438
467 Ga0495680_0348929 3300047322 Bacteria 1031
468 Ga0495680_0799299 3300047322 Unclassified 616
469 Ga0495680_0882051 3300047322 Unclassified 579
470 Ga0495675_0505244 3300047444 Bacteria 694
471 Ga0495684_0508257 3300047471 Bacteria 827
472 Ga0495602_0285439 3300048088 Bacteria 1214
473 Ga0496100_0018213 3300048903 Bacteria 4162
474 Ga0496100_0124538 3300048903 Bacteria 1807
475 Ga0496100_0135310 3300048903 Bacteria 1740
476 Ga0496100_0140859 3300048903 Unclassified 1709
477 Ga0496101_0018561 3300048904 Bacteria 4731
478 Ga0496101_0023686 3300048904 Bacteria 4243
479 Ga0496101_0024630 3300048904 Bacteria 4167
480 Ga0496101_0060214 3300048904 Bacteria 2754
481 Ga0496101_0086527 3300048904 Bacteria 2324
482 Ga0496101_0187915 3300048904 Bacteria 1593
483 Ga0496101_0243042 3300048904 Bacteria 1401
484 Ga0496101_0885785 3300048904 Bacteria 703
485 Ga0496102_0004122 3300048905 Bacteria 12319
486 Ga0496102_0053118 3300048905 Bacteria 3694
487 Ga0496102_0179746 3300048905 Bacteria 1993
488 Ga0496102_0186797 3300048905 Bacteria 1953
489 Ga0496102_0202924 3300048905 Bacteria 1869
490 Ga0496102_0313910 3300048905 Bacteria 1477
491 Ga0496102_0541749 3300048905 Unclassified 1086
492 Ga0496102_1728073 3300048905 Unclassified 543
493 Ga0496103_0186205 3300048906 Bacteria 1334
494 Ga0496103_0261985 3300048906 Bacteria 1112
495 Ga0496104_0002813 3300048907 Bacteria 15001
496 Ga0496104_0016977 3300048907 Bacteria 6622
497 Ga0496104_0059675 3300048907 Bacteria 3612
498 Ga0496104_0246334 3300048907 Bacteria 1700
499 Ga0496104_0516501 3300048907 Bacteria 1106
500 Ga0496104_0848251 3300048907 Bacteria 819
501 Ga0496105_0009674 3300048908 Bacteria 7546
502 Ga0496105_0017651 3300048908 Bacteria 5725
503 Ga0496105_0087686 3300048908 Bacteria 2571
504 Ga0496105_0247471 3300048908 Bacteria 1445
505 Ga0496105_0304397 3300048908 Unclassified 1281
506 Ga0496105_0309221 3300048908 Bacteria 1269
507 Ga0496106_0007489 3300048909 Bacteria 8068
508 Ga0496106_0046292 3300048909 Bacteria 3269
509 Ga0496106_0052832 3300048909 Bacteria 3067
510 Ga0496106_0090975 3300048909 Unclassified 2355
511 Ga0496107_0004168 3300048910 Bacteria 9760
512 Ga0496107_0023215 3300048910 Bacteria 4385
513 Ga0496107_0028545 3300048910 Bacteria 3966
514 Ga0496107_0069917 3300048910 Bacteria 2548
515 Ga0496108_0095159 3300048911 Bacteria 2535
516 Ga0496108_0367286 3300048911 Bacteria 1256
517 Ga0496108_0533778 3300048911 Bacteria 1024
518 Ga0496109_0017500 3300048912 Bacteria 6283
519 Ga0496109_0057566 3300048912 Bacteria 3548
520 Ga0496109_0205815 3300048912 Unclassified 1850
521 Ga0496109_0409202 3300048912 Bacteria 1282
522 Ga0496110_0027449 3300048913 Bacteria 4881
523 Ga0496111_0027704 3300048914 Bacteria 4012
524 Ga0496111_0465243 3300048914 Bacteria 932
525 Ga0496112_0021398 3300048915 Bacteria 6150
526 Ga0496112_0079967 3300048915 Bacteria 3233
527 Ga0496112_0327133 3300048915 Bacteria 1477
528 Ga0496113_0069668 3300048916 Bacteria 2672
529 Ga0496113_0078897 3300048916 Bacteria 2519
530 Ga0496113_1501234 3300048916 Bacteria 520
531 Ga0496114_0020808 3300048917 Bacteria 5326
532 Ga0496114_0042998 3300048917 Bacteria 3746
533 Ga0496114_0046951 3300048917 Bacteria 3590
534 Ga0496114_0091795 3300048917 Bacteria 2579
535 Ga0496114_0121414 3300048917 Bacteria 2247
536 Ga0496114_0130982 3300048917 Bacteria 2166
537 Ga0496114_0380887 3300048917 Unclassified 1249
538 Ga0496114_1105872 3300048917 Bacteria 677
539 Ga0496114_1406243 3300048917 Unclassified 585
540 Ga0496115_0009605 3300048918 Bacteria 7193
541 Ga0496115_0033447 3300048918 Bacteria 4059
542 Ga0496115_0056933 3300048918 Bacteria 3143
543 Ga0496115_0285935 3300048918 Bacteria 1353
544 Ga0496115_0356055 3300048918 Unclassified 1193
545 Ga0496115_0531422 3300048918 Unclassified 942
546 Ga0501031_0169543 3300049568 Bacteria 1426
547 Ga0501032_0014990 3300049569 Bacteria 5481
548 Ga0501033_0021110 3300049570 Bacteria 4915
549 Ga0501036_0170200 3300049572 Bacteria 1835
550 Ga0501037_0017088 3300049573 Bacteria 5338
551 Ga0501038_0007682 3300049574 Bacteria 9943
552 Ga0501038_0422162 3300049574 Bacteria 1029
553 Ga0501039_0140391 3300049575 Bacteria 1897
554 Ga0501041_0031915 3300049577 Bacteria 3183
555 Ga0501041_0156767 3300049577 Bacteria 1423
556 Ga0501042_0110522 3300049578 Bacteria 1979
557 Ga0501043_0010327 3300049579 Bacteria 7320
558 Ga0501046_0068743 3300049580 Bacteria 2756
559 Ga0501048_0345086 3300049582 Bacteria 1061
560 Ga0501067_0038183 3300049583 Bacteria 2666
561 Ga0501068_0009847 3300049584 Bacteria 5353
562 Ga0501068_0160759 3300049584 Bacteria 1416
563 Ga0501069_0001001 3300049585 Bacteria 13446
564 Ga0501069_0020919 3300049585 Bacteria 3547
565 Ga0501069_0499439 3300049585 Unclassified 726
566 Ga0501070_0050713 3300049586 Bacteria 3444
567 Ga0501070_1319761 3300049586 Unclassified 550
568 Ga0501071_0345063 3300049587 Bacteria 1132
569 Ga0501071_0359389 3300049587 Bacteria 1109
570 Ga0501072_0150455 3300049588 Bacteria 1855
571 Ga0501072_0334599 3300049588 Unclassified 1203
572 Ga0501073_0010385 3300049589 Bacteria 6830
573 Ga0501074_0013413 3300049590 Bacteria 5957
574 Ga0501075_0122007 3300049591 Bacteria 1983
575 Ga0501075_0364907 3300049591 Bacteria 1101
576 Ga0501075_0625948 3300049591 Bacteria 821
577 Ga0501076_0387568 3300049592 Bacteria 1148
578 Ga0501076_0399622 3300049592 Bacteria 1130
579 Ga0501077_0022845 3300049593 Bacteria 3963
580 Ga0501077_0090632 3300049593 Unclassified 1938
581 Ga0501077_1086502 3300049593 Bacteria 515
582 Ga0501079_0224498 3300049741 Bacteria 1467
583 Ga0501079_0875234 3300049741 Bacteria 707
584 Ga0501080_0008121 3300049742 Bacteria 9509
585 Ga0501080_0905628 3300049742 Unclassified 769
586 Ga0501081_0074005 3300049743 Bacteria 2376
587 Ga0501083_0009530 3300049744 Bacteria 6860
588 Ga0501035_0220515 3300049822 Bacteria 1619
589 Ga0501044_0221256 3300049823 Bacteria 1844
590 Ga0501045_0111545 3300049824 Bacteria 2028
591 Ga0501045_0460113 3300049824 Bacteria 945
592 Ga0501045_0534205 3300049824 Unclassified 870
593 Ga0501045_0785199 3300049824 Bacteria 701
594 nmdc:mga08y16_723813_c1 3300050511 Bacteria 993
595 nmdc:mga0n895_250657_c1 3300050512 Bacteria 1797
596 nmdc:mga0n895_26031_c1 3300050512 Bacteria 5534
597 nmdc:mga0rr50_10324_c1 3300050513 Bacteria 5921
598 nmdc:mga08x19_161378_c1 3300050514 Unclassified 1522
599 nmdc:mga08x19_3557_c1 3300050514 Bacteria 9274
600 nmdc:mga0a205_682543_c1 3300050515 Bacteria 877
601 Ga0495601_0039830 3300053077 Bacteria 2943
602 Ga0495601_0156265 3300053077 Bacteria 1489
603 Ga0495601_0497443 3300053077 Bacteria 787
604 Ga0495601_0888809 3300053077 Unclassified 563
605 Ga0495612_0143086 3300053078 Bacteria 1038
606 Ga0495612_0457183 3300053078 Bacteria 584
607 Ga0495619_0431015 3300053085 Bacteria 909
608 Ga0495619_0882473 3300053085 Unclassified 602
609 Ga0500556_0001954 3300053104 Bacteria 7274
610 Ga0500616_0010426 3300053153 Bacteria 5561
611 Ga0500599_001438 3300053736 Bacteria 2733
612 Ga0501084_0371996 3300054114 Bacteria 1207
613 Ga0501082_0328013 3300060353 Bacteria 1333
614 Ga0466962_0022561 3300061719 Bacteria 3025
615 Ga0530510_0014265 3300061734 Bacteria 5603
616 Ga0530510_0099611 3300061734 Bacteria 2125
617 Ga0530510_0158140 3300061734 Bacteria 1675
618 Ga0530510_0345645 3300061734 Bacteria 1117
619 Ga0070682_100310146
620 JGI24738J21930_10043301
621 JGI24744J21845_10041472
622 Ga0070683_100915640
623 Ga0068869_100039228
624 Ga0070680_100301162
625 Ga0070682_100067762
626 Ga0070682_100103635
627 Ga0070682_100144629
628 Ga0070682_100792793
629 Ga0068868_100001984
630 Ga0068868_100244086
631 Ga0068868_100387732
632 Ga0070660_100566607
633 Ga0070689_100388487
634 Ga0070691_10021585
635 Ga0070687_100181424
636 Ga0070687_100821589
637 Ga0070661_100180874
638 Ga0070661_101179276
639 Ga0070692_10775944
640 Ga0070668_100032709
641 Ga0070668_100053296
642 Ga0070671_100036727
643 Ga0070671_100208832
644 Ga0070674_100078634
645 Ga0070674_100483708
646 Ga0070674_100909307
647 Ga0070674_101340220
648 Ga0070673_100375818
649 Ga0070673_101128362
650 Ga0070688_100063706
651 Ga0070688_100133969
652 Ga0070659_100388134
653 Ga0070659_100906133
654 Ga0070659_101157847
655 Ga0070667_100969395
656 Ga0070714_100003099
657 Ga0070714_101682410
658 Ga0070713_100041474
659 Ga0070713_100519802
660 Ga0070710_10040149
661 Ga0070710_10188706
662 Ga0070710_10231788
663 Ga0070710_10950662
664 Ga0070711_100025636
665 Ga0070711_100136225
666 Ga0070711_100210051
667 Ga0070711_100220104
668 Ga0070711_100227479
669 Ga0070711_100228440
670 Ga0070711_100304891
671 Ga0070705_100017337
672 Ga0070705_100723618
673 Ga0070700_100001106
674 Ga0070700_100253240
675 Ga0070700_100659885
676 Ga0070694_101180078
677 Ga0070708_100972896
678 Ga0070663_100027740
679 Ga0070663_100585127
680 Ga0070678_100011077
681 Ga0070678_100045406
682 Ga0070662_100054441
683 Ga0070662_100210468
684 Ga0070681_10030062
685 Ga0070681_10041065
686 Ga0070681_10174388
687 Ga0070681_10386216
688 Ga0068867_100128251
689 Ga0068867_100324356
690 Ga0068867_100757122
691 Ga0070685_10096565
692 Ga0070698_100409551
693 Ga0070699_100179749
694 Ga0070679_100026432
695 Ga0070679_100265327
696 Ga0070679_100467846
697 Ga0070679_100596539
698 Ga0070684_100006386
699 Ga0070684_100008992
700 Ga0070684_100065704
701 Ga0070684_100106609
702 Ga0068853_100770812
703 Ga0070686_100050418
704 Ga0070686_100089996
705 Ga0070686_100177040
706 Ga0070686_100194614
707 Ga0070686_100385240
708 Ga0070695_100810360
709 Ga0070696_100021224
710 Ga0070696_100047166
711 Ga0070693_100022849
712 Ga0070693_100246567
713 Ga0070693_100473085
714 Ga0070665_100153705
715 Ga0070704_100219411
716 Ga0070704_100929132
717 Ga0070704_101321384
718 Ga0068855_100290519
719 Ga0068855_101012266
720 Ga0068855_101048066
721 Ga0070664_100028477
722 Ga0068854_100037103
723 Ga0068854_101124171
724 Ga0068856_100064219
725 Ga0070702_100027315
726 Ga0070702_100040550
727 Ga0070702_100053194
728 Ga0068852_100104417
729 Ga0068852_102582623
730 Ga0068864_100023860
731 Ga0068866_10038107
732 Ga0068866_10221572
733 Ga0068861_100000901
734 Ga0068861_100591588
735 Ga0068858_100175146
736 Ga0068858_100716405
737 Ga0068858_100885035
738 Ga0068860_100015334
739 Ga0068860_101554856
740 Ga0068862_100339905
741 Ga0068862_100360403
742 Ga0081455_10080750
743 Ga0081455_10081444
744 Ga0081538_10007840
745 Ga0081538_10036083
746 Ga0081538_10060970
747 Ga0081539_10139909
748 Ga0070717_10065902
749 Ga0070717_10079291
750 Ga0070717_10650129
751 Ga0070717_10747828
752 Ga0070715_10027493
753 Ga0070716_100228501
754 Ga0070716_101494269
755 Ga0070712_100007279
756 Ga0070712_100015114
757 Ga0070712_100088929
758 Ga0070712_100150191
759 Ga0070712_100434010
760 Ga0070712_100570731
761 Ga0097621_100009042
762 Ga0097621_100370175
763 Ga0068871_100191513
764 Ga0068871_100540665
765 Ga0075433_10880487
766 Ga0075434_100009741
767 Ga0075434_100060563
768 Ga0075434_100631423
769 Ga0068865_100085131
770 Ga0068865_101169713
771 Ga0075436_100009143
772 Ga0075436_100176028
773 Ga0075435_100005424
774 Ga0105251_10305955
775 Ga0105240_10004256
776 Ga0111539_10159693
777 Ga0105245_10013727
778 Ga0105245_10047104
779 Ga0105245_10078973
780 Ga0105245_10247081
781 Ga0105245_11004802
782 Ga0105245_12468431
783 Ga0105245_12703488
784 Ga0105247_10048222
785 Ga0105247_10250833
786 Ga0105247_10534680
787 Ga0114129_10429080
788 Ga0114129_10712756
789 Ga0114129_10809738
790 Ga0105243_10092076
791 Ga0105243_10227682
792 Ga0105243_10391675
793 Ga0105243_10407593
794 Ga0105243_10772077
795 Ga0105241_10114948
796 Ga0105242_10010591
797 Ga0105242_10087802
798 Ga0105242_11118717
799 Ga0105248_10261295
800 Ga0105248_10318954
801 Ga0105248_10759087
802 Ga0105248_12726831
803 Ga0105237_10121922
804 Ga0105238_10075561
805 Ga0105238_10093387
806 Ga0105238_10819206
807 Ga0105238_10964145
808 Ga0105249_10003767
809 Ga0105249_10062351
810 Ga0105249_10258285
811 Ga0105239_10008213
812 Ga0105239_10665766
813 Ga0105246_10167886
814 Ga0105246_10745122
815 Ga0157371_10822417
816 Ga0157370_10047372
817 Ga0157369_10046910
818 Ga0157374_10047947
819 Ga0157374_10050475
820 Ga0157374_10397287
821 Ga0157378_10013326
822 Ga0163162_10426264
823 Ga0163162_11133012
824 Ga0157372_10038710
825 Ga0157372_10151799
826 Ga0157372_10281207
827 Ga0157375_10051006
828 Ga0157375_11353627
829 Ga0157375_11916852
830 Ga0163163_10011750
831 Ga0157380_10742371
832 Ga0157377_10001428
833 Ga0157377_10039298
834 Ga0157379_10239985
835 Ga0157376_10124358
836 Ga0163161_10228718
837 Ga0163161_10345341
838 Ga0206356_11450398
839 Ga0206350_10472421
840 Ga0206353_11963338
841 Ga0213876_10012651
842 Ga0207692_10220643
843 Ga0207642_10137091
844 Ga0207642_10515506
845 Ga0207642_10550465
846 Ga0207710_10038277
847 Ga0207710_10241599
848 Ga0207710_10499881
849 Ga0207688_10013672
850 Ga0207688_10048318
851 Ga0207688_10065354
852 Ga0207680_10100758
853 Ga0207685_10861758
854 Ga0207699_10452580
855 Ga0207654_10077750
856 Ga0207654_10705564
857 Ga0207707_10072908
858 Ga0207707_10283948
859 Ga0207707_10294032
860 Ga0207707_10333210
861 Ga0207695_10018489
862 Ga0207671_10183300
863 Ga0207693_10011778
864 Ga0207693_10044509
865 Ga0207693_10122284
866 Ga0207693_10307272
867 Ga0207693_11186081
868 Ga0207663_10052119
869 Ga0207663_10078953
870 Ga0207663_10112469
871 Ga0207663_10139383
872 Ga0207663_10534473
873 Ga0207663_10858087
874 Ga0207660_10004428
875 Ga0207660_10060984
876 Ga0207662_10201623
877 Ga0207657_10337677
878 Ga0207652_10042115
879 Ga0207652_10384884
880 Ga0207652_10726890
881 Ga0207694_10580826
882 Ga0207659_10103589
883 Ga0207687_10021995
884 Ga0207687_10081684
885 Ga0207687_10095941
886 Ga0207687_10104687
887 Ga0207687_10117396
888 Ga0207687_10435418
889 Ga0207687_10772855
890 Ga0207700_10223227
891 Ga0207700_10830642
892 Ga0207700_10868174
893 Ga0207664_10141256
894 Ga0207664_10412274
895 Ga0207664_10599186
896 Ga0207644_10314449
897 Ga0207644_10350096
898 Ga0207644_10431939
899 Ga0207644_10813889
900 Ga0207690_10129902
901 Ga0207690_10183662
902 Ga0207690_10561356
903 Ga0207690_10568508
904 Ga0207706_10002741
905 Ga0207706_10009700
906 Ga0207686_10016674
907 Ga0207686_10183054
908 Ga0207709_10028119
909 Ga0207709_10160547
910 Ga0207670_10127995
911 Ga0207669_10086290
912 Ga0207669_10094942
913 Ga0207669_10299331
914 Ga0207704_10083960
915 Ga0207704_10672675
916 Ga0207704_10855485
917 Ga0207665_10662150
918 Ga0207691_10580801
919 Ga0207711_10162061
920 Ga0207711_10165914
921 Ga0207689_10804290
922 Ga0207661_10035686
923 Ga0207661_10396810
924 Ga0207661_10814057
925 Ga0207667_10660748
926 Ga0207667_12107603
927 Ga0207712_10021752
928 Ga0207668_10027981
929 Ga0207668_10036877
930 Ga0207668_10052405
931 Ga0207640_10225657
932 Ga0207640_10248085
933 Ga0207640_10446053
934 Ga0207640_10511833
935 Ga0207658_10538385
936 Ga0207677_10183081
937 Ga0207677_10221549
938 Ga0207677_10362157
939 Ga0207703_10093596
940 Ga0207703_10571599
941 Ga0207639_11494811
942 Ga0207678_10213794
943 Ga0207678_10509456
944 Ga0207708_10000610
945 Ga0207702_10040691
946 Ga0207702_10090358
947 Ga0207702_10167709
948 Ga0207648_10044516
949 Ga0207648_10094471
950 Ga0207648_10686009
951 Ga0207648_10717016
952 Ga0207674_10223836
953 Ga0207674_10717480
954 Ga0207675_100002561
955 Ga0207683_10000098
956 Ga0207698_10164235
957 Ga0207698_11140648
958 Ga0268266_10041473
959 Ga0268266_10268303
960 Ga0268265_10610064
961 Ga0268264_10093314
962 Ga0268264_10262669
963 Ga0265319_1032924
964 Ga0265319_1042417
965 Ga0265334_10028877
966 Ga0265334_10066401
967 Ga0265318_10000296
968 Ga0265318_10026778
969 Ga0265318_10078042
970 Ga0265323_10145174
971 Ga0265336_10103438
972 Ga0265338_10007027
973 Ga0265338_10051655
974 Ga0265338_10075279
975 Ga0265338_10168712
976 Ga0265330_10064476
977 Ga0265332_10060292
978 Ga0265320_10159228
979 Ga0265325_10000309
980 Ga0265325_10474932
981 Ga0265329_10022793
982 Ga0265340_10010810
983 Ga0265340_10172729
984 Ga0265339_10157539
985 Ga0265331_10018529
986 Ga0265327_10004386
987 Ga0265327_10004579
988 Ga0265327_10119355
989 Ga0265327_10169924
990 Ga0265316_10002547
991 Ga0265316_10508316
992 Ga0265313_10032353
993 Ga0265314_10014307
994 Ga0265314_10072155
995 Ga0265314_10130962
996 Ga0265314_10485376
997 Ga0265342_10041626
998 Ga0265342_10051737
999 Ga0307415_102109146
1000 Ga0373938_0093731
1001 Ga0373934_0151226
1002 Ga0373923_0406847
1003 Ga0373953_0072524
1004 Ga0373956_0274181
1005 Ga0373955_0257937
1006 Ga0373962_0057297
1007 Ga0316574_0251030
1008 Ga0373937_0071241
1009 Ga0373937_0213907
1010 Ga0373937_1134621
1011 Ga0373925_0206480
1012 Ga0395898_1169645
1013 Ga0242420_055133
1014 Ga0436365_1292416
1015 Ga0436360_0948485
1016 Ga0436362_1286410
1017 Ga0451851_0547637
1018 Ga0451853_3545930
1019 Ga0439448_0110140
1020 Ga0439463_038654
1021 Ga0439440_0046126
1022 Ga0466963_0012848
1023 Ga0466963_0202868
1024 Ga0466964_0128155
1025 Ga0466964_0253666
1026 Ga0466971_0009765
1027 Ga0466968_0095297
1028 Ga0466957_0016056
1029 Ga0466960_0248916
1030 Ga0466958_0028571
1031 Ga0466967_0001714
1032 Ga0466967_0050202
1033 Ga0466967_0414128
1034 Ga0466967_0423638
1035 Ga0495592_0058195
1036 Ga0495603_0072488
1037 Ga0495629_0950344
1038 Ga0495641_0284211
1039 Ga0495651_0012763
1040 Ga0495653_0331423
1041 Ga0495639_0080298
1042 Ga0495662_0146884
1043 Ga0495664_0036607
1044 Ga0495584_0189317
1045 Ga0495596_0170925
1046 Ga0495607_0315754
1047 Ga0495607_0332775
1048 Ga0495608_0053417
1049 Ga0495608_0268936
1050 Ga0495618_0007884
1051 Ga0495628_0009380
1052 Ga0495630_0004756
1053 Ga0495630_0551295
1054 Ga0495652_0054116
1055 Ga0495652_0445850
1056 Ga0495640_0019889
1057 Ga0495645_0789631
1058 Ga0495667_0056270
1059 Ga0495667_0385950
1060 Ga0495656_0213670
1061 Ga0495634_0121249
1062 Ga0495611_0221718
1063 Ga0495588_0346344
1064 Ga0495623_0256278
1065 Ga0495646_0173975
1066 Ga0495658_0199137
1067 Ga0495658_0352970
1068 Ga0495658_1051701
1069 Ga0495624_0240700
1070 Ga0495624_0428955
1071 Ga0495589_0166227
1072 Ga0495600_0407802
1073 Ga0495600_0461815
1074 Ga0495600_0511517
1075 Ga0495581_0183800
1076 Ga0495581_0660241
1077 Ga0495604_0174587
1078 Ga0495604_0259444
1079 Ga0495604_0323668
1080 Ga0495674_0001934
1081 Ga0495674_0364043
1082 Ga0495674_0448591
1083 Ga0495674_0662502
1084 Ga0495680_0081775
1085 Ga0495680_0348929
1086 Ga0495680_0799299
1087 Ga0495680_0882051
1088 Ga0495675_0505244
1089 Ga0495684_0508257
1090 Ga0495602_0285439
1091 Ga0496100_0018213
1092 Ga0496100_0124538
1093 Ga0496100_0135310
1094 Ga0496100_0140859
1095 Ga0496101_0018561
1096 Ga0496101_0023686
1097 Ga0496101_0024630
1098 Ga0496101_0060214
1099 Ga0496101_0086527
1100 Ga0496101_0187915
1101 Ga0496101_0243042
1102 Ga0496101_0885785
1103 Ga0496102_0004122
1104 Ga0496102_0053118
1105 Ga0496102_0179746
1106 Ga0496102_0186797
1107 Ga0496102_0202924
1108 Ga0496102_0313910
1109 Ga0496102_0541749
1110 Ga0496102_1728073
1111 Ga0496103_0186205
1112 Ga0496103_0261985
1113 Ga0496104_0002813
1114 Ga0496104_0016977
1115 Ga0496104_0059675
1116 Ga0496104_0246334
1117 Ga0496104_0516501
1118 Ga0496104_0848251
1119 Ga0496105_0009674
1120 Ga0496105_0017651
1121 Ga0496105_0087686
1122 Ga0496105_0247471
1123 Ga0496105_0304397
1124 Ga0496105_0309221
1125 Ga0496106_0007489
1126 Ga0496106_0046292
1127 Ga0496106_0052832
1128 Ga0496106_0090975
1129 Ga0496107_0004168
1130 Ga0496107_0023215
1131 Ga0496107_0028545
1132 Ga0496107_0069917
1133 Ga0496108_0095159
1134 Ga0496108_0367286
1135 Ga0496108_0533778
1136 Ga0496109_0017500
1137 Ga0496109_0057566
1138 Ga0496109_0205815
1139 Ga0496109_0409202
1140 Ga0496110_0027449
1141 Ga0496111_0027704
1142 Ga0496111_0465243
1143 Ga0496112_0021398
1144 Ga0496112_0079967
1145 Ga0496112_0327133
1146 Ga0496113_0069668
1147 Ga0496113_0078897
1148 Ga0496113_1501234
1149 Ga0496114_0020808
1150 Ga0496114_0042998
1151 Ga0496114_0046951
1152 Ga0496114_0091795
1153 Ga0496114_0121414
1154 Ga0496114_0130982
1155 Ga0496114_0380887
1156 Ga0496114_1105872
1157 Ga0496114_1406243
1158 Ga0496115_0009605
1159 Ga0496115_0033447
1160 Ga0496115_0056933
1161 Ga0496115_0285935
1162 Ga0496115_0356055
1163 Ga0496115_0531422
1164 Ga0501031_0169543
1165 Ga0501032_0014990
1166 Ga0501033_0021110
1167 Ga0501036_0170200
1168 Ga0501037_0017088
1169 Ga0501038_0007682
1170 Ga0501038_0422162
1171 Ga0501039_0140391
1172 Ga0501041_0031915
1173 Ga0501041_0156767
1174 Ga0501042_0110522
1175 Ga0501043_0010327
1176 Ga0501046_0068743
1177 Ga0501048_0345086
1178 Ga0501067_0038183
1179 Ga0501068_0009847
1180 Ga0501068_0160759
1181 Ga0501069_0001001
1182 Ga0501069_0020919
1183 Ga0501069_0499439
1184 Ga0501070_0050713
1185 Ga0501070_1319761
1186 Ga0501071_0345063
1187 Ga0501071_0359389
1188 Ga0501072_0150455
1189 Ga0501072_0334599
1190 Ga0501073_0010385
1191 Ga0501074_0013413
1192 Ga0501075_0122007
1193 Ga0501075_0364907
1194 Ga0501075_0625948
1195 Ga0501076_0387568
1196 Ga0501076_0399622
1197 Ga0501077_0022845
1198 Ga0501077_0090632
1199 Ga0501077_1086502
1200 Ga0501079_0224498
1201 Ga0501079_0875234
1202 Ga0501080_0008121
1203 Ga0501080_0905628
1204 Ga0501081_0074005
1205 Ga0501083_0009530
1206 Ga0501035_0220515
1207 Ga0501044_0221256
1208 Ga0501045_0111545
1209 Ga0501045_0460113
1210 Ga0501045_0534205
1211 Ga0501045_0785199
1212 nmdc:mga08y16_723813_c1
1213 nmdc:mga0n895_250657_c1
1214 nmdc:mga0n895_26031_c1
1215 nmdc:mga0rr50_10324_c1
1216 nmdc:mga08x19_161378_c1
1217 nmdc:mga08x19_3557_c1
1218 nmdc:mga0a205_682543_c1
1219 Ga0495601_0039830
1220 Ga0495601_0156265
1221 Ga0495601_0497443
1222 Ga0495601_0888809
1223 Ga0495612_0143086
1224 Ga0495612_0457183
1225 Ga0495619_0431015
1226 Ga0495619_0882473
1227 Ga0500556_0001954
1228 Ga0500616_0010426
1229 Ga0500599_001438
1230 Ga0501084_0371996
1231 Ga0501082_0328013
1232 Ga0466962_0022561
1233 Ga0530510_0014265
1234 Ga0530510_0099611
1235 Ga0530510_0158140
1236 Ga0530510_0345645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06240

COXG

Carbon monoxide dehydrogenase subunit G (CoxG)

12

146

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ns9-assembly1.cif.gz_B crystal structure of protein ape2225 from aeropyrum pernix k1, pfam coxg 0.8376 1 142
2ns9-assembly1.cif.gz_B crystal structure of protein ape2225 from aeropyrum pernix k1, pfam coxg 0.8269 1 142
2pcs-assembly1.cif.gz_A crystal structure of conserved protein from geobacillus kaustophilus 0.7871 1 142
2pcs-assembly1.cif.gz_A crystal structure of conserved protein from geobacillus kaustophilus 0.7777 1 142
4jdl-assembly2.cif.gz_B-2 crystal structure of native abscisic acid receptor pyl5 at 2.65 angstrom 0.7433 2 142
ID Description Score Start End Superfamily
2ns9B01 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8376 1 142 3.30.530.20
2ns9B01 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8269 1 142 3.30.530.20
2pcsA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7871 1 142 3.30.530.20
2pcsA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7777 1 142 3.30.530.20
af_A0A0R4IQI7_1016_1117_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.7079 4 111 3.30.310.10
ID Description Score Start End GO Terms
AF-A0A7Y5X0R7-F1-model_v4 SRPBCC family protein 0.9925 1 143
AF-A0A7V9MHK6-F1-model_v4 Uncharacterized protein 0.962 1 96
AF-A0A845TMD7-F1-model_v4 SRPBCC family protein 0.9459 1 142
AF-A0A0D6QK08-F1-model_v4 Carbon monoxide dehydrogenase subunit G 0.9451 1 142
AF-A0A7V9MHK6-F1-model_v4 Uncharacterized protein 0.9429 1 96

Map