F469657

General Info

Members Datasets Scaffolds Average Seq Length
617 315 1234 89

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0781929|Ga0395901_0781929_279_563
Length 94
Sequence VSTVETATVRIPPVLRDTTGGEREVPASGGTVRELLEDLSARLPSLGERIYDGDLKPFVNVYVEGEDVRTRDGLETPIPAGATVILLPAMAGGC

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
92 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
93 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
94 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
95 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
96 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
97 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
98 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
99 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
181 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
182 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
183 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
184 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
203 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
204 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
205 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
206 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
207 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
208 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
254 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 11.18
Rhizosphere 88.33
Stem 0
Stem Tuber 0
Unclassified 4.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0781929 3300038443 Bacteria 945
2 JGI25407J50210_10000885 3300003373 Bacteria 6447
3 Ga0070676_11151888 3300005328 Bacteria 588
4 Ga0070683_100125155 3300005329 Bacteria 2430
5 Ga0070670_100461287 3300005331 Bacteria 1127
6 Ga0068869_100685034 3300005334 Bacteria 873
7 Ga0068869_101912294 3300005334 Bacteria 532
8 Ga0070680_100101968 3300005336 Bacteria 2383
9 Ga0070682_100005828 3300005337 Bacteria 6881
10 Ga0070682_100412221 3300005337 Bacteria 1025
11 Ga0070682_100474172 3300005337 Bacteria 964
12 Ga0068868_100100787 3300005338 Bacteria 2337
13 Ga0068868_100143083 3300005338 Bacteria 1965
14 Ga0068868_101482629 3300005338 Bacteria 635
15 Ga0070660_100139417 3300005339 Bacteria 1945
16 Ga0070689_100567165 3300005340 Bacteria 980
17 Ga0070689_101114994 3300005340 Bacteria 706
18 Ga0070691_10015735 3300005341 Bacteria 3476
19 Ga0070691_10103639 3300005341 Bacteria 1416
20 Ga0070691_10698556 3300005341 Bacteria 609
21 Ga0070691_10842083 3300005341 Bacteria 562
22 Ga0070692_10015585 3300005345 Bacteria 3598
23 Ga0070692_10505710 3300005345 Bacteria 784
24 Ga0070668_100868985 3300005347 Bacteria 804
25 Ga0070669_100029460 3300005353 Bacteria 3957
26 Ga0070671_100169652 3300005355 Bacteria 1845
27 Ga0070674_100016491 3300005356 Bacteria 4631
28 Ga0070673_100677234 3300005364 Bacteria 946
29 Ga0070673_101167404 3300005364 Bacteria 721
30 Ga0070673_101347939 3300005364 Bacteria 671
31 Ga0070659_100488217 3300005366 Bacteria 1049
32 Ga0070659_100568721 3300005366 Bacteria 972
33 Ga0070703_10235194 3300005406 Bacteria 736
34 Ga0070703_10431579 3300005406 Bacteria 580
35 Ga0070714_100205885 3300005435 Bacteria 1802
36 Ga0070714_100298015 3300005435 Bacteria 1502
37 Ga0070713_100120385 3300005436 Bacteria 2301
38 Ga0070710_10018279 3300005437 Bacteria 3604
39 Ga0070710_10864000 3300005437 Bacteria 650
40 Ga0070701_10658803 3300005438 Bacteria 700
41 Ga0070711_100466813 3300005439 Bacteria 1035
42 Ga0070711_101171423 3300005439 Bacteria 664
43 Ga0070711_101513487 3300005439 Bacteria 585
44 Ga0070711_101739918 3300005439 Bacteria 546
45 Ga0070705_100008009 3300005440 Bacteria 5223
46 Ga0070705_100066423 3300005440 Bacteria 2162
47 Ga0070705_100245519 3300005440 Bacteria 1254
48 Ga0070705_100588700 3300005440 Bacteria 859
49 Ga0070705_101875793 3300005440 Bacteria 509
50 Ga0070700_100840916 3300005441 Bacteria 742
51 Ga0070700_101513958 3300005441 Bacteria 571
52 Ga0070694_100792294 3300005444 Bacteria 776
53 Ga0070694_100811435 3300005444 Bacteria 768
54 Ga0070694_101097324 3300005444 Bacteria 664
55 Ga0070708_100003595 3300005445 Bacteria 12161
56 Ga0070708_100072082 3300005445 Bacteria 3112
57 Ga0070708_100142300 3300005445 Bacteria 2225
58 Ga0070708_101167186 3300005445 Bacteria 721
59 Ga0070708_101689314 3300005445 Bacteria 589
60 Ga0070678_100108735 3300005456 Bacteria 2165
61 Ga0070678_100113103 3300005456 Bacteria 2127
62 Ga0070678_101552708 3300005456 Bacteria 621
63 Ga0070662_100100076 3300005457 Bacteria 2192
64 Ga0070662_100781991 3300005457 Bacteria 811
65 Ga0070681_10185326 3300005458 Bacteria 2002
66 Ga0070681_10477837 3300005458 Bacteria 1159
67 Ga0068867_100090161 3300005459 Bacteria 2325
68 Ga0068867_100766238 3300005459 Bacteria 858
69 Ga0068867_101742862 3300005459 Bacteria 585
70 Ga0070685_10184457 3300005466 Bacteria 1346
71 Ga0070685_11056592 3300005466 Bacteria 612
72 Ga0070706_100015830 3300005467 Bacteria 6964
73 Ga0070706_100031968 3300005467 Bacteria 4853
74 Ga0070706_100102473 3300005467 Bacteria 2661
75 Ga0070706_100186840 3300005467 Bacteria 1936
76 Ga0070706_100774082 3300005467 Bacteria 889
77 Ga0070706_101143206 3300005467 Bacteria 716
78 Ga0070706_101817786 3300005467 Bacteria 554
79 Ga0070707_100004867 3300005468 Bacteria 12585
80 Ga0070707_100032904 3300005468 Bacteria 4941
81 Ga0070707_100101383 3300005468 Bacteria 2790
82 Ga0070707_101963110 3300005468 Bacteria 553
83 Ga0070698_100072430 3300005471 Bacteria 3453
84 Ga0070698_100573075 3300005471 Bacteria 1069
85 Ga0070698_101077118 3300005471 Bacteria 752
86 Ga0070698_102027710 3300005471 Bacteria 529
87 Ga0070699_100112362 3300005518 Bacteria 2393
88 Ga0070699_100211431 3300005518 Bacteria 1727
89 Ga0070699_101022894 3300005518 Bacteria 758
90 Ga0070679_100050445 3300005530 Bacteria 4145
91 Ga0070679_100162474 3300005530 Bacteria 2207
92 Ga0070679_101318195 3300005530 Bacteria 668
93 Ga0070697_100604802 3300005536 Bacteria 964
94 Ga0068853_100625305 3300005539 Bacteria 1024
95 Ga0068853_100998476 3300005539 Bacteria 806
96 Ga0070672_100497219 3300005543 Bacteria 1055
97 Ga0070686_100013318 3300005544 Bacteria 4704
98 Ga0070695_100133771 3300005545 Bacteria 1711
99 Ga0070695_100176144 3300005545 Bacteria 1512
100 Ga0070695_100711938 3300005545 Unclassified 798
101 Ga0070695_101073979 3300005545 Unclassified 658
102 Ga0070695_101523951 3300005545 Bacteria 557
103 Ga0070696_100168826 3300005546 Bacteria 1616
104 Ga0070696_100264692 3300005546 Bacteria 1305
105 Ga0070696_100608828 3300005546 Bacteria 881
106 Ga0070696_101018814 3300005546 Bacteria 692
107 Ga0070693_100045610 3300005547 Bacteria 2486
108 Ga0070693_100079880 3300005547 Bacteria 1947
109 Ga0070693_100402393 3300005547 Bacteria 949
110 Ga0070704_100230897 3300005549 Bacteria 1509
111 Ga0070704_100932265 3300005549 Bacteria 782
112 Ga0068855_100037273 3300005563 Bacteria 5784
113 Ga0068855_100051765 3300005563 Bacteria 4836
114 Ga0070664_100893973 3300005564 Bacteria 833
115 Ga0068854_100430664 3300005578 Bacteria 1097
116 Ga0068854_100684730 3300005578 Bacteria 884
117 Ga0068856_100288890 3300005614 Bacteria 1657
118 Ga0068856_100479767 3300005614 Bacteria 1264
119 Ga0068856_101140756 3300005614 Bacteria 796
120 Ga0068856_101242888 3300005614 Bacteria 761
121 Ga0070702_100180872 3300005615 Bacteria 1379
122 Ga0070702_100390355 3300005615 Bacteria 992
123 Ga0068859_100775742 3300005617 Bacteria 1047
124 Ga0068864_101179771 3300005618 Bacteria 764
125 Ga0068866_10301019 3300005718 Bacteria 1002
126 Ga0068861_100004201 3300005719 Bacteria 9660
127 Ga0068861_100024366 3300005719 Bacteria 4376
128 Ga0068861_100552203 3300005719 Bacteria 1050
129 Ga0068863_100791257 3300005841 Bacteria 946
130 Ga0068858_100726790 3300005842 Bacteria 967
131 Ga0068860_100352454 3300005843 Bacteria 1449
132 Ga0081455_10111535 3300005937 Bacteria 2173
133 Ga0081455_10251932 3300005937 Bacteria 1291
134 Ga0081455_10883264 3300005937 Bacteria 557
135 Ga0081538_10000085 3300005981 Bacteria 89830
136 Ga0081540_1044957 3300005983 Bacteria 2248
137 Ga0070717_10036876 3300006028 Bacteria 3967
138 Ga0070717_10166701 3300006028 Bacteria 1913
139 Ga0075365_10166320 3300006038 Bacteria 1538
140 Ga0075432_10055248 3300006058 Bacteria 1407
141 Ga0070716_100023631 3300006173 Bacteria 3261
142 Ga0070716_101508306 3300006173 Bacteria 550
143 Ga0070712_100547640 3300006175 Bacteria 974
144 Ga0070712_100733082 3300006175 Bacteria 845
145 Ga0070712_101717436 3300006175 Bacteria 549
146 Ga0097621_100691418 3300006237 Bacteria 938
147 Ga0068871_100033784 3300006358 Bacteria 4052
148 Ga0068871_101905903 3300006358 Bacteria 565
149 Ga0075428_101231170 3300006844 Bacteria 788
150 Ga0075428_101453655 3300006844 Unclassified 719
151 Ga0075431_100480355 3300006847 Bacteria 1235
152 Ga0075433_10579096 3300006852 Bacteria 986
153 Ga0075433_10612525 3300006852 Bacteria 956
154 Ga0075433_10778223 3300006852 Bacteria 837
155 Ga0075434_100235970 3300006871 Bacteria 1849
156 Ga0075434_100578386 3300006871 Bacteria 1142
157 Ga0075434_100911296 3300006871 Bacteria 894
158 Ga0075434_101306855 3300006871 Bacteria 736
159 Ga0075434_101436639 3300006871 Unclassified 699
160 Ga0068865_100183330 3300006881 Bacteria 1613
161 Ga0075436_100177360 3300006914 Bacteria 1505
162 Ga0075436_100814691 3300006914 Bacteria 696
163 Ga0097620_100775808 3300006931 Bacteria 1047
164 Ga0075435_100011661 3300007076 Bacteria 6478
165 Ga0075435_100406436 3300007076 Bacteria 1171
166 Ga0075435_101328693 3300007076 Bacteria 630
167 Ga0105240_10355462 3300009093 Bacteria 1661
168 Ga0105240_11345019 3300009093 Bacteria 752
169 Ga0105240_11491987 3300009093 Bacteria 709
170 Ga0111539_10725360 3300009094 Bacteria 1157
171 Ga0111539_11398536 3300009094 Bacteria 812
172 Ga0111539_11579330 3300009094 Bacteria 761
173 Ga0105245_10028297 3300009098 Bacteria 4942
174 Ga0105245_10037474 3300009098 Bacteria 4311
175 Ga0105245_10110550 3300009098 Bacteria 2555
176 Ga0105245_11274268 3300009098 Bacteria 784
177 Ga0114129_10674543 3300009147 Bacteria 1331
178 Ga0114129_11775279 3300009147 Unclassified 751
179 Ga0114129_11897818 3300009147 Bacteria 722
180 Ga0105243_10346506 3300009148 Bacteria 1363
181 Ga0105241_10161904 3300009174 Bacteria 1840
182 Ga0105241_10593124 3300009174 Bacteria 1000
183 Ga0105242_11050828 3300009176 Bacteria 825
184 Ga0105242_11155192 3300009176 Bacteria 791
185 Ga0105242_11937054 3300009176 Unclassified 630
186 Ga0105242_12489538 3300009176 Unclassified 566
187 Ga0105248_10714640 3300009177 Bacteria 1131
188 Ga0105248_11007099 3300009177 Bacteria 941
189 Ga0105248_11110323 3300009177 Bacteria 894
190 Ga0105237_10112869 3300009545 Bacteria 2710
191 Ga0105238_10552182 3300009551 Bacteria 1156
192 Ga0105249_10018223 3300009553 Bacteria 6241
193 Ga0105249_10098455 3300009553 Bacteria 2747
194 Ga0105249_10797604 3300009553 Bacteria 1008
195 Ga0105239_10053963 3300010375 Bacteria 4407
196 Ga0105239_10329967 3300010375 Bacteria 1721
197 Ga0105239_10521196 3300010375 Bacteria 1352
198 Ga0105239_12439450 3300010375 Bacteria 609
199 Ga0105239_13250841 3300010375 Unclassified 529
200 Ga0105246_11536348 3300011119 Bacteria 627
201 Ga0157317_1013122 3300012475 Bacteria 664
202 Ga0157317_1034049 3300012475 Unclassified 508
203 Ga0157320_1036685 3300012481 Unclassified 516
204 Ga0157325_1010218 3300012485 Bacteria 685
205 Ga0157329_1022487 3300012491 Bacteria 601
206 Ga0157313_1065834 3300012503 Bacteria 506
207 Ga0157342_1006476 3300012507 Bacteria 1109
208 Ga0157316_1003005 3300012510 Bacteria 1188
209 Ga0157326_1036308 3300012513 Bacteria 674
210 Ga0157338_1013984 3300012515 Bacteria 859
211 Ga0157373_10311717 3300013100 Bacteria 1118
212 Ga0157370_11055912 3300013104 Bacteria 734
213 Ga0157369_11072931 3300013105 Bacteria 823
214 Ga0157369_11283212 3300013105 Bacteria 747
215 Ga0157369_12622303 3300013105 Bacteria 509
216 Ga0157378_12014951 3300013297 Bacteria 627
217 Ga0157378_12070854 3300013297 Bacteria 619
218 Ga0163162_10018642 3300013306 Bacteria 6800
219 Ga0157372_10037315 3300013307 Bacteria 5359
220 Ga0157372_10568482 3300013307 Bacteria 1321
221 Ga0157375_10547232 3300013308 Bacteria 1319
222 Ga0157375_10673928 3300013308 Bacteria 1189
223 Ga0157375_11490456 3300013308 Bacteria 798
224 Ga0157375_13336831 3300013308 Bacteria 535
225 Ga0163163_10060888 3300014325 Bacteria 3739
226 Ga0163163_12636468 3300014325 Unclassified 560
227 Ga0157380_10942588 3300014326 Bacteria 893
228 Ga0157380_11294616 3300014326 Bacteria 776
229 Ga0182008_10062559 3300014497 Bacteria 1834
230 Ga0157379_11728916 3300014968 Bacteria 613
231 Ga0157376_10118447 3300014969 Bacteria 2343
232 Ga0157376_12048519 3300014969 Unclassified 610
233 Ga0182005_1115851 3300015265 Bacteria 760
234 Ga0163161_10423871 3300017792 Bacteria 1071
235 Ga0206351_10371502 3300020077 Bacteria 1757
236 Ga0206350_11598520 3300020080 Bacteria 545
237 Ga0206354_11178650 3300020081 Bacteria 1076
238 Ga0206354_11318228 3300020081 Bacteria 643
239 Ga0206353_10361820 3300020082 Bacteria 7300
240 Ga0207653_10085302 3300025885 Bacteria 1099
241 Ga0207692_10036272 3300025898 Bacteria 2402
242 Ga0207692_10210352 3300025898 Bacteria 1148
243 Ga0207642_10259275 3300025899 Bacteria 990
244 Ga0207688_10128629 3300025901 Bacteria 1483
245 Ga0207680_10209188 3300025903 Bacteria 1333
246 Ga0207699_10170371 3300025906 Bacteria 1456
247 Ga0207699_10529270 3300025906 Bacteria 853
248 Ga0207645_10326845 3300025907 Bacteria 1024
249 Ga0207643_10823717 3300025908 Bacteria 601
250 Ga0207684_10050709 3300025910 Bacteria 3521
251 Ga0207684_10078440 3300025910 Bacteria 2809
252 Ga0207684_10085754 3300025910 Bacteria 2682
253 Ga0207684_10110228 3300025910 Bacteria 2356
254 Ga0207684_10160049 3300025910 Bacteria 1939
255 Ga0207684_11038568 3300025910 Unclassified 684
256 Ga0207654_10094325 3300025911 Bacteria 1831
257 Ga0207654_11079455 3300025911 Bacteria 585
258 Ga0207707_10168556 3300025912 Bacteria 1913
259 Ga0207707_10364595 3300025912 Bacteria 1244
260 Ga0207695_10438055 3300025913 Bacteria 1190
261 Ga0207693_10081623 3300025915 Bacteria 2531
262 Ga0207693_10402835 3300025915 Bacteria 1069
263 Ga0207693_10438854 3300025915 Bacteria 1020
264 Ga0207663_10148977 3300025916 Bacteria 1639
265 Ga0207663_10420960 3300025916 Bacteria 1025
266 Ga0207663_10756840 3300025916 Bacteria 772
267 Ga0207663_11603024 3300025916 Bacteria 524
268 Ga0207660_10020276 3300025917 Bacteria 4457
269 Ga0207660_11096500 3300025917 Bacteria 649
270 Ga0207662_10067899 3300025918 Bacteria 2151
271 Ga0207657_10038460 3300025919 Bacteria 4259
272 Ga0207652_10101174 3300025921 Bacteria 2545
273 Ga0207652_11476625 3300025921 Bacteria 584
274 Ga0207646_10021823 3300025922 Bacteria 5908
275 Ga0207646_10165595 3300025922 Bacteria 1996
276 Ga0207646_10533704 3300025922 Unclassified 1056
277 Ga0207646_11242760 3300025922 Bacteria 652
278 Ga0207646_11535460 3300025922 Bacteria 576
279 Ga0207694_11723321 3300025924 Bacteria 527
280 Ga0207687_10072839 3300025927 Bacteria 2459
281 Ga0207687_10341282 3300025927 Bacteria 1218
282 Ga0207687_10473307 3300025927 Bacteria 1042
283 Ga0207687_11294408 3300025927 Bacteria 627
284 Ga0207700_10884661 3300025928 Bacteria 799
285 Ga0207700_10921341 3300025928 Bacteria 782
286 Ga0207664_10264775 3300025929 Bacteria 1504
287 Ga0207664_10347646 3300025929 Bacteria 1312
288 Ga0207644_10176429 3300025931 Bacteria 1672
289 Ga0207690_10434781 3300025932 Bacteria 1052
290 Ga0207706_10096472 3300025933 Bacteria 2600
291 Ga0207706_11711393 3300025933 Unclassified 506
292 Ga0207686_10103472 3300025934 Bacteria 1905
293 Ga0207686_11237026 3300025934 Unclassified 612
294 Ga0207686_11766566 3300025934 Bacteria 512
295 Ga0207709_10029716 3300025935 Bacteria 3173
296 Ga0207670_11292740 3300025936 Bacteria 618
297 Ga0207669_11468805 3300025937 Bacteria 581
298 Ga0207704_10107823 3300025938 Bacteria 1874
299 Ga0207704_10800488 3300025938 Bacteria 787
300 Ga0207665_10012811 3300025939 Bacteria 5513
301 Ga0207691_10168175 3300025940 Bacteria 1921
302 Ga0207711_11233714 3300025941 Bacteria 689
303 Ga0207689_10722667 3300025942 Bacteria 840
304 Ga0207661_10393634 3300025944 Bacteria 1256
305 Ga0207661_11943826 3300025944 Bacteria 534
306 Ga0207679_10209579 3300025945 Bacteria 1633
307 Ga0207679_10490336 3300025945 Bacteria 1095
308 Ga0207679_11189175 3300025945 Bacteria 700
309 Ga0207667_10024327 3300025949 Bacteria 6650
310 Ga0207667_11457563 3300025949 Bacteria 657
311 Ga0207651_10423286 3300025960 Bacteria 1137
312 Ga0207651_10448944 3300025960 Bacteria 1106
313 Ga0207712_10025265 3300025961 Bacteria 3946
314 Ga0207712_10289527 3300025961 Bacteria 1340
315 Ga0207712_10663485 3300025961 Bacteria 907
316 Ga0207668_10440208 3300025972 Bacteria 1110
317 Ga0207640_10326249 3300025981 Bacteria 1224
318 Ga0207640_10735448 3300025981 Bacteria 849
319 Ga0207658_10866160 3300025986 Bacteria 822
320 Ga0207677_10184217 3300026023 Bacteria 1645
321 Ga0207677_10960008 3300026023 Bacteria 773
322 Ga0207677_11471427 3300026023 Bacteria 629
323 Ga0207703_10472081 3300026035 Bacteria 1175
324 Ga0207639_11492475 3300026041 Bacteria 634
325 Ga0207678_10010207 3300026067 Bacteria 8244
326 Ga0207708_10000986 3300026075 Bacteria 21267
327 Ga0207702_10349524 3300026078 Bacteria 1414
328 Ga0207702_10394421 3300026078 Bacteria 1333
329 Ga0207641_11734647 3300026088 Bacteria 626
330 Ga0207648_10025185 3300026089 Bacteria 5304
331 Ga0207648_10942532 3300026089 Bacteria 807
332 Ga0207648_11313963 3300026089 Unclassified 679
333 Ga0207648_11947047 3300026089 Bacteria 549
334 Ga0207676_10359513 3300026095 Bacteria 1349
335 Ga0207675_100000145 3300026118 Bacteria 61287
336 Ga0207675_100021776 3300026118 Bacteria 5967
337 Ga0207675_100607771 3300026118 Bacteria 1097
338 Ga0207683_10038710 3300026121 Bacteria 4158
339 Ga0207683_10248206 3300026121 Bacteria 1624
340 Ga0209966_1067469 3300027695 Unclassified 780
341 Ga0209998_10000265 3300027717 Bacteria 17002
342 Ga0268265_10561651 3300028380 Bacteria 1085
343 Ga0268264_10654003 3300028381 Bacteria 1040
344 Ga0265336_10132552 3300028666 Bacteria 742
345 Ga0265331_10179611 3300031250 Bacteria 956
346 Ga0307405_10264270 3300031731 Bacteria 1287
347 Ga0307415_102478154 3300032126 Bacteria 511
348 Ga0373930_0005294 3300034816 Bacteria 2140
349 Ga0373950_0166971 3300034818 Bacteria 511
350 Ga0373958_0015461 3300034819 Bacteria 1349
351 Ga0373959_0111292 3300034820 Bacteria 661
352 Ga0373929_0001355 3300035085 Bacteria 4697
353 Ga0373940_0094883 3300035088 Bacteria 898
354 Ga0373944_0030043 3300035089 Bacteria 1628
355 Ga0373944_0221417 3300035089 Bacteria 691
356 Ga0373951_0080309 3300035091 Bacteria 843
357 Ga0373932_0021593 3300035112 Bacteria 1701
358 Ga0373960_0097891 3300035121 Bacteria 947
359 Ga0373943_0006293 3300035170 Bacteria 5330
360 Ga0373943_0458125 3300035170 Bacteria 742
361 Ga0373946_0457258 3300035171 Bacteria 651
362 Ga0373962_0216145 3300035242 Bacteria 654
363 Ga0373931_0104992 3300035691 Bacteria 1594
364 Ga0373931_0266177 3300035691 Bacteria 1048
365 Ga0373935_0114011 3300035692 Bacteria 1797
366 Ga0373927_0120789 3300035695 Bacteria 1710
367 Ga0373947_0001046 3300035725 Bacteria 16888
368 Ga0373947_0214365 3300035725 Bacteria 1264
369 Ga0373925_0025256 3300037068 Bacteria 4339
370 Ga0395899_0008752 3300037312 Bacteria 7789
371 Ga0395899_0040915 3300037312 Bacteria 3465
372 Ga0395899_0042316 3300037312 Bacteria 3401
373 Ga0395899_0701815 3300037312 Bacteria 634
374 Ga0395900_0007578 3300037418 Bacteria 11209
375 Ga0395900_0016813 3300037418 Bacteria 7461
376 Ga0395900_0020259 3300037418 Bacteria 6788
377 Ga0395900_0022467 3300037418 Bacteria 6451
378 Ga0395900_0040501 3300037418 Bacteria 4801
379 Ga0395900_0324827 3300037418 Bacteria 1518
380 Ga0395898_0001745 3300037466 Bacteria 28669
381 Ga0395898_0014653 3300037466 Bacteria 8051
382 Ga0395898_0053071 3300037466 Bacteria 3959
383 Ga0395898_0236995 3300037466 Bacteria 1740
384 Ga0395905_0001814 3300037471 Bacteria 24709
385 Ga0395905_0003900 3300037471 Bacteria 15734
386 Ga0395905_0040045 3300037471 Bacteria 4396
387 Ga0395905_0045731 3300037471 Bacteria 4105
388 Ga0395905_1640465 3300037471 Bacteria 548
389 Ga0395901_0052895 3300038443 Bacteria 4221
390 Ga0395901_0108797 3300038443 Bacteria 2909
391 Ga0395901_0138390 3300038443 Bacteria 2559
392 Ga0395901_0160833 3300038443 Bacteria 2358
393 Ga0395901_0196757 3300038443 Bacteria 2113
394 Ga0395901_0419990 3300038443 Bacteria 1371
395 Ga0395901_1222435 3300038443 Bacteria 716
396 Ga0451804_1113261 3300041463 Bacteria 748
397 Ga0439448_0037021 3300042005 Bacteria 1566
398 Ga0439448_0112688 3300042005 Bacteria 930
399 Ga0439450_032945 3300042008 Bacteria 1173
400 Ga0439458_0008668 3300042157 Bacteria 2266
401 Ga0439444_0188457 3300042437 Bacteria 515
402 Ga0439464_0126533 3300042439 Bacteria 790
403 Ga0450916_068630 3300042530 Bacteria 588
404 Ga0466963_0111415 3300044694 Bacteria 1879
405 Ga0466963_0589636 3300044694 Bacteria 785
406 Ga0466957_0177437 3300044842 Bacteria 1390
407 Ga0466957_0643301 3300044842 Bacteria 745
408 Ga0451576_0504066 3300045051 Bacteria 1272
409 Ga0466958_0055461 3300045836 Bacteria 2405
410 Ga0466958_0177773 3300045836 Bacteria 1350
411 Ga0466967_0155064 3300045976 Bacteria 2144
412 Ga0466967_0471177 3300045976 Bacteria 1229
413 Ga0466967_0751919 3300045976 Bacteria 967
414 Ga0495592_0580409 3300046454 Unclassified 686
415 Ga0495603_0001199 3300046455 Bacteria 15128
416 Ga0495590_0225707 3300046457 Bacteria 693
417 Ga0495629_0794414 3300046459 Unclassified 624
418 Ga0495641_0005902 3300046461 Bacteria 8084
419 Ga0495641_0095656 3300046461 Bacteria 1326
420 Ga0495580_0146168 3300046472 Bacteria 1638
421 Ga0495582_0066903 3300046473 Bacteria 1985
422 Ga0495605_0479917 3300046474 Bacteria 510
423 Ga0495639_0153249 3300046475 Bacteria 1113
424 Ga0495585_0074927 3300046492 Bacteria 1841
425 Ga0495594_0001547 3300046499 Bacteria 11942
426 Ga0495596_0163697 3300046500 Bacteria 865
427 Ga0495620_0237816 3300046515 Bacteria 695
428 Ga0495630_1054467 3300046517 Bacteria 617
429 Ga0495630_1221424 3300046517 Bacteria 568
430 Ga0495637_0221873 3300046520 Bacteria 688
431 Ga0495644_0189374 3300046523 Bacteria 792
432 Ga0495663_0090346 3300046525 Bacteria 998
433 Ga0495666_0105980 3300046526 Bacteria 1323
434 Ga0495586_0136664 3300046535 Bacteria 1374
435 Ga0495597_0161383 3300046542 Bacteria 915
436 Ga0495622_0064092 3300046557 Bacteria 1700
437 Ga0495656_0253956 3300046615 Bacteria 889
438 Ga0495611_0270521 3300046648 Bacteria 786
439 Ga0495635_0891810 3300046663 Bacteria 570
440 Ga0495659_0509733 3300046664 Bacteria 528
441 Ga0495588_0001116 3300046674 Bacteria 11554
442 Ga0495599_0235360 3300046678 Bacteria 1118
443 Ga0495647_0016187 3300046681 Bacteria 2622
444 Ga0495658_0037651 3300046683 Bacteria 2675
445 Ga0495669_0183204 3300046684 Bacteria 999
446 Ga0495613_0358202 3300046689 Bacteria 1001
447 Ga0495624_0125846 3300046690 Bacteria 1573
448 Ga0495670_0775634 3300046691 Bacteria 523
449 Ga0495589_0153049 3300046794 Bacteria 1101
450 Ga0495581_0416100 3300047315 Bacteria 784
451 Ga0495604_0847489 3300047317 Bacteria 574
452 Ga0495674_1180568 3300047319 Bacteria 579
453 Ga0495676_0002134 3300047321 Bacteria 17473
454 Ga0495676_0088556 3300047321 Bacteria 2321
455 Ga0495680_0328947 3300047322 Bacteria 1068
456 Ga0495677_0292443 3300047445 Bacteria 640
457 Ga0495686_0000020 3300047472 Bacteria 429191
458 Ga0495686_0018236 3300047472 Bacteria 4714
459 Ga0496100_0022420 3300048903 Bacteria 3821
460 Ga0496100_0167572 3300048903 Bacteria 1579
461 Ga0496100_0498342 3300048903 Bacteria 938
462 Ga0496101_0047122 3300048904 Bacteria 3093
463 Ga0496101_0229862 3300048904 Bacteria 1441
464 Ga0496101_0460105 3300048904 Bacteria 1004
465 Ga0496101_1517090 3300048904 Bacteria 521
466 Ga0496102_0082434 3300048905 Bacteria 2966
467 Ga0496102_0124176 3300048905 Bacteria 2412
468 Ga0496102_0127002 3300048905 Bacteria 2384
469 Ga0496102_0593918 3300048905 Bacteria 1030
470 Ga0496102_1641480 3300048905 Bacteria 561
471 Ga0496102_1823727 3300048905 Bacteria 525
472 Ga0496103_0009681 3300048906 Bacteria 5704
473 Ga0496103_0226960 3300048906 Bacteria 1201
474 Ga0496103_0661084 3300048906 Bacteria 663
475 Ga0496103_0688088 3300048906 Bacteria 648
476 Ga0496104_0000381 3300048907 Bacteria 38927
477 Ga0496104_0047482 3300048907 Bacteria 4046
478 Ga0496104_0126774 3300048907 Bacteria 2451
479 Ga0496104_0219887 3300048907 Bacteria 1812
480 Ga0496105_0001956 3300048908 Bacteria 14786
481 Ga0496105_0063098 3300048908 Bacteria 3057
482 Ga0496105_0369545 3300048908 Bacteria 1143
483 Ga0496105_0893897 3300048908 Bacteria 670
484 Ga0496106_0159920 3300048909 Bacteria 1781
485 Ga0496106_0930251 3300048909 Bacteria 685
486 Ga0496107_0047855 3300048910 Bacteria 3079
487 Ga0496107_0051652 3300048910 Bacteria 2965
488 Ga0496107_0640954 3300048910 Bacteria 784
489 Ga0496107_0820349 3300048910 Bacteria 680
490 Ga0496108_0001352 3300048911 Bacteria 19278
491 Ga0496108_0016177 3300048911 Bacteria 6082
492 Ga0496108_0126890 3300048911 Bacteria 2191
493 Ga0496108_1047995 3300048911 Bacteria 695
494 Ga0496108_1272263 3300048911 Unclassified 620
495 Ga0496108_1715909 3300048911 Unclassified 516
496 Ga0496109_0001686 3300048912 Bacteria 18402
497 Ga0496109_0006342 3300048912 Bacteria 9960
498 Ga0496109_0146012 3300048912 Bacteria 2213
499 Ga0496109_0331113 3300048912 Bacteria 1438
500 Ga0496109_0460760 3300048912 Bacteria 1201
501 Ga0496110_0000890 3300048913 Bacteria 21075
502 Ga0496110_0020623 3300048913 Bacteria 5568
503 Ga0496110_0072717 3300048913 Bacteria 3051
504 Ga0496110_0183669 3300048913 Bacteria 1899
505 Ga0496111_0000043 3300048914 Bacteria 49176
506 Ga0496111_0011064 3300048914 Bacteria 6072
507 Ga0496111_0055595 3300048914 Bacteria 2863
508 Ga0496111_0357548 3300048914 Unclassified 1081
509 Ga0496111_0575132 3300048914 Bacteria 826
510 Ga0496112_0000145 3300048915 Bacteria 44395
511 Ga0496112_0050076 3300048915 Bacteria 4095
512 Ga0496112_0080997 3300048915 Bacteria 3210
513 Ga0496112_0547638 3300048915 Bacteria 1091
514 Ga0496112_0764735 3300048915 Bacteria 892
515 Ga0496113_0000298 3300048916 Bacteria 23527
516 Ga0496113_0009512 3300048916 Bacteria 6375
517 Ga0496113_0575265 3300048916 Bacteria 903
518 Ga0496113_0782945 3300048916 Bacteria 758
519 Ga0496113_0989726 3300048916 Bacteria 663
520 Ga0496114_0021144 3300048917 Bacteria 5291
521 Ga0496114_0148910 3300048917 Bacteria 2030
522 Ga0496114_1033939 3300048917 Bacteria 705
523 Ga0496114_1090596 3300048917 Bacteria 683
524 Ga0496115_0015354 3300048918 Bacteria 5808
525 Ga0496115_0241395 3300048918 Bacteria 1489
526 Ga0496115_0842242 3300048918 Bacteria 711
527 Ga0501031_0003866 3300049568 Bacteria 9635
528 Ga0501031_0050109 3300049568 Bacteria 2721
529 Ga0501032_0033282 3300049569 Bacteria 3532
530 Ga0501032_0109200 3300049569 Bacteria 1831
531 Ga0501033_0066001 3300049570 Bacteria 2661
532 Ga0501034_0198760 3300049571 Bacteria 1964
533 Ga0501036_0052996 3300049572 Bacteria 3435
534 Ga0501036_0056337 3300049572 Bacteria 3330
535 Ga0501037_0352348 3300049573 Bacteria 1015
536 Ga0501038_0003554 3300049574 Bacteria 14503
537 Ga0501038_0090879 3300049574 Bacteria 2558
538 Ga0501039_0063212 3300049575 Bacteria 2868
539 Ga0501039_0129462 3300049575 Bacteria 1980
540 Ga0501040_0019882 3300049576 Bacteria 4469
541 Ga0501040_0043328 3300049576 Bacteria 3067
542 Ga0501040_1049041 3300049576 Bacteria 591
543 Ga0501041_0022025 3300049577 Bacteria 3815
544 Ga0501042_0014559 3300049578 Bacteria 5371
545 Ga0501042_0150897 3300049578 Bacteria 1676
546 Ga0501043_0007634 3300049579 Bacteria 8569
547 Ga0501046_0042337 3300049580 Bacteria 3631
548 Ga0501046_0453823 3300049580 Bacteria 922
549 Ga0501048_0018300 3300049582 Bacteria 5154
550 Ga0501048_0031950 3300049582 Bacteria 3805
551 Ga0501067_0014092 3300049583 Bacteria 4429
552 Ga0501067_0032096 3300049583 Bacteria 2914
553 Ga0501067_0836786 3300049583 Bacteria 519
554 Ga0501068_0001205 3300049584 Bacteria 13752
555 Ga0501069_0000854 3300049585 Bacteria 14451
556 Ga0501069_0003597 3300049585 Bacteria 7984
557 Ga0501070_0019789 3300049586 Bacteria 5645
558 Ga0501070_0112699 3300049586 Bacteria 2248
559 Ga0501071_0007583 3300049587 Bacteria 7144
560 Ga0501071_0020623 3300049587 Bacteria 4582
561 Ga0501072_0074434 3300049588 Bacteria 2685
562 Ga0501072_0940553 3300049588 Bacteria 674
563 Ga0501073_0014050 3300049589 Bacteria 5817
564 Ga0501073_0118008 3300049589 Bacteria 1839
565 Ga0501074_0001178 3300049590 Bacteria 17155
566 Ga0501074_0407181 3300049590 Bacteria 965
567 Ga0501075_0295809 3300049591 Bacteria 1233
568 Ga0501076_0024954 3300049592 Bacteria 4624
569 Ga0501076_0051153 3300049592 Bacteria 3269
570 Ga0501076_0160937 3300049592 Bacteria 1828
571 Ga0501077_0546055 3300049593 Bacteria 743
572 Ga0501079_0009593 3300049741 Bacteria 7340
573 Ga0501079_0440608 3300049741 Bacteria 1023
574 Ga0501079_1439887 3300049741 Bacteria 542
575 Ga0501080_0022583 3300049742 Bacteria 5828
576 Ga0501081_0005931 3300049743 Bacteria 7908
577 Ga0501081_0335023 3300049743 Bacteria 1113
578 Ga0501081_1284801 3300049743 Bacteria 555
579 Ga0501083_0188274 3300049744 Bacteria 1347
580 Ga0501035_0037131 3300049822 Bacteria 4413
581 Ga0501035_0198411 3300049822 Bacteria 1722
582 Ga0501044_0013648 3300049823 Bacteria 8780
583 Ga0501044_0313536 3300049823 Bacteria 1495
584 Ga0501045_0005247 3300049824 Bacteria 8963
585 Ga0501045_0376605 3300049824 Bacteria 1056
586 nmdc:mga00v17_692147_c1 3300050491 Bacteria 654
587 nmdc:mga0yw44_205905_c1 3300050492 Bacteria 1300
588 nmdc:mga05p37_1397191_c1 3300050507 Bacteria 705
589 nmdc:mga05p37_2122332_c1 3300050507 Unclassified 525
590 nmdc:mga05p37_80842_c1 3300050507 Bacteria 4003
591 nmdc:mga09592_907032_c1 3300050508 Bacteria 740
592 nmdc:mga06r32_1813296_c1 3300050510 Bacteria 545
593 nmdc:mga06r32_641415_c1 3300050510 Bacteria 1031
594 nmdc:mga08y16_2081973_c1 3300050511 Bacteria 515
595 nmdc:mga08y16_390566_c1 3300050511 Bacteria 1426
596 nmdc:mga0n895_1043769_c1 3300050512 Bacteria 797
597 nmdc:mga0n895_195913_c1 3300050512 Bacteria 2052
598 nmdc:mga0n895_365086_c1 3300050512 Bacteria 1462
599 nmdc:mga0n895_670714_c1 3300050512 Bacteria 1034
600 nmdc:mga0n895_948786_c1 3300050512 Bacteria 844
601 nmdc:mga0rr50_1468522_c1 3300050513 Bacteria 577
602 nmdc:mga0rr50_463293_c1 3300050513 Bacteria 1075
603 nmdc:mga0rr50_63439_c1 3300050513 Bacteria 2791
604 nmdc:mga08x19_188628_c1 3300050514 Bacteria 1410
605 nmdc:mga08x19_38359_c1 3300050514 Bacteria 3044
606 nmdc:mga08x19_942295_c1 3300050514 Unclassified 613
607 nmdc:mga0a205_1037547_c1 3300050515 Bacteria 667
608 nmdc:mga0a205_207132_c1 3300050515 Bacteria 1850
609 nmdc:mga0a205_226161_c1 3300050515 Bacteria 1756
610 nmdc:mga0a205_740446_c1 3300050515 Bacteria 832
611 Ga0501084_0158834 3300054114 Bacteria 1907
612 Ga0501082_0125656 3300060353 Bacteria 2224
613 Ga0501082_0235347 3300060353 Bacteria 1594
614 Ga0501082_1255999 3300060353 Bacteria 647
615 Ga0530510_0037921 3300061734 Bacteria 3477
616 Ga0530510_0042351 3300061734 Bacteria 3289
617 Ga0530510_1253617 3300061734 Unclassified 568
618 Ga0395901_0781929
619 JGI25407J50210_10000885
620 Ga0070676_11151888
621 Ga0070683_100125155
622 Ga0070670_100461287
623 Ga0068869_100685034
624 Ga0068869_101912294
625 Ga0070680_100101968
626 Ga0070682_100005828
627 Ga0070682_100412221
628 Ga0070682_100474172
629 Ga0068868_100100787
630 Ga0068868_100143083
631 Ga0068868_101482629
632 Ga0070660_100139417
633 Ga0070689_100567165
634 Ga0070689_101114994
635 Ga0070691_10015735
636 Ga0070691_10103639
637 Ga0070691_10698556
638 Ga0070691_10842083
639 Ga0070692_10015585
640 Ga0070692_10505710
641 Ga0070668_100868985
642 Ga0070669_100029460
643 Ga0070671_100169652
644 Ga0070674_100016491
645 Ga0070673_100677234
646 Ga0070673_101167404
647 Ga0070673_101347939
648 Ga0070659_100488217
649 Ga0070659_100568721
650 Ga0070703_10235194
651 Ga0070703_10431579
652 Ga0070714_100205885
653 Ga0070714_100298015
654 Ga0070713_100120385
655 Ga0070710_10018279
656 Ga0070710_10864000
657 Ga0070701_10658803
658 Ga0070711_100466813
659 Ga0070711_101171423
660 Ga0070711_101513487
661 Ga0070711_101739918
662 Ga0070705_100008009
663 Ga0070705_100066423
664 Ga0070705_100245519
665 Ga0070705_100588700
666 Ga0070705_101875793
667 Ga0070700_100840916
668 Ga0070700_101513958
669 Ga0070694_100792294
670 Ga0070694_100811435
671 Ga0070694_101097324
672 Ga0070708_100003595
673 Ga0070708_100072082
674 Ga0070708_100142300
675 Ga0070708_101167186
676 Ga0070708_101689314
677 Ga0070678_100108735
678 Ga0070678_100113103
679 Ga0070678_101552708
680 Ga0070662_100100076
681 Ga0070662_100781991
682 Ga0070681_10185326
683 Ga0070681_10477837
684 Ga0068867_100090161
685 Ga0068867_100766238
686 Ga0068867_101742862
687 Ga0070685_10184457
688 Ga0070685_11056592
689 Ga0070706_100015830
690 Ga0070706_100031968
691 Ga0070706_100102473
692 Ga0070706_100186840
693 Ga0070706_100774082
694 Ga0070706_101143206
695 Ga0070706_101817786
696 Ga0070707_100004867
697 Ga0070707_100032904
698 Ga0070707_100101383
699 Ga0070707_101963110
700 Ga0070698_100072430
701 Ga0070698_100573075
702 Ga0070698_101077118
703 Ga0070698_102027710
704 Ga0070699_100112362
705 Ga0070699_100211431
706 Ga0070699_101022894
707 Ga0070679_100050445
708 Ga0070679_100162474
709 Ga0070679_101318195
710 Ga0070697_100604802
711 Ga0068853_100625305
712 Ga0068853_100998476
713 Ga0070672_100497219
714 Ga0070686_100013318
715 Ga0070695_100133771
716 Ga0070695_100176144
717 Ga0070695_100711938
718 Ga0070695_101073979
719 Ga0070695_101523951
720 Ga0070696_100168826
721 Ga0070696_100264692
722 Ga0070696_100608828
723 Ga0070696_101018814
724 Ga0070693_100045610
725 Ga0070693_100079880
726 Ga0070693_100402393
727 Ga0070704_100230897
728 Ga0070704_100932265
729 Ga0068855_100037273
730 Ga0068855_100051765
731 Ga0070664_100893973
732 Ga0068854_100430664
733 Ga0068854_100684730
734 Ga0068856_100288890
735 Ga0068856_100479767
736 Ga0068856_101140756
737 Ga0068856_101242888
738 Ga0070702_100180872
739 Ga0070702_100390355
740 Ga0068859_100775742
741 Ga0068864_101179771
742 Ga0068866_10301019
743 Ga0068861_100004201
744 Ga0068861_100024366
745 Ga0068861_100552203
746 Ga0068863_100791257
747 Ga0068858_100726790
748 Ga0068860_100352454
749 Ga0081455_10111535
750 Ga0081455_10251932
751 Ga0081455_10883264
752 Ga0081538_10000085
753 Ga0081540_1044957
754 Ga0070717_10036876
755 Ga0070717_10166701
756 Ga0075365_10166320
757 Ga0075432_10055248
758 Ga0070716_100023631
759 Ga0070716_101508306
760 Ga0070712_100547640
761 Ga0070712_100733082
762 Ga0070712_101717436
763 Ga0097621_100691418
764 Ga0068871_100033784
765 Ga0068871_101905903
766 Ga0075428_101231170
767 Ga0075428_101453655
768 Ga0075431_100480355
769 Ga0075433_10579096
770 Ga0075433_10612525
771 Ga0075433_10778223
772 Ga0075434_100235970
773 Ga0075434_100578386
774 Ga0075434_100911296
775 Ga0075434_101306855
776 Ga0075434_101436639
777 Ga0068865_100183330
778 Ga0075436_100177360
779 Ga0075436_100814691
780 Ga0097620_100775808
781 Ga0075435_100011661
782 Ga0075435_100406436
783 Ga0075435_101328693
784 Ga0105240_10355462
785 Ga0105240_11345019
786 Ga0105240_11491987
787 Ga0111539_10725360
788 Ga0111539_11398536
789 Ga0111539_11579330
790 Ga0105245_10028297
791 Ga0105245_10037474
792 Ga0105245_10110550
793 Ga0105245_11274268
794 Ga0114129_10674543
795 Ga0114129_11775279
796 Ga0114129_11897818
797 Ga0105243_10346506
798 Ga0105241_10161904
799 Ga0105241_10593124
800 Ga0105242_11050828
801 Ga0105242_11155192
802 Ga0105242_11937054
803 Ga0105242_12489538
804 Ga0105248_10714640
805 Ga0105248_11007099
806 Ga0105248_11110323
807 Ga0105237_10112869
808 Ga0105238_10552182
809 Ga0105249_10018223
810 Ga0105249_10098455
811 Ga0105249_10797604
812 Ga0105239_10053963
813 Ga0105239_10329967
814 Ga0105239_10521196
815 Ga0105239_12439450
816 Ga0105239_13250841
817 Ga0105246_11536348
818 Ga0157317_1013122
819 Ga0157317_1034049
820 Ga0157320_1036685
821 Ga0157325_1010218
822 Ga0157329_1022487
823 Ga0157313_1065834
824 Ga0157342_1006476
825 Ga0157316_1003005
826 Ga0157326_1036308
827 Ga0157338_1013984
828 Ga0157373_10311717
829 Ga0157370_11055912
830 Ga0157369_11072931
831 Ga0157369_11283212
832 Ga0157369_12622303
833 Ga0157378_12014951
834 Ga0157378_12070854
835 Ga0163162_10018642
836 Ga0157372_10037315
837 Ga0157372_10568482
838 Ga0157375_10547232
839 Ga0157375_10673928
840 Ga0157375_11490456
841 Ga0157375_13336831
842 Ga0163163_10060888
843 Ga0163163_12636468
844 Ga0157380_10942588
845 Ga0157380_11294616
846 Ga0182008_10062559
847 Ga0157379_11728916
848 Ga0157376_10118447
849 Ga0157376_12048519
850 Ga0182005_1115851
851 Ga0163161_10423871
852 Ga0206351_10371502
853 Ga0206350_11598520
854 Ga0206354_11178650
855 Ga0206354_11318228
856 Ga0206353_10361820
857 Ga0207653_10085302
858 Ga0207692_10036272
859 Ga0207692_10210352
860 Ga0207642_10259275
861 Ga0207688_10128629
862 Ga0207680_10209188
863 Ga0207699_10170371
864 Ga0207699_10529270
865 Ga0207645_10326845
866 Ga0207643_10823717
867 Ga0207684_10050709
868 Ga0207684_10078440
869 Ga0207684_10085754
870 Ga0207684_10110228
871 Ga0207684_10160049
872 Ga0207684_11038568
873 Ga0207654_10094325
874 Ga0207654_11079455
875 Ga0207707_10168556
876 Ga0207707_10364595
877 Ga0207695_10438055
878 Ga0207693_10081623
879 Ga0207693_10402835
880 Ga0207693_10438854
881 Ga0207663_10148977
882 Ga0207663_10420960
883 Ga0207663_10756840
884 Ga0207663_11603024
885 Ga0207660_10020276
886 Ga0207660_11096500
887 Ga0207662_10067899
888 Ga0207657_10038460
889 Ga0207652_10101174
890 Ga0207652_11476625
891 Ga0207646_10021823
892 Ga0207646_10165595
893 Ga0207646_10533704
894 Ga0207646_11242760
895 Ga0207646_11535460
896 Ga0207694_11723321
897 Ga0207687_10072839
898 Ga0207687_10341282
899 Ga0207687_10473307
900 Ga0207687_11294408
901 Ga0207700_10884661
902 Ga0207700_10921341
903 Ga0207664_10264775
904 Ga0207664_10347646
905 Ga0207644_10176429
906 Ga0207690_10434781
907 Ga0207706_10096472
908 Ga0207706_11711393
909 Ga0207686_10103472
910 Ga0207686_11237026
911 Ga0207686_11766566
912 Ga0207709_10029716
913 Ga0207670_11292740
914 Ga0207669_11468805
915 Ga0207704_10107823
916 Ga0207704_10800488
917 Ga0207665_10012811
918 Ga0207691_10168175
919 Ga0207711_11233714
920 Ga0207689_10722667
921 Ga0207661_10393634
922 Ga0207661_11943826
923 Ga0207679_10209579
924 Ga0207679_10490336
925 Ga0207679_11189175
926 Ga0207667_10024327
927 Ga0207667_11457563
928 Ga0207651_10423286
929 Ga0207651_10448944
930 Ga0207712_10025265
931 Ga0207712_10289527
932 Ga0207712_10663485
933 Ga0207668_10440208
934 Ga0207640_10326249
935 Ga0207640_10735448
936 Ga0207658_10866160
937 Ga0207677_10184217
938 Ga0207677_10960008
939 Ga0207677_11471427
940 Ga0207703_10472081
941 Ga0207639_11492475
942 Ga0207678_10010207
943 Ga0207708_10000986
944 Ga0207702_10349524
945 Ga0207702_10394421
946 Ga0207641_11734647
947 Ga0207648_10025185
948 Ga0207648_10942532
949 Ga0207648_11313963
950 Ga0207648_11947047
951 Ga0207676_10359513
952 Ga0207675_100000145
953 Ga0207675_100021776
954 Ga0207675_100607771
955 Ga0207683_10038710
956 Ga0207683_10248206
957 Ga0209966_1067469
958 Ga0209998_10000265
959 Ga0268265_10561651
960 Ga0268264_10654003
961 Ga0265336_10132552
962 Ga0265331_10179611
963 Ga0307405_10264270
964 Ga0307415_102478154
965 Ga0373930_0005294
966 Ga0373950_0166971
967 Ga0373958_0015461
968 Ga0373959_0111292
969 Ga0373929_0001355
970 Ga0373940_0094883
971 Ga0373944_0030043
972 Ga0373944_0221417
973 Ga0373951_0080309
974 Ga0373932_0021593
975 Ga0373960_0097891
976 Ga0373943_0006293
977 Ga0373943_0458125
978 Ga0373946_0457258
979 Ga0373962_0216145
980 Ga0373931_0104992
981 Ga0373931_0266177
982 Ga0373935_0114011
983 Ga0373927_0120789
984 Ga0373947_0001046
985 Ga0373947_0214365
986 Ga0373925_0025256
987 Ga0395899_0008752
988 Ga0395899_0040915
989 Ga0395899_0042316
990 Ga0395899_0701815
991 Ga0395900_0007578
992 Ga0395900_0016813
993 Ga0395900_0020259
994 Ga0395900_0022467
995 Ga0395900_0040501
996 Ga0395900_0324827
997 Ga0395898_0001745
998 Ga0395898_0014653
999 Ga0395898_0053071
1000 Ga0395898_0236995
1001 Ga0395905_0001814
1002 Ga0395905_0003900
1003 Ga0395905_0040045
1004 Ga0395905_0045731
1005 Ga0395905_1640465
1006 Ga0395901_0052895
1007 Ga0395901_0108797
1008 Ga0395901_0138390
1009 Ga0395901_0160833
1010 Ga0395901_0196757
1011 Ga0395901_0419990
1012 Ga0395901_1222435
1013 Ga0451804_1113261
1014 Ga0439448_0037021
1015 Ga0439448_0112688
1016 Ga0439450_032945
1017 Ga0439458_0008668
1018 Ga0439444_0188457
1019 Ga0439464_0126533
1020 Ga0450916_068630
1021 Ga0466963_0111415
1022 Ga0466963_0589636
1023 Ga0466957_0177437
1024 Ga0466957_0643301
1025 Ga0451576_0504066
1026 Ga0466958_0055461
1027 Ga0466958_0177773
1028 Ga0466967_0155064
1029 Ga0466967_0471177
1030 Ga0466967_0751919
1031 Ga0495592_0580409
1032 Ga0495603_0001199
1033 Ga0495590_0225707
1034 Ga0495629_0794414
1035 Ga0495641_0005902
1036 Ga0495641_0095656
1037 Ga0495580_0146168
1038 Ga0495582_0066903
1039 Ga0495605_0479917
1040 Ga0495639_0153249
1041 Ga0495585_0074927
1042 Ga0495594_0001547
1043 Ga0495596_0163697
1044 Ga0495620_0237816
1045 Ga0495630_1054467
1046 Ga0495630_1221424
1047 Ga0495637_0221873
1048 Ga0495644_0189374
1049 Ga0495663_0090346
1050 Ga0495666_0105980
1051 Ga0495586_0136664
1052 Ga0495597_0161383
1053 Ga0495622_0064092
1054 Ga0495656_0253956
1055 Ga0495611_0270521
1056 Ga0495635_0891810
1057 Ga0495659_0509733
1058 Ga0495588_0001116
1059 Ga0495599_0235360
1060 Ga0495647_0016187
1061 Ga0495658_0037651
1062 Ga0495669_0183204
1063 Ga0495613_0358202
1064 Ga0495624_0125846
1065 Ga0495670_0775634
1066 Ga0495589_0153049
1067 Ga0495581_0416100
1068 Ga0495604_0847489
1069 Ga0495674_1180568
1070 Ga0495676_0002134
1071 Ga0495676_0088556
1072 Ga0495680_0328947
1073 Ga0495677_0292443
1074 Ga0495686_0000020
1075 Ga0495686_0018236
1076 Ga0496100_0022420
1077 Ga0496100_0167572
1078 Ga0496100_0498342
1079 Ga0496101_0047122
1080 Ga0496101_0229862
1081 Ga0496101_0460105
1082 Ga0496101_1517090
1083 Ga0496102_0082434
1084 Ga0496102_0124176
1085 Ga0496102_0127002
1086 Ga0496102_0593918
1087 Ga0496102_1641480
1088 Ga0496102_1823727
1089 Ga0496103_0009681
1090 Ga0496103_0226960
1091 Ga0496103_0661084
1092 Ga0496103_0688088
1093 Ga0496104_0000381
1094 Ga0496104_0047482
1095 Ga0496104_0126774
1096 Ga0496104_0219887
1097 Ga0496105_0001956
1098 Ga0496105_0063098
1099 Ga0496105_0369545
1100 Ga0496105_0893897
1101 Ga0496106_0159920
1102 Ga0496106_0930251
1103 Ga0496107_0047855
1104 Ga0496107_0051652
1105 Ga0496107_0640954
1106 Ga0496107_0820349
1107 Ga0496108_0001352
1108 Ga0496108_0016177
1109 Ga0496108_0126890
1110 Ga0496108_1047995
1111 Ga0496108_1272263
1112 Ga0496108_1715909
1113 Ga0496109_0001686
1114 Ga0496109_0006342
1115 Ga0496109_0146012
1116 Ga0496109_0331113
1117 Ga0496109_0460760
1118 Ga0496110_0000890
1119 Ga0496110_0020623
1120 Ga0496110_0072717
1121 Ga0496110_0183669
1122 Ga0496111_0000043
1123 Ga0496111_0011064
1124 Ga0496111_0055595
1125 Ga0496111_0357548
1126 Ga0496111_0575132
1127 Ga0496112_0000145
1128 Ga0496112_0050076
1129 Ga0496112_0080997
1130 Ga0496112_0547638
1131 Ga0496112_0764735
1132 Ga0496113_0000298
1133 Ga0496113_0009512
1134 Ga0496113_0575265
1135 Ga0496113_0782945
1136 Ga0496113_0989726
1137 Ga0496114_0021144
1138 Ga0496114_0148910
1139 Ga0496114_1033939
1140 Ga0496114_1090596
1141 Ga0496115_0015354
1142 Ga0496115_0241395
1143 Ga0496115_0842242
1144 Ga0501031_0003866
1145 Ga0501031_0050109
1146 Ga0501032_0033282
1147 Ga0501032_0109200
1148 Ga0501033_0066001
1149 Ga0501034_0198760
1150 Ga0501036_0052996
1151 Ga0501036_0056337
1152 Ga0501037_0352348
1153 Ga0501038_0003554
1154 Ga0501038_0090879
1155 Ga0501039_0063212
1156 Ga0501039_0129462
1157 Ga0501040_0019882
1158 Ga0501040_0043328
1159 Ga0501040_1049041
1160 Ga0501041_0022025
1161 Ga0501042_0014559
1162 Ga0501042_0150897
1163 Ga0501043_0007634
1164 Ga0501046_0042337
1165 Ga0501046_0453823
1166 Ga0501048_0018300
1167 Ga0501048_0031950
1168 Ga0501067_0014092
1169 Ga0501067_0032096
1170 Ga0501067_0836786
1171 Ga0501068_0001205
1172 Ga0501069_0000854
1173 Ga0501069_0003597
1174 Ga0501070_0019789
1175 Ga0501070_0112699
1176 Ga0501071_0007583
1177 Ga0501071_0020623
1178 Ga0501072_0074434
1179 Ga0501072_0940553
1180 Ga0501073_0014050
1181 Ga0501073_0118008
1182 Ga0501074_0001178
1183 Ga0501074_0407181
1184 Ga0501075_0295809
1185 Ga0501076_0024954
1186 Ga0501076_0051153
1187 Ga0501076_0160937
1188 Ga0501077_0546055
1189 Ga0501079_0009593
1190 Ga0501079_0440608
1191 Ga0501079_1439887
1192 Ga0501080_0022583
1193 Ga0501081_0005931
1194 Ga0501081_0335023
1195 Ga0501081_1284801
1196 Ga0501083_0188274
1197 Ga0501035_0037131
1198 Ga0501035_0198411
1199 Ga0501044_0013648
1200 Ga0501044_0313536
1201 Ga0501045_0005247
1202 Ga0501045_0376605
1203 nmdc:mga00v17_692147_c1
1204 nmdc:mga0yw44_205905_c1
1205 nmdc:mga05p37_1397191_c1
1206 nmdc:mga05p37_2122332_c1
1207 nmdc:mga05p37_80842_c1
1208 nmdc:mga09592_907032_c1
1209 nmdc:mga06r32_1813296_c1
1210 nmdc:mga06r32_641415_c1
1211 nmdc:mga08y16_2081973_c1
1212 nmdc:mga08y16_390566_c1
1213 nmdc:mga0n895_1043769_c1
1214 nmdc:mga0n895_195913_c1
1215 nmdc:mga0n895_365086_c1
1216 nmdc:mga0n895_670714_c1
1217 nmdc:mga0n895_948786_c1
1218 nmdc:mga0rr50_1468522_c1
1219 nmdc:mga0rr50_463293_c1
1220 nmdc:mga0rr50_63439_c1
1221 nmdc:mga08x19_188628_c1
1222 nmdc:mga08x19_38359_c1
1223 nmdc:mga08x19_942295_c1
1224 nmdc:mga0a205_1037547_c1
1225 nmdc:mga0a205_207132_c1
1226 nmdc:mga0a205_226161_c1
1227 nmdc:mga0a205_740446_c1
1228 Ga0501084_0158834
1229 Ga0501082_0125656
1230 Ga0501082_0235347
1231 Ga0501082_1255999
1232 Ga0530510_0037921
1233 Ga0530510_0042351
1234 Ga0530510_1253617

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

9

93

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.9599 2 81
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9332 2 86
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.9309 2 81
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9153 2 82
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9028 2 86
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9332 2 86 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9309 2 81 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9028 2 86 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8977 2 86 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8786 2 81 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2N2R4B9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9808 2 81
AF-A0A538J751-F1-model_v4 MoaD/ThiS family protein 0.9756 2 86
AF-A0A535VU56-F1-model_v4 MoaD/ThiS family protein 0.9729 2 86
AF-A0A7V9IXR5-F1-model_v4 MoaD/ThiS family protein 0.9703 1 69
AF-A0A535FJZ7-F1-model_v4 MoaD/ThiS family protein 0.97 2 85

Map