F469629

General Info

Members Datasets Scaffolds Average Seq Length
617 223 1234 240

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10246376|Ga0111539_102463762
Length 263
Sequence MIGWWSRDRIFDHWHRSCYVSWGARAVAEDRTQVNESRMVSLADEDAVKDLLVTSVLDLWKVVNNLTRLKPSRRDRYRVAIFGSARAQPGTFVYEEVKRTAAAFAEMGCDIVTGGGPGLMQAANEGAKGAVTTGSLGIRVELPFEQHANPFVDQSFTHETFFTRLHHFVLASDAFVVVPGGIGTVLEMLMIWQLLQVRHLKEVPLILVGKMWTGLVEWAKTSMQDPRLALANPGDFDIPRCVDTADEAIALVRELHGQWQTSH

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
162 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
163 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
176 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
177 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
178 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
179 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
180 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
186 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
187 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
188 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
189 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
192 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
193 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
194 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
195 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
196 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
197 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
198 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
201 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
202 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
203 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
204 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
207 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
208 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
209 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
210 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
211 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
212 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
213 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 1.62
Rhizosphere 97.73
Stem 0
Stem Tuber 0
Unclassified 18.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10246376 3300009094 Bacteria 2080
2 SwRhRL2b_contig_3301351 2162886007 Bacteria 1684
3 MBSR1b_contig_5710850 2162886012 Unclassified 941
4 JGI24748J21848_1000031 3300002074 Bacteria 80371
5 JGI24034J26672_10000005 3300002239 Bacteria 404185
6 JGI24742J22300_10011011 3300002244 Bacteria 1499
7 JGI24751J29686_10000015 3300002459 Bacteria 112804
8 rootL2_10248591 3300003322 Bacteria 4569
9 Ga0065704_10139768 3300005289 Bacteria 1520
10 Ga0065712_10001353 3300005290 Bacteria 6089
11 Ga0065712_10001618 3300005290 Bacteria 9207
12 Ga0065712_10019549 3300005290 Bacteria 1412
13 Ga0065712_10105208 3300005290 Bacteria 1939
14 Ga0065715_10001589 3300005293 Bacteria 9831
15 Ga0065715_10151270 3300005293 Bacteria 1726
16 Ga0065715_10209628 3300005293 Unclassified 1311
17 Ga0065715_10224945 3300005293 Bacteria 1256
18 Ga0065715_10259257 3300005293 Bacteria 1143
19 Ga0065707_10035470 3300005295 Unclassified 1052
20 Ga0065707_10127096 3300005295 Bacteria 1990
21 Ga0070690_100147693 3300005330 Bacteria 1601
22 Ga0070690_100163521 3300005330 Bacteria 1527
23 Ga0070690_100451957 3300005330 Bacteria 953
24 Ga0070670_100000182 3300005331 Bacteria 57532
25 Ga0070670_100262403 3300005331 Bacteria 1506
26 Ga0068869_100006915 3300005334 Bacteria 7219
27 Ga0068869_100021332 3300005334 Bacteria 4455
28 Ga0068869_100151100 3300005334 Unclassified 1801
29 Ga0068869_100151981 3300005334 Bacteria 1796
30 Ga0068869_100247032 3300005334 Bacteria 1424
31 Ga0070680_100026960 3300005336 Bacteria 4599
32 Ga0070680_100177224 3300005336 Bacteria 1795
33 Ga0068868_100375370 3300005338 Unclassified 1222
34 Ga0070660_100450769 3300005339 Bacteria 1067
35 Ga0070689_100000729 3300005340 Bacteria 20093
36 Ga0070689_100035068 3300005340 Bacteria 3831
37 Ga0070689_100075371 3300005340 Bacteria 2642
38 Ga0070689_100077039 3300005340 Bacteria 2613
39 Ga0070689_100118677 3300005340 Bacteria 2111
40 Ga0070689_100151638 3300005340 Bacteria 1869
41 Ga0070689_100376751 3300005340 Bacteria 1195
42 Ga0070687_100031252 3300005343 Bacteria 2611
43 Ga0070661_100174243 3300005344 Unclassified 1635
44 Ga0070692_10345154 3300005345 Unclassified 923
45 Ga0070669_100102486 3300005353 Bacteria 2161
46 Ga0070669_100131193 3300005353 Bacteria 1922
47 Ga0070669_100150835 3300005353 Bacteria 1799
48 Ga0070669_100224180 3300005353 Viruses 1487
49 Ga0070669_100633575 3300005353 Bacteria 898
50 Ga0070675_100012818 3300005354 Bacteria 6578
51 Ga0070675_100053660 3300005354 Bacteria 3316
52 Ga0070675_100098432 3300005354 Bacteria 2460
53 Ga0070675_100104130 3300005354 Bacteria 2393
54 Ga0070675_100120487 3300005354 Unclassified 2229
55 Ga0070675_100121966 3300005354 Bacteria 2215
56 Ga0070671_100000205 3300005355 Bacteria 39211
57 Ga0070671_100064295 3300005355 Bacteria 3056
58 Ga0070671_100117557 3300005355 Bacteria 2236
59 Ga0070671_100130344 3300005355 Bacteria 2118
60 Ga0070673_100024003 3300005364 Bacteria 4463
61 Ga0070673_100048132 3300005364 Bacteria 3322
62 Ga0070673_100074064 3300005364 Bacteria 2743
63 Ga0070673_100096265 3300005364 Bacteria 2429
64 Ga0070673_100102569 3300005364 Bacteria 2359
65 Ga0070673_100132541 3300005364 Bacteria 2093
66 Ga0070673_100210352 3300005364 Bacteria 1679
67 Ga0070673_100239013 3300005364 Bacteria 1578
68 Ga0070673_100388718 3300005364 Unclassified 1245
69 Ga0070673_100587647 3300005364 Unclassified 1015
70 Ga0070688_100124858 3300005365 Bacteria 1729
71 Ga0070688_100230472 3300005365 Bacteria 1310
72 Ga0070659_100138972 3300005366 Unclassified 1977
73 Ga0070659_100317921 3300005366 Bacteria 1301
74 Ga0070667_100126794 3300005367 Unclassified 2225
75 Ga0070667_100314021 3300005367 Bacteria 1413
76 Ga0070703_10000395 3300005406 Bacteria 18239
77 Ga0070703_10022729 3300005406 Bacteria 1842
78 Ga0070703_10042920 3300005406 Bacteria 1416
79 Ga0070701_10053088 3300005438 Bacteria 2108
80 Ga0070701_10114445 3300005438 Bacteria 1512
81 Ga0070705_100001740 3300005440 Bacteria 11314
82 Ga0070705_100097590 3300005440 Bacteria 1847
83 Ga0070705_100102440 3300005440 Bacteria 1810
84 Ga0070700_100001052 3300005441 Bacteria 13668
85 Ga0070700_100001906 3300005441 Bacteria 10538
86 Ga0070700_100014217 3300005441 Bacteria 4490
87 Ga0070700_100019044 3300005441 Bacteria 3957
88 Ga0070700_100113135 3300005441 Bacteria 1808
89 Ga0070700_100203277 3300005441 Unclassified 1393
90 Ga0070700_100327421 3300005441 Unclassified 1128
91 Ga0070694_100010755 3300005444 Bacteria 5659
92 Ga0070694_100022002 3300005444 Bacteria 4082
93 Ga0070694_100207017 3300005444 Unclassified 1465
94 Ga0070694_100357704 3300005444 Bacteria 1133
95 Ga0070694_100638895 3300005444 Unclassified 860
96 Ga0070663_100784077 3300005455 Bacteria 816
97 Ga0070678_100099009 3300005456 Unclassified 2255
98 Ga0068867_100046854 3300005459 Bacteria 3176
99 Ga0068867_100085872 3300005459 Bacteria 2380
100 Ga0068867_100263063 3300005459 Unclassified 1407
101 Ga0070685_10070194 3300005466 Bacteria 2074
102 Ga0070707_100039276 3300005468 Bacteria 4523
103 Ga0070699_100001121 3300005518 Bacteria 24945
104 Ga0070697_100247829 3300005536 Bacteria 1523
105 Ga0070672_100050518 3300005543 Bacteria 3239
106 Ga0070672_100056116 3300005543 Bacteria 3088
107 Ga0070686_100082344 3300005544 Bacteria 2134
108 Ga0070695_100022113 3300005545 Bacteria 3898
109 Ga0070693_100000409 3300005547 Bacteria 19458
110 Ga0070665_100045737 3300005548 Bacteria 4396
111 Ga0070665_100237277 3300005548 Bacteria 1824
112 Ga0070704_100037681 3300005549 Bacteria 3306
113 Ga0070704_100051111 3300005549 Unclassified 2909
114 Ga0070704_100079354 3300005549 Bacteria 2411
115 Ga0070704_100142874 3300005549 Bacteria 1871
116 Ga0070704_100353235 3300005549 Bacteria 1242
117 Ga0068855_100534948 3300005563 Bacteria 1270
118 Ga0070664_100435494 3300005564 Bacteria 1202
119 Ga0070664_100683813 3300005564 Bacteria 955
120 Ga0068857_100047230 3300005577 Unclassified 3822
121 Ga0068854_100110100 3300005578 Bacteria 2076
122 Ga0068854_100299937 3300005578 Unclassified 1299
123 Ga0068854_100347035 3300005578 Bacteria 1214
124 Ga0068854_100383534 3300005578 Bacteria 1159
125 Ga0070702_100018079 3300005615 Bacteria 3649
126 Ga0070702_100067790 3300005615 Bacteria 2098
127 Ga0070702_100267172 3300005615 Unclassified 1168
128 Ga0070702_100271536 3300005615 Bacteria 1160
129 Ga0068852_100354363 3300005616 Bacteria 1434
130 Ga0068852_100464489 3300005616 Bacteria 1255
131 Ga0068852_100930679 3300005616 Bacteria 887
132 Ga0068852_101012471 3300005616 Unclassified 849
133 Ga0068859_100001631 3300005617 Bacteria 22938
134 Ga0068859_100002033 3300005617 Bacteria 20671
135 Ga0068859_100002516 3300005617 Bacteria 18607
136 Ga0068859_100007329 3300005617 Bacteria 11190
137 Ga0068859_100018867 3300005617 Bacteria 6930
138 Ga0068859_100036284 3300005617 Bacteria 4949
139 Ga0068859_100048238 3300005617 Bacteria 4278
140 Ga0068859_100052241 3300005617 Bacteria 4109
141 Ga0068859_100098073 3300005617 Unclassified 2984
142 Ga0068859_100153877 3300005617 Bacteria 2376
143 Ga0068859_100203441 3300005617 Bacteria 2065
144 Ga0068859_100258485 3300005617 Unclassified 1832
145 Ga0068859_100293855 3300005617 Bacteria 1718
146 Ga0068859_100320659 3300005617 Bacteria 1643
147 Ga0068859_101069747 3300005617 Bacteria 887
148 Ga0068864_100013212 3300005618 Bacteria 6838
149 Ga0068864_100015653 3300005618 Bacteria 6309
150 Ga0068864_100020670 3300005618 Bacteria 5509
151 Ga0068864_100059940 3300005618 Bacteria 3294
152 Ga0068864_100074461 3300005618 Unclassified 2963
153 Ga0068864_100076952 3300005618 Unclassified 2917
154 Ga0068864_100222744 3300005618 Unclassified 1741
155 Ga0068864_100422152 3300005618 Bacteria 1271
156 Ga0068864_100500894 3300005618 Unclassified 1168
157 Ga0068866_10003289 3300005718 Bacteria 6639
158 Ga0068861_100002212 3300005719 Bacteria 12615
159 Ga0068861_100324520 3300005719 Bacteria 1342
160 Ga0068861_100340176 3300005719 Bacteria 1313
161 Ga0068861_100510190 3300005719 Unclassified 1089
162 Ga0068861_100554271 3300005719 Bacteria 1048
163 Ga0068861_100558577 3300005719 Unclassified 1044
164 Ga0068861_100952722 3300005719 Bacteria 816
165 Ga0068851_10008419 3300005834 Bacteria 4767
166 Ga0068870_10005210 3300005840 Bacteria 5660
167 Ga0068870_10049222 3300005840 Bacteria 2222
168 Ga0068870_10132264 3300005840 Bacteria 1451
169 Ga0068863_100019120 3300005841 Bacteria 6557
170 Ga0068863_100111155 3300005841 Unclassified 2610
171 Ga0068863_100153528 3300005841 Bacteria 2203
172 Ga0068863_100367370 3300005841 Unclassified 1403
173 Ga0068863_100446003 3300005841 Bacteria 1270
174 Ga0068863_100450136 3300005841 Unclassified 1264
175 Ga0068863_100667392 3300005841 Bacteria 1032
176 Ga0068858_100000384 3300005842 Bacteria 46280
177 Ga0068858_100015230 3300005842 Bacteria 7233
178 Ga0068858_100019217 3300005842 Bacteria 6389
179 Ga0068858_100205426 3300005842 Unclassified 1864
180 Ga0068858_100266976 3300005842 Unclassified 1628
181 Ga0068858_100372938 3300005842 Bacteria 1369
182 Ga0068858_100741193 3300005842 Unclassified 957
183 Ga0068860_100003375 3300005843 Bacteria 16425
184 Ga0068860_100005585 3300005843 Bacteria 12713
185 Ga0068860_100149088 3300005843 Bacteria 2252
186 Ga0068860_100181570 3300005843 Bacteria 2034
187 Ga0068860_100356846 3300005843 Unclassified 1439
188 Ga0068860_100628602 3300005843 Unclassified 1081
189 Ga0068862_100098579 3300005844 Bacteria 2553
190 Ga0068862_100099422 3300005844 Bacteria 2543
191 Ga0068862_100248325 3300005844 Bacteria 1621
192 Ga0068862_100311581 3300005844 Bacteria 1451
193 Ga0068862_100341989 3300005844 Bacteria 1386
194 Ga0068862_100395567 3300005844 Unclassified 1292
195 Ga0075367_10066182 3300006178 Bacteria 2165
196 Ga0097621_100015878 3300006237 Bacteria 5678
197 Ga0097621_100069777 3300006237 Bacteria 2902
198 Ga0097621_100101236 3300006237 Unclassified 2424
199 Ga0097621_100451710 3300006237 Unclassified 1158
200 Ga0068871_100013437 3300006358 Bacteria 6078
201 Ga0068871_100030772 3300006358 Bacteria 4230
202 Ga0068871_100048143 3300006358 Unclassified 3440
203 Ga0068871_100364571 3300006358 Bacteria 1280
204 Ga0075428_100011300 3300006844 Bacteria 9933
205 Ga0075428_100013940 3300006844 Bacteria 8949
206 Ga0075428_100074023 3300006844 Bacteria 3721
207 Ga0075428_100279905 3300006844 Bacteria 1795
208 Ga0075430_100021907 3300006846 Bacteria 5430
209 Ga0075431_100009482 3300006847 Bacteria 9774
210 Ga0075431_100121656 3300006847 Bacteria 2693
211 Ga0075431_100749645 3300006847 Unclassified 952
212 Ga0075433_10106585 3300006852 Bacteria 2484
213 Ga0075433_10111512 3300006852 Unclassified 2427
214 Ga0075433_10409333 3300006852 Unclassified 1196
215 Ga0075433_10646647 3300006852 Bacteria 927
216 Ga0075434_100028768 3300006871 Bacteria 5464
217 Ga0075434_100146497 3300006871 Unclassified 2381
218 Ga0075434_100171659 3300006871 Bacteria 2188
219 Ga0075429_100007935 3300006880 Bacteria 9224
220 Ga0075429_100421117 3300006880 Bacteria 1170
221 Ga0075429_100427077 3300006880 Bacteria 1161
222 Ga0075429_100463379 3300006880 Bacteria 1110
223 Ga0068865_100019337 3300006881 Bacteria 4407
224 Ga0075436_100574748 3300006914 Bacteria 829
225 Ga0097620_100001631 3300006931 Bacteria 22938
226 Ga0097620_100002033 3300006931 Bacteria 20671
227 Ga0097620_100002516 3300006931 Bacteria 18607
228 Ga0097620_100007329 3300006931 Bacteria 11190
229 Ga0097620_100018867 3300006931 Bacteria 6930
230 Ga0097620_100036284 3300006931 Bacteria 4949
231 Ga0097620_100048239 3300006931 Bacteria 4278
232 Ga0097620_100052242 3300006931 Bacteria 4109
233 Ga0097620_100098066 3300006931 Unclassified 2984
234 Ga0097620_100153887 3300006931 Bacteria 2376
235 Ga0097620_100203451 3300006931 Bacteria 2065
236 Ga0097620_100258490 3300006931 Unclassified 1832
237 Ga0097620_100293874 3300006931 Bacteria 1718
238 Ga0097620_100320656 3300006931 Bacteria 1643
239 Ga0097620_101069775 3300006931 Bacteria 887
240 Ga0075435_100337462 3300007076 Unclassified 1291
241 Ga0105240_10580323 3300009093 Bacteria 1237
242 Ga0111539_10003176 3300009094 Bacteria 21748
243 Ga0111539_10003183 3300009094 Bacteria 21718
244 Ga0111539_10003919 3300009094 Bacteria 19568
245 Ga0111539_10004234 3300009094 Bacteria 18802
246 Ga0111539_10013474 3300009094 Bacteria 10218
247 Ga0111539_10025118 3300009094 Bacteria 7302
248 Ga0111539_10037903 3300009094 Bacteria 5816
249 Ga0111539_10111485 3300009094 Bacteria 3210
250 Ga0111539_10134193 3300009094 Bacteria 2898
251 Ga0111539_10144463 3300009094 Unclassified 2785
252 Ga0111539_10229769 3300009094 Unclassified 2160
253 Ga0111539_10483563 3300009094 Bacteria 1442
254 Ga0105245_11159344 3300009098 Bacteria 820
255 Ga0105247_10000033 3300009101 Bacteria 184433
256 Ga0105247_10000512 3300009101 Bacteria 31789
257 Ga0105247_10072664 3300009101 Unclassified 2153
258 Ga0105247_10097133 3300009101 Bacteria 1879
259 Ga0105247_10604666 3300009101 Unclassified 813
260 Ga0114129_10001093 3300009147 Bacteria 35623
261 Ga0114129_10008409 3300009147 Bacteria 14699
262 Ga0114129_10011569 3300009147 Bacteria 12564
263 Ga0114129_10021588 3300009147 Bacteria 9139
264 Ga0114129_10075778 3300009147 Bacteria 4684
265 Ga0114129_10114446 3300009147 Bacteria 3719
266 Ga0114129_10163272 3300009147 Unclassified 3041
267 Ga0114129_10863098 3300009147 Bacteria 1150
268 Ga0105243_10000349 3300009148 Bacteria 49476
269 Ga0105243_10006323 3300009148 Bacteria 9152
270 Ga0105243_10216399 3300009148 Bacteria 1690
271 Ga0105243_10404129 3300009148 Bacteria 1270
272 Ga0105243_10412638 3300009148 Unclassified 1257
273 Ga0105241_10263289 3300009174 Unclassified 1466
274 Ga0105241_10303045 3300009174 Bacteria 1372
275 Ga0105242_10000162 3300009176 Bacteria 50052
276 Ga0105242_10000376 3300009176 Bacteria 35441
277 Ga0105242_10073717 3300009176 Bacteria 2839
278 Ga0105242_10078867 3300009176 Bacteria 2749
279 Ga0105242_10149827 3300009176 Bacteria 2033
280 Ga0105248_10004162 3300009177 Bacteria 16001
281 Ga0105248_10010708 3300009177 Bacteria 10122
282 Ga0105248_10010732 3300009177 Bacteria 10113
283 Ga0105248_10011214 3300009177 Bacteria 9885
284 Ga0105248_10046102 3300009177 Bacteria 4886
285 Ga0105248_10055723 3300009177 Bacteria 4435
286 Ga0105248_10130889 3300009177 Bacteria 2831
287 Ga0105248_10140550 3300009177 Bacteria 2724
288 Ga0105248_10192427 3300009177 Bacteria 2299
289 Ga0105248_10235578 3300009177 Bacteria 2061
290 Ga0105248_10456109 3300009177 Bacteria 1441
291 Ga0105248_10518936 3300009177 Bacteria 1343
292 Ga0105248_10541728 3300009177 Unclassified 1313
293 Ga0105237_10130566 3300009545 Bacteria 2507
294 Ga0105238_10001162 3300009551 Bacteria 26555
295 Ga0105238_10034132 3300009551 Bacteria 5177
296 Ga0105249_10001330 3300009553 Bacteria 21636
297 Ga0105249_10025297 3300009553 Bacteria 5343
298 Ga0105249_10033851 3300009553 Bacteria 4628
299 Ga0105249_10062039 3300009553 Bacteria 3431
300 Ga0105249_10084439 3300009553 Bacteria 2957
301 Ga0105249_10438682 3300009553 Unclassified 1343
302 Ga0105249_10623351 3300009553 Bacteria 1135
303 Ga0105239_10095767 3300010375 Bacteria 3279
304 Ga0105239_10314487 3300010375 Bacteria 1765
305 Ga0105246_10304328 3300011119 Bacteria 1289
306 Ga0157371_10499791 3300013102 Bacteria 898
307 Ga0157374_10190646 3300013296 Bacteria 2005
308 Ga0157374_10547409 3300013296 Bacteria 1165
309 Ga0157378_10000094 3300013297 Bacteria 84481
310 Ga0157378_10001855 3300013297 Bacteria 18973
311 Ga0157378_10014934 3300013297 Bacteria 6797
312 Ga0157378_10078664 3300013297 Bacteria 2976
313 Ga0157378_10455245 3300013297 Unclassified 1271
314 Ga0163162_10001025 3300013306 Bacteria 25955
315 Ga0163162_10003397 3300013306 Bacteria 15202
316 Ga0163162_10011291 3300013306 Bacteria 8710
317 Ga0163162_10025532 3300013306 Bacteria 5839
318 Ga0163162_10104672 3300013306 Bacteria 2925
319 Ga0163162_10296077 3300013306 Bacteria 1750
320 Ga0163162_10360914 3300013306 Bacteria 1586
321 Ga0163162_10483680 3300013306 Bacteria 1369
322 Ga0163162_10635686 3300013306 Unclassified 1192
323 Ga0157372_10068301 3300013307 Bacteria 3996
324 Ga0157375_10002895 3300013308 Bacteria 14869
325 Ga0157375_10003628 3300013308 Bacteria 13387
326 Ga0157375_10004555 3300013308 Bacteria 12045
327 Ga0157375_10011429 3300013308 Bacteria 7838
328 Ga0157375_10061555 3300013308 Bacteria 3727
329 Ga0157375_10079969 3300013308 Unclassified 3306
330 Ga0157375_10083475 3300013308 Bacteria 3240
331 Ga0157375_10286031 3300013308 Bacteria 1812
332 Ga0157375_10317877 3300013308 Unclassified 1721
333 Ga0157375_10358822 3300013308 Bacteria 1623
334 Ga0163163_10000142 3300014325 Bacteria 74753
335 Ga0163163_10006582 3300014325 Bacteria 10176
336 Ga0163163_10009034 3300014325 Bacteria 8879
337 Ga0163163_10009552 3300014325 Bacteria 8666
338 Ga0163163_10022549 3300014325 Bacteria 5965
339 Ga0163163_10026731 3300014325 Bacteria 5520
340 Ga0163163_10065776 3300014325 Unclassified 3600
341 Ga0163163_10154508 3300014325 Bacteria 2339
342 Ga0163163_10166522 3300014325 Bacteria 2250
343 Ga0163163_10416147 3300014325 Bacteria 1403
344 Ga0163163_10472407 3300014325 Bacteria 1315
345 Ga0163163_10511702 3300014325 Bacteria 1263
346 Ga0163163_10565560 3300014325 Unclassified 1200
347 Ga0163163_10866789 3300014325 Bacteria 966
348 Ga0157380_10004355 3300014326 Bacteria 9818
349 Ga0157380_10030601 3300014326 Bacteria 4125
350 Ga0157380_10082449 3300014326 Bacteria 2632
351 Ga0157380_10224179 3300014326 Bacteria 1684
352 Ga0157380_10477288 3300014326 Bacteria 1205
353 Ga0157380_10529301 3300014326 Bacteria 1151
354 Ga0157377_10078693 3300014745 Bacteria 1922
355 Ga0157377_10162687 3300014745 Bacteria 1389
356 Ga0157377_10290693 3300014745 Unclassified 1075
357 Ga0157379_10019338 3300014968 Bacteria 6016
358 Ga0157379_10130551 3300014968 Bacteria 2261
359 Ga0157376_10027427 3300014969 Bacteria 4514
360 Ga0157376_10064641 3300014969 Bacteria 3087
361 Ga0163161_10154175 3300017792 Bacteria 1748
362 Ga0207672_1000162 3300025223 Bacteria 9197
363 Ga0207697_10006933 3300025315 Bacteria 5080
364 Ga0207656_10004845 3300025321 Bacteria 4726
365 Ga0207653_10000478 3300025885 Bacteria 15823
366 Ga0207642_10073429 3300025899 Bacteria 1636
367 Ga0207710_10000001 3300025900 Bacteria 1797433
368 Ga0207710_10000453 3300025900 Bacteria 26495
369 Ga0207710_10063573 3300025900 Unclassified 1679
370 Ga0207688_10016385 3300025901 Bacteria 4020
371 Ga0207680_10150940 3300025903 Bacteria 1549
372 Ga0207647_10018470 3300025904 Unclassified 4713
373 Ga0207645_10298062 3300025907 Unclassified 1073
374 Ga0207643_10000986 3300025908 Bacteria 17038
375 Ga0207643_10192404 3300025908 Unclassified 1239
376 Ga0207643_10365067 3300025908 Bacteria 908
377 Ga0207654_10198208 3300025911 Bacteria 1320
378 Ga0207654_10369928 3300025911 Bacteria 991
379 Ga0207671_10096045 3300025914 Bacteria 2239
380 Ga0207660_10013376 3300025917 Bacteria 5379
381 Ga0207660_10167976 3300025917 Bacteria 1696
382 Ga0207660_10177995 3300025917 Bacteria 1650
383 Ga0207662_10021237 3300025918 Bacteria 3709
384 Ga0207662_10021995 3300025918 Bacteria 3651
385 Ga0207662_10055590 3300025918 Bacteria 2362
386 Ga0207649_10215716 3300025920 Unclassified 1364
387 Ga0207646_10175928 3300025922 Unclassified 1933
388 Ga0207681_10241481 3300025923 Bacteria 1406
389 Ga0207681_10320824 3300025923 Unclassified 1232
390 Ga0207694_10000994 3300025924 Bacteria 24824
391 Ga0207650_10000017 3300025925 Bacteria 354674
392 Ga0207650_10242084 3300025925 Bacteria 1458
393 Ga0207650_10372593 3300025925 Bacteria 1178
394 Ga0207659_10029886 3300025926 Unclassified 3718
395 Ga0207659_10051314 3300025926 Bacteria 2933
396 Ga0207659_10066392 3300025926 Bacteria 2618
397 Ga0207659_10074578 3300025926 Unclassified 2487
398 Ga0207659_10385738 3300025926 Bacteria 1169
399 Ga0207659_10662834 3300025926 Unclassified 892
400 Ga0207644_10002650 3300025931 Bacteria 11527
401 Ga0207644_10048090 3300025931 Unclassified 3047
402 Ga0207690_10085628 3300025932 Unclassified 2213
403 Ga0207706_10170701 3300025933 Bacteria 1911
404 Ga0207686_10000069 3300025934 Bacteria 93699
405 Ga0207686_10001846 3300025934 Bacteria 11761
406 Ga0207686_10091056 3300025934 Bacteria 2014
407 Ga0207686_10189928 3300025934 Bacteria 1463
408 Ga0207686_10615241 3300025934 Unclassified 856
409 Ga0207709_10000025 3300025935 Bacteria 364795
410 Ga0207709_10001629 3300025935 Bacteria 15274
411 Ga0207709_10524572 3300025935 Unclassified 928
412 Ga0207670_10000352 3300025936 Bacteria 27297
413 Ga0207670_10023210 3300025936 Bacteria 3858
414 Ga0207670_10054427 3300025936 Bacteria 2700
415 Ga0207670_10360476 3300025936 Bacteria 1153
416 Ga0207669_10126832 3300025937 Bacteria 1745
417 Ga0207691_10007596 3300025940 Bacteria 10435
418 Ga0207691_10043896 3300025940 Bacteria 4117
419 Ga0207691_10154052 3300025940 Unclassified 2019
420 Ga0207711_10003783 3300025941 Bacteria 13026
421 Ga0207711_10006570 3300025941 Bacteria 9790
422 Ga0207711_10029079 3300025941 Bacteria 4658
423 Ga0207711_10070213 3300025941 Bacteria 3037
424 Ga0207711_10095094 3300025941 Bacteria 2627
425 Ga0207711_10101376 3300025941 Bacteria 2548
426 Ga0207711_10164658 3300025941 Unclassified 2009
427 Ga0207711_10391989 3300025941 Bacteria 1290
428 Ga0207711_10523997 3300025941 Bacteria 1105
429 Ga0207711_10630374 3300025941 Bacteria 1000
430 Ga0207689_10008168 3300025942 Bacteria 9122
431 Ga0207689_10144707 3300025942 Bacteria 1958
432 Ga0207689_10163330 3300025942 Bacteria 1835
433 Ga0207689_10164965 3300025942 Bacteria 1825
434 Ga0207689_10564538 3300025942 Unclassified 956
435 Ga0207651_10032958 3300025960 Bacteria 3335
436 Ga0207651_10043741 3300025960 Bacteria 2992
437 Ga0207651_10089157 3300025960 Bacteria 2251
438 Ga0207651_10115258 3300025960 Unclassified 2026
439 Ga0207651_10131410 3300025960 Bacteria 1917
440 Ga0207651_10185575 3300025960 Bacteria 1654
441 Ga0207651_10530689 3300025960 Unclassified 1021
442 Ga0207651_10774901 3300025960 Bacteria 849
443 Ga0207712_10000650 3300025961 Bacteria 27103
444 Ga0207712_10028443 3300025961 Bacteria 3739
445 Ga0207712_10046223 3300025961 Bacteria 3018
446 Ga0207712_10096627 3300025961 Bacteria 2187
447 Ga0207712_10586601 3300025961 Unclassified 963
448 Ga0207712_10717273 3300025961 Bacteria 874
449 Ga0207640_10089209 3300025981 Bacteria 2131
450 Ga0207640_10100015 3300025981 Bacteria 2031
451 Ga0207640_10373789 3300025981 Bacteria 1153
452 Ga0207640_10393010 3300025981 Bacteria 1127
453 Ga0207677_10216130 3300026023 Bacteria 1534
454 Ga0207677_10424621 3300026023 Bacteria 1133
455 Ga0207677_10546018 3300026023 Unclassified 1009
456 Ga0207703_10000274 3300026035 Bacteria 57000
457 Ga0207703_10028902 3300026035 Bacteria 4375
458 Ga0207703_10048137 3300026035 Unclassified 3439
459 Ga0207703_10103418 3300026035 Bacteria 2418
460 Ga0207703_10224766 3300026035 Bacteria 1680
461 Ga0207703_10313096 3300026035 Bacteria 1435
462 Ga0207703_10671853 3300026035 Bacteria 984
463 Ga0207708_10000088 3300026075 Bacteria 72618
464 Ga0207708_10003028 3300026075 Bacteria 12394
465 Ga0207708_10003660 3300026075 Bacteria 11345
466 Ga0207708_10013769 3300026075 Bacteria 6046
467 Ga0207708_10050118 3300026075 Unclassified 3179
468 Ga0207708_10074923 3300026075 Bacteria 2594
469 Ga0207708_10256011 3300026075 Unclassified 1412
470 Ga0207641_10226707 3300026088 Bacteria 1735
471 Ga0207641_10247828 3300026088 Bacteria 1662
472 Ga0207641_10375836 3300026088 Bacteria 1360
473 Ga0207648_10052051 3300026089 Bacteria 3580
474 Ga0207648_10391927 3300026089 Bacteria 1257
475 Ga0207648_10459911 3300026089 Bacteria 1160
476 Ga0207676_10003643 3300026095 Bacteria 10901
477 Ga0207676_10009824 3300026095 Bacteria 6806
478 Ga0207676_10030706 3300026095 Unclassified 4036
479 Ga0207676_10060921 3300026095 Unclassified 2987
480 Ga0207676_10118390 3300026095 Bacteria 2229
481 Ga0207676_10185445 3300026095 Bacteria 1826
482 Ga0207676_10255134 3300026095 Bacteria 1580
483 Ga0207676_10342816 3300026095 Unclassified 1379
484 Ga0207674_10150503 3300026116 Unclassified 2284
485 Ga0207674_10519209 3300026116 Bacteria 1150
486 Ga0207675_100011027 3300026118 Bacteria 8463
487 Ga0207675_100217591 3300026118 Unclassified 1839
488 Ga0207675_100363863 3300026118 Bacteria 1419
489 Ga0207675_100530227 3300026118 Bacteria 1175
490 Ga0207698_10480079 3300026142 Bacteria 1206
491 Ga0207428_10014016 3300027907 Bacteria 6981
492 Ga0207428_10023890 3300027907 Bacteria 5134
493 Ga0207428_10025879 3300027907 Bacteria 4904
494 Ga0207428_10154680 3300027907 Unclassified 1744
495 Ga0207428_10183353 3300027907 Bacteria 1581
496 Ga0207428_10405036 3300027907 Bacteria 998
497 Ga0268266_10163394 3300028379 Bacteria 2016
498 Ga0268265_10080505 3300028380 Bacteria 2569
499 Ga0268265_10296028 3300028380 Bacteria 1455
500 Ga0268265_10521926 3300028380 Bacteria 1123
501 Ga0268265_10557949 3300028380 Bacteria 1088
502 Ga0268264_10156940 3300028381 Bacteria 2046
503 Ga0268264_10165630 3300028381 Bacteria 1995
504 Ga0268264_10426947 3300028381 Bacteria 1279
505 Ga0268264_10574158 3300028381 Bacteria 1109
506 Ga0268264_10942394 3300028381 Bacteria 868
507 Ga0307405_10098798 3300031731 Bacteria 1952
508 Ga0307413_10011656 3300031824 Bacteria 4337
509 Ga0307410_10103823 3300031852 Bacteria 2042
510 Ga0307410_10548988 3300031852 Unclassified 957
511 Ga0307407_10088484 3300031903 Bacteria 1892
512 Ga0307412_10224463 3300031911 Bacteria 1442
513 Ga0307409_100264981 3300031995 Bacteria 1579
514 Ga0307414_10007054 3300032004 Bacteria 6299
515 Ga0307414_10247385 3300032004 Bacteria 1480
516 Ga0307411_10146974 3300032005 Bacteria 1746
517 Ga0307411_10282241 3300032005 Bacteria 1322
518 Ga0307415_100016584 3300032126 Bacteria 4395
519 Ga0307415_100527181 3300032126 Unclassified 1038
520 Ga0373942_0027992 3300035207 Bacteria 1470
521 Ga0373937_0448867 3300036401 Bacteria 1225
522 Ga0395900_0291407 3300037418 Bacteria 1621
523 Ga0450923_036805 3300042125 Bacteria 1016
524 Ga0450896_000017 3300042133 Bacteria 8941
525 Ga0450918_002357 3300042531 Bacteria 3571
526 Ga0453683_0447522 3300044673 Unclassified 835
527 Ga0451576_0026581 3300045051 Bacteria 6224
528 Ga0451576_0704716 3300045051 Bacteria 1061
529 Ga0451576_0832108 3300045051 Unclassified 969
530 Ga0495598_0017488 3300046537 Bacteria 1849
531 Ga0495598_0032284 3300046537 Bacteria 1479
532 Ga0495621_0011384 3300046539 Bacteria 2750
533 Ga0495656_0033580 3300046615 Unclassified 2095
534 Ga0496100_0602314 3300048903 Unclassified 853
535 Ga0496104_0095333 3300048907 Bacteria 2847
536 Ga0496104_0912127 3300048907 Bacteria 783
537 Ga0496108_0414416 3300048911 Bacteria 1177
538 Ga0496109_0408987 3300048912 Bacteria 1282
539 Ga0496112_0191526 3300048915 Bacteria 2007
540 Ga0496112_0335872 3300048915 Bacteria 1455
541 Ga0496112_0431417 3300048915 Bacteria 1256
542 Ga0496113_0240552 3300048916 Bacteria 1444
543 Ga0496113_0266158 3300048916 Bacteria 1370
544 Ga0501291_019082 3300049514 Bacteria 1073
545 Ga0501292_035153 3300049515 Unclassified 852
546 Ga0501297_007805 3300049520 Bacteria 1169
547 Ga0501298_015633 3300049521 Bacteria 1368
548 Ga0501299_013496 3300049522 Bacteria 1410
549 Ga0501300_017500 3300049523 Unclassified 1046
550 Ga0501034_0209270 3300049571 Bacteria 1906
551 Ga0501038_0022283 3300049574 Bacteria 5678
552 Ga0501040_0496548 3300049576 Unclassified 880
553 Ga0501072_0062374 3300049588 Bacteria 2941
554 Ga0501198_001083 3300049649 Bacteria 3477
555 Ga0501199_008703 3300049650 Unclassified 1066
556 Ga0501202_009359 3300049652 Bacteria 1800
557 Ga0501209_049344 3300049656 Unclassified 1143
558 Ga0501216_000203 3300049660 Bacteria 6500
559 Ga0501217_000059 3300049661 Bacteria 13120
560 Ga0501217_008576 3300049661 Bacteria 2211
561 Ga0501223_006360 3300049663 Bacteria 2445
562 Ga0501223_033450 3300049663 Unclassified 999
563 Ga0501227_000127 3300049665 Bacteria 13576
564 Ga0501227_035373 3300049665 Bacteria 1215
565 Ga0501230_001020 3300049667 Bacteria 3196
566 Ga0501233_011596 3300049668 Bacteria 1756
567 Ga0501233_087129 3300049668 Unclassified 811
568 Ga0501235_003026 3300049669 Bacteria 3626
569 Ga0501235_003448 3300049669 Bacteria 3421
570 Ga0501236_021127 3300049670 Unclassified 963
571 Ga0501239_002317 3300049672 Bacteria 1718
572 Ga0501240_000220 3300049673 Bacteria 4272
573 Ga0501243_000124 3300049675 Bacteria 8523
574 Ga0501243_003724 3300049675 Bacteria 2273
575 Ga0501246_004302 3300049676 Unclassified 1169
576 Ga0501247_013283 3300049677 Unclassified 1011
577 Ga0501256_006616 3300049685 Bacteria 1049
578 Ga0501257_009462 3300049686 Bacteria 2202
579 Ga0501260_002939 3300049689 Bacteria 1505
580 Ga0501225_0000783 3300049705 Bacteria 9940
581 Ga0501225_0019888 3300049705 Bacteria 1856
582 Ga0501229_009205 3300049706 Bacteria 1239
583 Ga0501234_017706 3300049707 Bacteria 1127
584 Ga0501263_003417 3300049760 Bacteria 1694
585 Ga0501273_002528 3300049770 Bacteria 1867
586 Ga0501273_008668 3300049770 Bacteria 1220
587 Ga0501283_000160 3300049779 Bacteria 8610
588 Ga0501204_001390 3300049850 Bacteria 2357
589 Ga0501212_007871 3300049851 Bacteria 1471
590 Ga0501226_001787 3300049853 Bacteria 2700
591 nmdc:mga0k408_7181_c1 3300050493 Bacteria 5953
592 nmdc:mga06z11_130891_c1 3300050494 Bacteria 1409
593 nmdc:mga05p37_1512_c1 3300050507 Bacteria 27033
594 nmdc:mga05p37_555004_c1 3300050507 Unclassified 1306
595 nmdc:mga05p37_6586_c1 3300050507 Bacteria 13694
596 nmdc:mga09592_120804_c1 3300050508 Bacteria 2250
597 nmdc:mga09592_59274_c1 3300050508 Bacteria 3236
598 nmdc:mga06r32_16224_c1 3300050510 Bacteria 6784
599 nmdc:mga08y16_143614_c1 3300050511 Bacteria 2481
600 nmdc:mga08y16_21613_c1 3300050511 Bacteria 6795
601 nmdc:mga08y16_2547_c1 3300050511 Bacteria 18743
602 nmdc:mga08y16_345534_c1 3300050511 Bacteria 1529
603 nmdc:mga08y16_34828_c1 3300050511 Bacteria 5290
604 nmdc:mga08y16_40849_c1 3300050511 Bacteria 4860
605 nmdc:mga08y16_4941_c1 3300050511 Bacteria 13931
606 nmdc:mga0n895_145666_c1 3300050512 Unclassified 2398
607 nmdc:mga0n895_174008_c1 3300050512 Bacteria 2184
608 nmdc:mga0n895_26779_c1 3300050512 Bacteria 5467
609 nmdc:mga0n895_298421_c1 3300050512 Unclassified 1633
610 nmdc:mga0n895_490273_c1 3300050512 Bacteria 1239
611 nmdc:mga0a205_26362_c1 3300050515 Bacteria 5542
612 nmdc:mga0a205_36893_c1 3300050515 Bacteria 4699
613 nmdc:mga0a205_436733_c1 3300050515 Unclassified 1170
614 nmdc:mga0a205_616916_c1 3300050515 Bacteria 937
615 Ga0495601_0127871 3300053077 Bacteria 1654
616 Ga0530510_0008058 3300061734 Bacteria 7349
617 Ga0530510_0319246 3300061734 Bacteria 1164
618 Ga0111539_10246376
619 SwRhRL2b_contig_3301351
620 MBSR1b_contig_5710850
621 JGI24748J21848_1000031
622 JGI24034J26672_10000005
623 JGI24742J22300_10011011
624 JGI24751J29686_10000015
625 rootL2_10248591
626 Ga0065704_10139768
627 Ga0065712_10001353
628 Ga0065712_10001618
629 Ga0065712_10019549
630 Ga0065712_10105208
631 Ga0065715_10001589
632 Ga0065715_10151270
633 Ga0065715_10209628
634 Ga0065715_10224945
635 Ga0065715_10259257
636 Ga0065707_10035470
637 Ga0065707_10127096
638 Ga0070690_100147693
639 Ga0070690_100163521
640 Ga0070690_100451957
641 Ga0070670_100000182
642 Ga0070670_100262403
643 Ga0068869_100006915
644 Ga0068869_100021332
645 Ga0068869_100151100
646 Ga0068869_100151981
647 Ga0068869_100247032
648 Ga0070680_100026960
649 Ga0070680_100177224
650 Ga0068868_100375370
651 Ga0070660_100450769
652 Ga0070689_100000729
653 Ga0070689_100035068
654 Ga0070689_100075371
655 Ga0070689_100077039
656 Ga0070689_100118677
657 Ga0070689_100151638
658 Ga0070689_100376751
659 Ga0070687_100031252
660 Ga0070661_100174243
661 Ga0070692_10345154
662 Ga0070669_100102486
663 Ga0070669_100131193
664 Ga0070669_100150835
665 Ga0070669_100224180
666 Ga0070669_100633575
667 Ga0070675_100012818
668 Ga0070675_100053660
669 Ga0070675_100098432
670 Ga0070675_100104130
671 Ga0070675_100120487
672 Ga0070675_100121966
673 Ga0070671_100000205
674 Ga0070671_100064295
675 Ga0070671_100117557
676 Ga0070671_100130344
677 Ga0070673_100024003
678 Ga0070673_100048132
679 Ga0070673_100074064
680 Ga0070673_100096265
681 Ga0070673_100102569
682 Ga0070673_100132541
683 Ga0070673_100210352
684 Ga0070673_100239013
685 Ga0070673_100388718
686 Ga0070673_100587647
687 Ga0070688_100124858
688 Ga0070688_100230472
689 Ga0070659_100138972
690 Ga0070659_100317921
691 Ga0070667_100126794
692 Ga0070667_100314021
693 Ga0070703_10000395
694 Ga0070703_10022729
695 Ga0070703_10042920
696 Ga0070701_10053088
697 Ga0070701_10114445
698 Ga0070705_100001740
699 Ga0070705_100097590
700 Ga0070705_100102440
701 Ga0070700_100001052
702 Ga0070700_100001906
703 Ga0070700_100014217
704 Ga0070700_100019044
705 Ga0070700_100113135
706 Ga0070700_100203277
707 Ga0070700_100327421
708 Ga0070694_100010755
709 Ga0070694_100022002
710 Ga0070694_100207017
711 Ga0070694_100357704
712 Ga0070694_100638895
713 Ga0070663_100784077
714 Ga0070678_100099009
715 Ga0068867_100046854
716 Ga0068867_100085872
717 Ga0068867_100263063
718 Ga0070685_10070194
719 Ga0070707_100039276
720 Ga0070699_100001121
721 Ga0070697_100247829
722 Ga0070672_100050518
723 Ga0070672_100056116
724 Ga0070686_100082344
725 Ga0070695_100022113
726 Ga0070693_100000409
727 Ga0070665_100045737
728 Ga0070665_100237277
729 Ga0070704_100037681
730 Ga0070704_100051111
731 Ga0070704_100079354
732 Ga0070704_100142874
733 Ga0070704_100353235
734 Ga0068855_100534948
735 Ga0070664_100435494
736 Ga0070664_100683813
737 Ga0068857_100047230
738 Ga0068854_100110100
739 Ga0068854_100299937
740 Ga0068854_100347035
741 Ga0068854_100383534
742 Ga0070702_100018079
743 Ga0070702_100067790
744 Ga0070702_100267172
745 Ga0070702_100271536
746 Ga0068852_100354363
747 Ga0068852_100464489
748 Ga0068852_100930679
749 Ga0068852_101012471
750 Ga0068859_100001631
751 Ga0068859_100002033
752 Ga0068859_100002516
753 Ga0068859_100007329
754 Ga0068859_100018867
755 Ga0068859_100036284
756 Ga0068859_100048238
757 Ga0068859_100052241
758 Ga0068859_100098073
759 Ga0068859_100153877
760 Ga0068859_100203441
761 Ga0068859_100258485
762 Ga0068859_100293855
763 Ga0068859_100320659
764 Ga0068859_101069747
765 Ga0068864_100013212
766 Ga0068864_100015653
767 Ga0068864_100020670
768 Ga0068864_100059940
769 Ga0068864_100074461
770 Ga0068864_100076952
771 Ga0068864_100222744
772 Ga0068864_100422152
773 Ga0068864_100500894
774 Ga0068866_10003289
775 Ga0068861_100002212
776 Ga0068861_100324520
777 Ga0068861_100340176
778 Ga0068861_100510190
779 Ga0068861_100554271
780 Ga0068861_100558577
781 Ga0068861_100952722
782 Ga0068851_10008419
783 Ga0068870_10005210
784 Ga0068870_10049222
785 Ga0068870_10132264
786 Ga0068863_100019120
787 Ga0068863_100111155
788 Ga0068863_100153528
789 Ga0068863_100367370
790 Ga0068863_100446003
791 Ga0068863_100450136
792 Ga0068863_100667392
793 Ga0068858_100000384
794 Ga0068858_100015230
795 Ga0068858_100019217
796 Ga0068858_100205426
797 Ga0068858_100266976
798 Ga0068858_100372938
799 Ga0068858_100741193
800 Ga0068860_100003375
801 Ga0068860_100005585
802 Ga0068860_100149088
803 Ga0068860_100181570
804 Ga0068860_100356846
805 Ga0068860_100628602
806 Ga0068862_100098579
807 Ga0068862_100099422
808 Ga0068862_100248325
809 Ga0068862_100311581
810 Ga0068862_100341989
811 Ga0068862_100395567
812 Ga0075367_10066182
813 Ga0097621_100015878
814 Ga0097621_100069777
815 Ga0097621_100101236
816 Ga0097621_100451710
817 Ga0068871_100013437
818 Ga0068871_100030772
819 Ga0068871_100048143
820 Ga0068871_100364571
821 Ga0075428_100011300
822 Ga0075428_100013940
823 Ga0075428_100074023
824 Ga0075428_100279905
825 Ga0075430_100021907
826 Ga0075431_100009482
827 Ga0075431_100121656
828 Ga0075431_100749645
829 Ga0075433_10106585
830 Ga0075433_10111512
831 Ga0075433_10409333
832 Ga0075433_10646647
833 Ga0075434_100028768
834 Ga0075434_100146497
835 Ga0075434_100171659
836 Ga0075429_100007935
837 Ga0075429_100421117
838 Ga0075429_100427077
839 Ga0075429_100463379
840 Ga0068865_100019337
841 Ga0075436_100574748
842 Ga0097620_100001631
843 Ga0097620_100002033
844 Ga0097620_100002516
845 Ga0097620_100007329
846 Ga0097620_100018867
847 Ga0097620_100036284
848 Ga0097620_100048239
849 Ga0097620_100052242
850 Ga0097620_100098066
851 Ga0097620_100153887
852 Ga0097620_100203451
853 Ga0097620_100258490
854 Ga0097620_100293874
855 Ga0097620_100320656
856 Ga0097620_101069775
857 Ga0075435_100337462
858 Ga0105240_10580323
859 Ga0111539_10003176
860 Ga0111539_10003183
861 Ga0111539_10003919
862 Ga0111539_10004234
863 Ga0111539_10013474
864 Ga0111539_10025118
865 Ga0111539_10037903
866 Ga0111539_10111485
867 Ga0111539_10134193
868 Ga0111539_10144463
869 Ga0111539_10229769
870 Ga0111539_10483563
871 Ga0105245_11159344
872 Ga0105247_10000033
873 Ga0105247_10000512
874 Ga0105247_10072664
875 Ga0105247_10097133
876 Ga0105247_10604666
877 Ga0114129_10001093
878 Ga0114129_10008409
879 Ga0114129_10011569
880 Ga0114129_10021588
881 Ga0114129_10075778
882 Ga0114129_10114446
883 Ga0114129_10163272
884 Ga0114129_10863098
885 Ga0105243_10000349
886 Ga0105243_10006323
887 Ga0105243_10216399
888 Ga0105243_10404129
889 Ga0105243_10412638
890 Ga0105241_10263289
891 Ga0105241_10303045
892 Ga0105242_10000162
893 Ga0105242_10000376
894 Ga0105242_10073717
895 Ga0105242_10078867
896 Ga0105242_10149827
897 Ga0105248_10004162
898 Ga0105248_10010708
899 Ga0105248_10010732
900 Ga0105248_10011214
901 Ga0105248_10046102
902 Ga0105248_10055723
903 Ga0105248_10130889
904 Ga0105248_10140550
905 Ga0105248_10192427
906 Ga0105248_10235578
907 Ga0105248_10456109
908 Ga0105248_10518936
909 Ga0105248_10541728
910 Ga0105237_10130566
911 Ga0105238_10001162
912 Ga0105238_10034132
913 Ga0105249_10001330
914 Ga0105249_10025297
915 Ga0105249_10033851
916 Ga0105249_10062039
917 Ga0105249_10084439
918 Ga0105249_10438682
919 Ga0105249_10623351
920 Ga0105239_10095767
921 Ga0105239_10314487
922 Ga0105246_10304328
923 Ga0157371_10499791
924 Ga0157374_10190646
925 Ga0157374_10547409
926 Ga0157378_10000094
927 Ga0157378_10001855
928 Ga0157378_10014934
929 Ga0157378_10078664
930 Ga0157378_10455245
931 Ga0163162_10001025
932 Ga0163162_10003397
933 Ga0163162_10011291
934 Ga0163162_10025532
935 Ga0163162_10104672
936 Ga0163162_10296077
937 Ga0163162_10360914
938 Ga0163162_10483680
939 Ga0163162_10635686
940 Ga0157372_10068301
941 Ga0157375_10002895
942 Ga0157375_10003628
943 Ga0157375_10004555
944 Ga0157375_10011429
945 Ga0157375_10061555
946 Ga0157375_10079969
947 Ga0157375_10083475
948 Ga0157375_10286031
949 Ga0157375_10317877
950 Ga0157375_10358822
951 Ga0163163_10000142
952 Ga0163163_10006582
953 Ga0163163_10009034
954 Ga0163163_10009552
955 Ga0163163_10022549
956 Ga0163163_10026731
957 Ga0163163_10065776
958 Ga0163163_10154508
959 Ga0163163_10166522
960 Ga0163163_10416147
961 Ga0163163_10472407
962 Ga0163163_10511702
963 Ga0163163_10565560
964 Ga0163163_10866789
965 Ga0157380_10004355
966 Ga0157380_10030601
967 Ga0157380_10082449
968 Ga0157380_10224179
969 Ga0157380_10477288
970 Ga0157380_10529301
971 Ga0157377_10078693
972 Ga0157377_10162687
973 Ga0157377_10290693
974 Ga0157379_10019338
975 Ga0157379_10130551
976 Ga0157376_10027427
977 Ga0157376_10064641
978 Ga0163161_10154175
979 Ga0207672_1000162
980 Ga0207697_10006933
981 Ga0207656_10004845
982 Ga0207653_10000478
983 Ga0207642_10073429
984 Ga0207710_10000001
985 Ga0207710_10000453
986 Ga0207710_10063573
987 Ga0207688_10016385
988 Ga0207680_10150940
989 Ga0207647_10018470
990 Ga0207645_10298062
991 Ga0207643_10000986
992 Ga0207643_10192404
993 Ga0207643_10365067
994 Ga0207654_10198208
995 Ga0207654_10369928
996 Ga0207671_10096045
997 Ga0207660_10013376
998 Ga0207660_10167976
999 Ga0207660_10177995
1000 Ga0207662_10021237
1001 Ga0207662_10021995
1002 Ga0207662_10055590
1003 Ga0207649_10215716
1004 Ga0207646_10175928
1005 Ga0207681_10241481
1006 Ga0207681_10320824
1007 Ga0207694_10000994
1008 Ga0207650_10000017
1009 Ga0207650_10242084
1010 Ga0207650_10372593
1011 Ga0207659_10029886
1012 Ga0207659_10051314
1013 Ga0207659_10066392
1014 Ga0207659_10074578
1015 Ga0207659_10385738
1016 Ga0207659_10662834
1017 Ga0207644_10002650
1018 Ga0207644_10048090
1019 Ga0207690_10085628
1020 Ga0207706_10170701
1021 Ga0207686_10000069
1022 Ga0207686_10001846
1023 Ga0207686_10091056
1024 Ga0207686_10189928
1025 Ga0207686_10615241
1026 Ga0207709_10000025
1027 Ga0207709_10001629
1028 Ga0207709_10524572
1029 Ga0207670_10000352
1030 Ga0207670_10023210
1031 Ga0207670_10054427
1032 Ga0207670_10360476
1033 Ga0207669_10126832
1034 Ga0207691_10007596
1035 Ga0207691_10043896
1036 Ga0207691_10154052
1037 Ga0207711_10003783
1038 Ga0207711_10006570
1039 Ga0207711_10029079
1040 Ga0207711_10070213
1041 Ga0207711_10095094
1042 Ga0207711_10101376
1043 Ga0207711_10164658
1044 Ga0207711_10391989
1045 Ga0207711_10523997
1046 Ga0207711_10630374
1047 Ga0207689_10008168
1048 Ga0207689_10144707
1049 Ga0207689_10163330
1050 Ga0207689_10164965
1051 Ga0207689_10564538
1052 Ga0207651_10032958
1053 Ga0207651_10043741
1054 Ga0207651_10089157
1055 Ga0207651_10115258
1056 Ga0207651_10131410
1057 Ga0207651_10185575
1058 Ga0207651_10530689
1059 Ga0207651_10774901
1060 Ga0207712_10000650
1061 Ga0207712_10028443
1062 Ga0207712_10046223
1063 Ga0207712_10096627
1064 Ga0207712_10586601
1065 Ga0207712_10717273
1066 Ga0207640_10089209
1067 Ga0207640_10100015
1068 Ga0207640_10373789
1069 Ga0207640_10393010
1070 Ga0207677_10216130
1071 Ga0207677_10424621
1072 Ga0207677_10546018
1073 Ga0207703_10000274
1074 Ga0207703_10028902
1075 Ga0207703_10048137
1076 Ga0207703_10103418
1077 Ga0207703_10224766
1078 Ga0207703_10313096
1079 Ga0207703_10671853
1080 Ga0207708_10000088
1081 Ga0207708_10003028
1082 Ga0207708_10003660
1083 Ga0207708_10013769
1084 Ga0207708_10050118
1085 Ga0207708_10074923
1086 Ga0207708_10256011
1087 Ga0207641_10226707
1088 Ga0207641_10247828
1089 Ga0207641_10375836
1090 Ga0207648_10052051
1091 Ga0207648_10391927
1092 Ga0207648_10459911
1093 Ga0207676_10003643
1094 Ga0207676_10009824
1095 Ga0207676_10030706
1096 Ga0207676_10060921
1097 Ga0207676_10118390
1098 Ga0207676_10185445
1099 Ga0207676_10255134
1100 Ga0207676_10342816
1101 Ga0207674_10150503
1102 Ga0207674_10519209
1103 Ga0207675_100011027
1104 Ga0207675_100217591
1105 Ga0207675_100363863
1106 Ga0207675_100530227
1107 Ga0207698_10480079
1108 Ga0207428_10014016
1109 Ga0207428_10023890
1110 Ga0207428_10025879
1111 Ga0207428_10154680
1112 Ga0207428_10183353
1113 Ga0207428_10405036
1114 Ga0268266_10163394
1115 Ga0268265_10080505
1116 Ga0268265_10296028
1117 Ga0268265_10521926
1118 Ga0268265_10557949
1119 Ga0268264_10156940
1120 Ga0268264_10165630
1121 Ga0268264_10426947
1122 Ga0268264_10574158
1123 Ga0268264_10942394
1124 Ga0307405_10098798
1125 Ga0307413_10011656
1126 Ga0307410_10103823
1127 Ga0307410_10548988
1128 Ga0307407_10088484
1129 Ga0307412_10224463
1130 Ga0307409_100264981
1131 Ga0307414_10007054
1132 Ga0307414_10247385
1133 Ga0307411_10146974
1134 Ga0307411_10282241
1135 Ga0307415_100016584
1136 Ga0307415_100527181
1137 Ga0373942_0027992
1138 Ga0373937_0448867
1139 Ga0395900_0291407
1140 Ga0450923_036805
1141 Ga0450896_000017
1142 Ga0450918_002357
1143 Ga0453683_0447522
1144 Ga0451576_0026581
1145 Ga0451576_0704716
1146 Ga0451576_0832108
1147 Ga0495598_0017488
1148 Ga0495598_0032284
1149 Ga0495621_0011384
1150 Ga0495656_0033580
1151 Ga0496100_0602314
1152 Ga0496104_0095333
1153 Ga0496104_0912127
1154 Ga0496108_0414416
1155 Ga0496109_0408987
1156 Ga0496112_0191526
1157 Ga0496112_0335872
1158 Ga0496112_0431417
1159 Ga0496113_0240552
1160 Ga0496113_0266158
1161 Ga0501291_019082
1162 Ga0501292_035153
1163 Ga0501297_007805
1164 Ga0501298_015633
1165 Ga0501299_013496
1166 Ga0501300_017500
1167 Ga0501034_0209270
1168 Ga0501038_0022283
1169 Ga0501040_0496548
1170 Ga0501072_0062374
1171 Ga0501198_001083
1172 Ga0501199_008703
1173 Ga0501202_009359
1174 Ga0501209_049344
1175 Ga0501216_000203
1176 Ga0501217_000059
1177 Ga0501217_008576
1178 Ga0501223_006360
1179 Ga0501223_033450
1180 Ga0501227_000127
1181 Ga0501227_035373
1182 Ga0501230_001020
1183 Ga0501233_011596
1184 Ga0501233_087129
1185 Ga0501235_003026
1186 Ga0501235_003448
1187 Ga0501236_021127
1188 Ga0501239_002317
1189 Ga0501240_000220
1190 Ga0501243_000124
1191 Ga0501243_003724
1192 Ga0501246_004302
1193 Ga0501247_013283
1194 Ga0501256_006616
1195 Ga0501257_009462
1196 Ga0501260_002939
1197 Ga0501225_0000783
1198 Ga0501225_0019888
1199 Ga0501229_009205
1200 Ga0501234_017706
1201 Ga0501263_003417
1202 Ga0501273_002528
1203 Ga0501273_008668
1204 Ga0501283_000160
1205 Ga0501204_001390
1206 Ga0501212_007871
1207 Ga0501226_001787
1208 nmdc:mga0k408_7181_c1
1209 nmdc:mga06z11_130891_c1
1210 nmdc:mga05p37_1512_c1
1211 nmdc:mga05p37_555004_c1
1212 nmdc:mga05p37_6586_c1
1213 nmdc:mga09592_120804_c1
1214 nmdc:mga09592_59274_c1
1215 nmdc:mga06r32_16224_c1
1216 nmdc:mga08y16_143614_c1
1217 nmdc:mga08y16_21613_c1
1218 nmdc:mga08y16_2547_c1
1219 nmdc:mga08y16_345534_c1
1220 nmdc:mga08y16_34828_c1
1221 nmdc:mga08y16_40849_c1
1222 nmdc:mga08y16_4941_c1
1223 nmdc:mga0n895_145666_c1
1224 nmdc:mga0n895_174008_c1
1225 nmdc:mga0n895_26779_c1
1226 nmdc:mga0n895_298421_c1
1227 nmdc:mga0n895_490273_c1
1228 nmdc:mga0a205_26362_c1
1229 nmdc:mga0a205_36893_c1
1230 nmdc:mga0a205_436733_c1
1231 nmdc:mga0a205_616916_c1
1232 Ga0495601_0127871
1233 Ga0530510_0008058
1234 Ga0530510_0319246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18306

LDcluster4

SLOG cluster4 family

76

215

0.87

PF03641

Lysine_decarbox

Possible lysine decarboxylase

120

252

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w2i-assembly1.cif.gz_D crystal structure of log (rv1205) from mycobacterium tuberculosis 0.8417 41 214
5zbl-assembly2.cif.gz_D crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.8387 42 214
3qua-assembly1.cif.gz_B crystal structure of a putative uncharacterized protein and possible molybdenum cofactor protein from mycobacterium smegmatis 0.8343 40 214
5zbl-assembly2.cif.gz_C crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.8315 40 218
5zbj-assembly1.cif.gz_A-2 crystal structure of type-i log from pseudomonas aeruginosa pao1 0.8295 41 217
ID Description Score Start End Superfamily
3sbxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8309 40 214 3.40.50.450
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8212 20 222 3.40.50.450
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8121 41 214 3.40.50.450
3sbxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8096 40 214 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7957 11 218 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A2D6G6W4-F1-model_v4 LOG family protein 0.8942 39 222 GO:0005829
GO:0016020
AF-A0A520VUI7-F1-model_v4 LOG family protein 0.8925 36 221 GO:0005829
AF-A0A0M8K9V5-F1-model_v4 DNA-binding protein 0.8911 36 221 GO:0005829
AF-A0A1J5AK16-F1-model_v4 DNA-binding protein 0.8858 40 214 GO:0005829
AF-A0A419ES31-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.8857 40 223 GO:0005829
GO:0009691
GO:0016787

Map