F469622
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 617 | 271 | 1234 | 237 |
Family's Representative Sequence
| Representative Sequence | 3300005718|Ga0068866_10106183|Ga0068866_101061832 |
| Length | 278 |
| Sequence | MIASGAAEIVTLPSPFRAHVGKLQGLKLYLKERRTMKKIFSFTVVALLLCTGAQAQQHEADRLRHAGEVLMEILNIPDNIPKSVLDKSECVIVIPSVKKLAVGIGANYGRGAMTCRGGQSFTGPWGPPAMVALEGGNIGFQLGGQATDFVLLVVNPKGIDSILKSKVKLGADAAAAAGPKGRDAQAATDVLMHAEILTYSRSRGLFAGISLDGSTLRPDNSATEKVYGRKVSARDVVIGHKVGTPKAGQLLVSALQKASPRNLSDPKSLHEAGAEEKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 68 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 159 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 170 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 172 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 181 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 256 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 259 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 260 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.84 |
| Metatranscriptomes | 0.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.13 |
| Nodule | 0 |
| Rhizoplane | 4.86 |
| Rhizosphere | 93.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068866_10106183 | 3300005718 | Unclassified | 1558 |
| 2 | Ga0058862_11980645 | 3300004803 | Unclassified | 854 |
| 3 | Ga0065715_10023449 | 3300005293 | Bacteria | 2079 |
| 4 | Ga0065715_10237222 | 3300005293 | Bacteria | 1158 |
| 5 | Ga0065707_10195922 | 3300005295 | Unclassified | 1335 |
| 6 | Ga0070683_100028438 | 3300005329 | Bacteria | 5052 |
| 7 | Ga0070683_100050549 | 3300005329 | Bacteria | 3849 |
| 8 | Ga0070683_100068644 | 3300005329 | Bacteria | 3303 |
| 9 | Ga0070683_100151438 | 3300005329 | Bacteria | 2199 |
| 10 | Ga0070670_100001056 | 3300005331 | Bacteria | 21882 |
| 11 | Ga0070670_100004237 | 3300005331 | Bacteria | 12004 |
| 12 | Ga0070670_100281962 | 3300005331 | Bacteria | 1451 |
| 13 | Ga0068869_100013816 | 3300005334 | Bacteria | 5381 |
| 14 | Ga0070666_10167821 | 3300005335 | Bacteria | 1536 |
| 15 | Ga0070680_100081858 | 3300005336 | Bacteria | 2664 |
| 16 | Ga0068868_100010310 | 3300005338 | Bacteria | 6760 |
| 17 | Ga0068868_100014612 | 3300005338 | Bacteria | 5791 |
| 18 | Ga0068868_100025822 | 3300005338 | Bacteria | 4472 |
| 19 | Ga0070660_100002598 | 3300005339 | Bacteria | 12395 |
| 20 | Ga0070689_100555856 | 3300005340 | Bacteria | 989 |
| 21 | Ga0070687_100221792 | 3300005343 | Bacteria | 1158 |
| 22 | Ga0070661_100033197 | 3300005344 | Bacteria | 3738 |
| 23 | Ga0070669_100469806 | 3300005353 | Unclassified | 1039 |
| 24 | Ga0070675_100017446 | 3300005354 | Bacteria | 5704 |
| 25 | Ga0070659_100051605 | 3300005366 | Bacteria | 3234 |
| 26 | Ga0070709_10019198 | 3300005434 | Bacteria | 3947 |
| 27 | Ga0070709_10057178 | 3300005434 | Unclassified | 2469 |
| 28 | Ga0070709_10157631 | 3300005434 | Bacteria | 1575 |
| 29 | Ga0070709_10181394 | 3300005434 | Bacteria | 1478 |
| 30 | Ga0070714_100006981 | 3300005435 | Bacteria | 8755 |
| 31 | Ga0070714_100040722 | 3300005435 | Bacteria | 3917 |
| 32 | Ga0070714_100582210 | 3300005435 | Bacteria | 1073 |
| 33 | Ga0070713_100003646 | 3300005436 | Bacteria | 10190 |
| 34 | Ga0070713_100008055 | 3300005436 | Bacteria | 7446 |
| 35 | Ga0070713_100010846 | 3300005436 | Bacteria | 6604 |
| 36 | Ga0070713_100073031 | 3300005436 | Unclassified | 2903 |
| 37 | Ga0070713_100105822 | 3300005436 | Unclassified | 2445 |
| 38 | Ga0070713_100116344 | 3300005436 | Bacteria | 2338 |
| 39 | Ga0070713_100244282 | 3300005436 | Unclassified | 1636 |
| 40 | Ga0070713_100249149 | 3300005436 | Bacteria | 1620 |
| 41 | Ga0070710_10021668 | 3300005437 | Unclassified | 3353 |
| 42 | Ga0070710_10161020 | 3300005437 | Unclassified | 1392 |
| 43 | Ga0070710_10200389 | 3300005437 | Unclassified | 1260 |
| 44 | Ga0070711_100003089 | 3300005439 | Bacteria | 9625 |
| 45 | Ga0070705_100018628 | 3300005440 | Bacteria | 3642 |
| 46 | Ga0070705_100167005 | 3300005440 | Bacteria | 1477 |
| 47 | Ga0070705_100398151 | 3300005440 | Bacteria | 1019 |
| 48 | Ga0070708_100035530 | 3300005445 | Bacteria | 4341 |
| 49 | Ga0070708_100036183 | 3300005445 | Bacteria | 4305 |
| 50 | Ga0070708_100056917 | 3300005445 | Unclassified | 3479 |
| 51 | Ga0070708_100057686 | 3300005445 | Bacteria | 3457 |
| 52 | Ga0070708_100621006 | 3300005445 | Bacteria | 1019 |
| 53 | Ga0070663_100273832 | 3300005455 | Unclassified | 1343 |
| 54 | Ga0070662_100018342 | 3300005457 | Bacteria | 4733 |
| 55 | Ga0070681_10000453 | 3300005458 | Bacteria | 33564 |
| 56 | Ga0070681_10023797 | 3300005458 | Bacteria | 6166 |
| 57 | Ga0070681_10026795 | 3300005458 | Bacteria | 5795 |
| 58 | Ga0070681_10140422 | 3300005458 | Bacteria | 2346 |
| 59 | Ga0070681_10209142 | 3300005458 | Bacteria | 1867 |
| 60 | Ga0068867_100039000 | 3300005459 | Bacteria | 3461 |
| 61 | Ga0068867_100147016 | 3300005459 | Unclassified | 1848 |
| 62 | Ga0070685_10140211 | 3300005466 | Unclassified | 1521 |
| 63 | Ga0070706_100131844 | 3300005467 | Bacteria | 2332 |
| 64 | Ga0070706_100153144 | 3300005467 | Unclassified | 2152 |
| 65 | Ga0070707_100084620 | 3300005468 | Bacteria | 3065 |
| 66 | Ga0070707_100095684 | 3300005468 | Unclassified | 2876 |
| 67 | Ga0070707_100153097 | 3300005468 | Bacteria | 2245 |
| 68 | Ga0070698_100006903 | 3300005471 | Bacteria | 12304 |
| 69 | Ga0070698_100022863 | 3300005471 | Bacteria | 6537 |
| 70 | Ga0070698_100423759 | 3300005471 | Bacteria | 1265 |
| 71 | Ga0070699_100178761 | 3300005518 | Unclassified | 1882 |
| 72 | Ga0070699_100329441 | 3300005518 | Bacteria | 1373 |
| 73 | Ga0070679_100179922 | 3300005530 | Bacteria | 2087 |
| 74 | Ga0070684_100088154 | 3300005535 | Bacteria | 2756 |
| 75 | Ga0070684_100108052 | 3300005535 | Bacteria | 2492 |
| 76 | Ga0070684_100130455 | 3300005535 | Bacteria | 2267 |
| 77 | Ga0070697_100000393 | 3300005536 | Bacteria | 33883 |
| 78 | Ga0070697_100054087 | 3300005536 | Bacteria | 3263 |
| 79 | Ga0070697_100202723 | 3300005536 | Unclassified | 1686 |
| 80 | Ga0070697_100504494 | 3300005536 | Bacteria | 1058 |
| 81 | Ga0068853_100023219 | 3300005539 | Bacteria | 5189 |
| 82 | Ga0068853_100051528 | 3300005539 | Bacteria | 3543 |
| 83 | Ga0068853_100106426 | 3300005539 | Bacteria | 2486 |
| 84 | Ga0068853_100415838 | 3300005539 | Unclassified | 1260 |
| 85 | Ga0070672_100074725 | 3300005543 | Unclassified | 2704 |
| 86 | Ga0070693_100026905 | 3300005547 | Bacteria | 3109 |
| 87 | Ga0070693_100031033 | 3300005547 | Bacteria | 2926 |
| 88 | Ga0068855_100000151 | 3300005563 | Bacteria | 88133 |
| 89 | Ga0068855_100003935 | 3300005563 | Bacteria | 18132 |
| 90 | Ga0068855_100014636 | 3300005563 | Bacteria | 9447 |
| 91 | Ga0068855_100095279 | 3300005563 | Bacteria | 3431 |
| 92 | Ga0068855_100102117 | 3300005563 | Bacteria | 3301 |
| 93 | Ga0068855_100102899 | 3300005563 | Bacteria | 3287 |
| 94 | Ga0068855_100410458 | 3300005563 | Bacteria | 1483 |
| 95 | Ga0070664_100002608 | 3300005564 | Bacteria | 14545 |
| 96 | Ga0070664_100007042 | 3300005564 | Bacteria | 9073 |
| 97 | Ga0070664_100011960 | 3300005564 | Bacteria | 7047 |
| 98 | Ga0068857_100000121 | 3300005577 | Bacteria | 46931 |
| 99 | Ga0068857_100061371 | 3300005577 | Bacteria | 3340 |
| 100 | Ga0068857_100247178 | 3300005577 | Unclassified | 1634 |
| 101 | Ga0068857_100530102 | 3300005577 | Unclassified | 1108 |
| 102 | Ga0068854_100002645 | 3300005578 | Bacteria | 11101 |
| 103 | Ga0068854_100024169 | 3300005578 | Bacteria | 4158 |
| 104 | Ga0068854_100061463 | 3300005578 | Unclassified | 2721 |
| 105 | Ga0068856_100000119 | 3300005614 | Bacteria | 78324 |
| 106 | Ga0068856_100002726 | 3300005614 | Bacteria | 18084 |
| 107 | Ga0068856_100006181 | 3300005614 | Bacteria | 11751 |
| 108 | Ga0068856_100008546 | 3300005614 | Bacteria | 9951 |
| 109 | Ga0068852_100075375 | 3300005616 | Bacteria | 2976 |
| 110 | Ga0068852_100181500 | 3300005616 | Bacteria | 1979 |
| 111 | Ga0068852_100354113 | 3300005616 | Bacteria | 1434 |
| 112 | Ga0068859_100000415 | 3300005617 | Bacteria | 42515 |
| 113 | Ga0068859_100239063 | 3300005617 | Unclassified | 1905 |
| 114 | Ga0068859_100769449 | 3300005617 | Unclassified | 1051 |
| 115 | Ga0068864_100001710 | 3300005618 | Bacteria | 18028 |
| 116 | Ga0068864_100049669 | 3300005618 | Bacteria | 3609 |
| 117 | Ga0068866_10047218 | 3300005718 | Bacteria | 2170 |
| 118 | Ga0068866_10056124 | 3300005718 | Bacteria | 2025 |
| 119 | Ga0068861_100209421 | 3300005719 | Bacteria | 1641 |
| 120 | Ga0068851_10007273 | 3300005834 | Bacteria | 5077 |
| 121 | Ga0068870_10017182 | 3300005840 | Bacteria | 3472 |
| 122 | Ga0068863_100005712 | 3300005841 | Bacteria | 12213 |
| 123 | Ga0068863_100205159 | 3300005841 | Bacteria | 1897 |
| 124 | Ga0068863_100373997 | 3300005841 | Bacteria | 1391 |
| 125 | Ga0068863_100533952 | 3300005841 | Unclassified | 1157 |
| 126 | Ga0068858_100001496 | 3300005842 | Bacteria | 24110 |
| 127 | Ga0068858_100027450 | 3300005842 | Bacteria | 5289 |
| 128 | Ga0068858_100119680 | 3300005842 | Bacteria | 2462 |
| 129 | Ga0068860_100119307 | 3300005843 | Bacteria | 2525 |
| 130 | Ga0068860_100406788 | 3300005843 | Unclassified | 1347 |
| 131 | Ga0068860_100812699 | 3300005843 | Unclassified | 948 |
| 132 | Ga0068862_100240502 | 3300005844 | Unclassified | 1646 |
| 133 | Ga0068862_100291305 | 3300005844 | Unclassified | 1499 |
| 134 | Ga0081540_1041944 | 3300005983 | Bacteria | 2366 |
| 135 | Ga0070717_10000966 | 3300006028 | Bacteria | 19192 |
| 136 | Ga0070717_10003354 | 3300006028 | Bacteria | 11437 |
| 137 | Ga0070717_10056203 | 3300006028 | Bacteria | 3251 |
| 138 | Ga0070717_10063383 | 3300006028 | Bacteria | 3068 |
| 139 | Ga0070717_10277723 | 3300006028 | Bacteria | 1485 |
| 140 | Ga0070717_10388759 | 3300006028 | Bacteria | 1252 |
| 141 | Ga0070717_10396772 | 3300006028 | Unclassified | 1239 |
| 142 | Ga0070715_10046875 | 3300006163 | Bacteria | 1840 |
| 143 | Ga0070715_10219206 | 3300006163 | Unclassified | 977 |
| 144 | Ga0070716_100000450 | 3300006173 | Bacteria | 17008 |
| 145 | Ga0070716_100022418 | 3300006173 | Unclassified | 3337 |
| 146 | Ga0070716_100262144 | 3300006173 | Bacteria | 1183 |
| 147 | Ga0070716_100286484 | 3300006173 | Unclassified | 1139 |
| 148 | Ga0070716_100335558 | 3300006173 | Unclassified | 1064 |
| 149 | Ga0070712_100007133 | 3300006175 | Bacteria | 6972 |
| 150 | Ga0070712_100102972 | 3300006175 | Bacteria | 2116 |
| 151 | Ga0070712_100383793 | 3300006175 | Unclassified | 1157 |
| 152 | Ga0070712_100916217 | 3300006175 | Unclassified | 756 |
| 153 | Ga0097621_100002852 | 3300006237 | Bacteria | 11866 |
| 154 | Ga0097621_100026115 | 3300006237 | Bacteria | 4578 |
| 155 | Ga0097621_100041136 | 3300006237 | Bacteria | 3719 |
| 156 | Ga0068871_100000258 | 3300006358 | Bacteria | 36543 |
| 157 | Ga0068871_100000827 | 3300006358 | Bacteria | 20732 |
| 158 | Ga0068871_100007369 | 3300006358 | Bacteria | 7852 |
| 159 | Ga0068871_100055239 | 3300006358 | Bacteria | 3224 |
| 160 | Ga0068871_100115251 | 3300006358 | Bacteria | 2265 |
| 161 | Ga0075433_10110815 | 3300006852 | Bacteria | 2435 |
| 162 | Ga0068865_100014950 | 3300006881 | Bacteria | 4943 |
| 163 | Ga0068865_100042845 | 3300006881 | Bacteria | 3089 |
| 164 | Ga0075436_100000368 | 3300006914 | Bacteria | 28841 |
| 165 | Ga0075436_100013403 | 3300006914 | Bacteria | 5613 |
| 166 | Ga0075436_100035014 | 3300006914 | Bacteria | 3463 |
| 167 | Ga0075436_100072190 | 3300006914 | Unclassified | 2388 |
| 168 | Ga0097620_100000415 | 3300006931 | Bacteria | 42515 |
| 169 | Ga0097620_100239049 | 3300006931 | Unclassified | 1905 |
| 170 | Ga0097620_100769439 | 3300006931 | Unclassified | 1051 |
| 171 | Ga0097620_100969814 | 3300006931 | Unclassified | 933 |
| 172 | Ga0075435_100019267 | 3300007076 | Bacteria | 5207 |
| 173 | Ga0075435_100222755 | 3300007076 | Unclassified | 1602 |
| 174 | Ga0099794_10011930 | 3300007265 | Bacteria | 3735 |
| 175 | Ga0099794_10013313 | 3300007265 | Unclassified | 3577 |
| 176 | Ga0099794_10022133 | 3300007265 | Bacteria | 2896 |
| 177 | Ga0099794_10117037 | 3300007265 | Bacteria | 1338 |
| 178 | Ga0099795_10000942 | 3300007788 | Bacteria | 5904 |
| 179 | Ga0099795_10007794 | 3300007788 | Unclassified | 3015 |
| 180 | Ga0099795_10115805 | 3300007788 | Bacteria | 1067 |
| 181 | Ga0099795_10195052 | 3300007788 | Unclassified | 852 |
| 182 | Ga0105240_10004947 | 3300009093 | Bacteria | 20033 |
| 183 | Ga0105240_10099613 | 3300009093 | Bacteria | 3537 |
| 184 | Ga0105240_10125847 | 3300009093 | Bacteria | 3080 |
| 185 | Ga0105240_10248262 | 3300009093 | Bacteria | 2060 |
| 186 | Ga0105240_10262209 | 3300009093 | Bacteria | 1993 |
| 187 | Ga0105245_10000076 | 3300009098 | Bacteria | 102308 |
| 188 | Ga0105245_10088884 | 3300009098 | Bacteria | 2839 |
| 189 | Ga0105245_10259569 | 3300009098 | Bacteria | 1690 |
| 190 | Ga0105241_10006972 | 3300009174 | Bacteria | 8313 |
| 191 | Ga0105241_10017151 | 3300009174 | Bacteria | 5319 |
| 192 | Ga0105241_10214708 | 3300009174 | Unclassified | 1614 |
| 193 | Ga0105242_10055360 | 3300009176 | Bacteria | 3245 |
| 194 | Ga0105242_10083847 | 3300009176 | Bacteria | 2670 |
| 195 | Ga0105248_10091968 | 3300009177 | Bacteria | 3416 |
| 196 | Ga0105248_10237864 | 3300009177 | Bacteria | 2050 |
| 197 | Ga0105248_10394694 | 3300009177 | Bacteria | 1558 |
| 198 | Ga0105237_10024941 | 3300009545 | Bacteria | 6117 |
| 199 | Ga0105237_10070004 | 3300009545 | Unclassified | 3504 |
| 200 | Ga0105237_10140637 | 3300009545 | Bacteria | 2408 |
| 201 | Ga0105238_10000439 | 3300009551 | Bacteria | 43837 |
| 202 | Ga0105238_10010036 | 3300009551 | Bacteria | 9497 |
| 203 | Ga0105238_10141679 | 3300009551 | Bacteria | 2381 |
| 204 | Ga0105238_10163862 | 3300009551 | Unclassified | 2199 |
| 205 | Ga0105238_10194865 | 3300009551 | Unclassified | 2002 |
| 206 | Ga0105249_10038016 | 3300009553 | Bacteria | 4367 |
| 207 | Ga0105249_10236657 | 3300009553 | Unclassified | 1803 |
| 208 | Ga0099796_10000665 | 3300010159 | Bacteria | 6015 |
| 209 | Ga0099796_10056062 | 3300010159 | Bacteria | 1382 |
| 210 | Ga0105239_10037520 | 3300010375 | Bacteria | 5310 |
| 211 | Ga0105239_10124426 | 3300010375 | Bacteria | 2865 |
| 212 | Ga0105239_10451507 | 3300010375 | Bacteria | 1458 |
| 213 | Ga0105246_10098841 | 3300011119 | Bacteria | 2121 |
| 214 | Ga0157371_10011209 | 3300013102 | Bacteria | 6928 |
| 215 | Ga0157370_10161392 | 3300013104 | Bacteria | 2085 |
| 216 | Ga0157369_10000108 | 3300013105 | Bacteria | 117027 |
| 217 | Ga0157369_10039021 | 3300013105 | Bacteria | 5191 |
| 218 | Ga0157369_10076715 | 3300013105 | Bacteria | 3583 |
| 219 | Ga0157369_10400361 | 3300013105 | Unclassified | 1424 |
| 220 | Ga0157369_10494638 | 3300013105 | Unclassified | 1265 |
| 221 | Ga0157369_10960356 | 3300013105 | Bacteria | 876 |
| 222 | Ga0157374_10000329 | 3300013296 | Bacteria | 43687 |
| 223 | Ga0157374_10007409 | 3300013296 | Bacteria | 9359 |
| 224 | Ga0157374_10011951 | 3300013296 | Bacteria | 7537 |
| 225 | Ga0157374_10041783 | 3300013296 | Bacteria | 4227 |
| 226 | Ga0157374_10129214 | 3300013296 | Bacteria | 2444 |
| 227 | Ga0157374_10239831 | 3300013296 | Unclassified | 1783 |
| 228 | Ga0157374_10311698 | 3300013296 | Unclassified | 1558 |
| 229 | Ga0157378_10000030 | 3300013297 | Bacteria | 124811 |
| 230 | Ga0157378_10000099 | 3300013297 | Bacteria | 81561 |
| 231 | Ga0157378_10035329 | 3300013297 | Bacteria | 4420 |
| 232 | Ga0157378_10040708 | 3300013297 | Bacteria | 4121 |
| 233 | Ga0157378_10059572 | 3300013297 | Bacteria | 3407 |
| 234 | Ga0163162_10153325 | 3300013306 | Bacteria | 2423 |
| 235 | Ga0157372_10000218 | 3300013307 | Bacteria | 63626 |
| 236 | Ga0157372_10002609 | 3300013307 | Bacteria | 19494 |
| 237 | Ga0157372_10030123 | 3300013307 | Bacteria | 5933 |
| 238 | Ga0157372_10121459 | 3300013307 | Unclassified | 3001 |
| 239 | Ga0157372_10708375 | 3300013307 | Bacteria | 1171 |
| 240 | Ga0157375_10055276 | 3300013308 | Bacteria | 3914 |
| 241 | Ga0163163_10049606 | 3300014325 | Bacteria | 4132 |
| 242 | Ga0163163_10069161 | 3300014325 | Bacteria | 3515 |
| 243 | Ga0157379_10487628 | 3300014968 | Bacteria | 1141 |
| 244 | Ga0157376_10053632 | 3300014969 | Bacteria | 3358 |
| 245 | Ga0182006_1055150 | 3300015261 | Unclassified | 1518 |
| 246 | Ga0182007_10004292 | 3300015262 | Bacteria | 6495 |
| 247 | Ga0182005_1003402 | 3300015265 | Bacteria | 5412 |
| 248 | Ga0207656_10076934 | 3300025321 | Unclassified | 1493 |
| 249 | Ga0207692_10023505 | 3300025898 | Unclassified | 2852 |
| 250 | Ga0207642_10098859 | 3300025899 | Bacteria | 1460 |
| 251 | Ga0207647_10012656 | 3300025904 | Bacteria | 5865 |
| 252 | Ga0207699_10025114 | 3300025906 | Unclassified | 3268 |
| 253 | Ga0207699_10040857 | 3300025906 | Bacteria | 2675 |
| 254 | Ga0207699_10303923 | 3300025906 | Bacteria | 1115 |
| 255 | Ga0207684_10022916 | 3300025910 | Bacteria | 5332 |
| 256 | Ga0207684_10055346 | 3300025910 | Bacteria | 3366 |
| 257 | Ga0207654_10039782 | 3300025911 | Bacteria | 2647 |
| 258 | Ga0207654_10051486 | 3300025911 | Unclassified | 2370 |
| 259 | Ga0207707_10001719 | 3300025912 | Bacteria | 20144 |
| 260 | Ga0207707_10008849 | 3300025912 | Bacteria | 8745 |
| 261 | Ga0207707_10040029 | 3300025912 | Bacteria | 4095 |
| 262 | Ga0207695_10017041 | 3300025913 | Bacteria | 8473 |
| 263 | Ga0207695_10093562 | 3300025913 | Bacteria | 3015 |
| 264 | Ga0207695_10204479 | 3300025913 | Unclassified | 1888 |
| 265 | Ga0207695_10230728 | 3300025913 | Bacteria | 1756 |
| 266 | Ga0207671_10218154 | 3300025914 | Unclassified | 1494 |
| 267 | Ga0207671_10309795 | 3300025914 | Unclassified | 1248 |
| 268 | Ga0207693_10005914 | 3300025915 | Bacteria | 10148 |
| 269 | Ga0207693_10010173 | 3300025915 | Bacteria | 7640 |
| 270 | Ga0207693_10015624 | 3300025915 | Bacteria | 6087 |
| 271 | Ga0207693_10050085 | 3300025915 | Bacteria | 3280 |
| 272 | Ga0207693_10120724 | 3300025915 | Bacteria | 2058 |
| 273 | Ga0207693_10225816 | 3300025915 | Bacteria | 1471 |
| 274 | Ga0207693_10442899 | 3300025915 | Unclassified | 1015 |
| 275 | Ga0207663_10000918 | 3300025916 | Bacteria | 13463 |
| 276 | Ga0207660_10021396 | 3300025917 | Bacteria | 4349 |
| 277 | Ga0207660_10060973 | 3300025917 | Bacteria | 2714 |
| 278 | Ga0207657_10006029 | 3300025919 | Bacteria | 12603 |
| 279 | Ga0207649_10030027 | 3300025920 | Bacteria | 3215 |
| 280 | Ga0207649_10545700 | 3300025920 | Unclassified | 886 |
| 281 | Ga0207652_10099264 | 3300025921 | Bacteria | 2569 |
| 282 | Ga0207652_10116369 | 3300025921 | Bacteria | 2375 |
| 283 | Ga0207646_10000122 | 3300025922 | Bacteria | 105908 |
| 284 | Ga0207646_10002647 | 3300025922 | Bacteria | 21021 |
| 285 | Ga0207646_10318050 | 3300025922 | Bacteria | 1406 |
| 286 | Ga0207646_10337605 | 3300025922 | Bacteria | 1361 |
| 287 | Ga0207681_10005323 | 3300025923 | Bacteria | 7904 |
| 288 | Ga0207694_10000866 | 3300025924 | Bacteria | 26945 |
| 289 | Ga0207694_10061311 | 3300025924 | Bacteria | 2927 |
| 290 | Ga0207694_10177394 | 3300025924 | Unclassified | 1726 |
| 291 | Ga0207694_10386558 | 3300025924 | Unclassified | 1162 |
| 292 | Ga0207650_10003541 | 3300025925 | Bacteria | 10714 |
| 293 | Ga0207650_10012994 | 3300025925 | Bacteria | 5758 |
| 294 | Ga0207650_10341578 | 3300025925 | Unclassified | 1230 |
| 295 | Ga0207687_10000823 | 3300025927 | Bacteria | 20970 |
| 296 | Ga0207687_10043589 | 3300025927 | Bacteria | 3092 |
| 297 | Ga0207700_10011050 | 3300025928 | Bacteria | 5737 |
| 298 | Ga0207700_10014946 | 3300025928 | Bacteria | 5102 |
| 299 | Ga0207700_10075684 | 3300025928 | Unclassified | 2609 |
| 300 | Ga0207700_10213618 | 3300025928 | Bacteria | 1632 |
| 301 | Ga0207700_10307615 | 3300025928 | Bacteria | 1370 |
| 302 | Ga0207700_10400320 | 3300025928 | Unclassified | 1203 |
| 303 | Ga0207700_10460678 | 3300025928 | Bacteria | 1121 |
| 304 | Ga0207700_10477264 | 3300025928 | Unclassified | 1101 |
| 305 | Ga0207664_10003509 | 3300025929 | Bacteria | 10473 |
| 306 | Ga0207664_10046629 | 3300025929 | Bacteria | 3403 |
| 307 | Ga0207664_10189850 | 3300025929 | Unclassified | 1768 |
| 308 | Ga0207664_10450336 | 3300025929 | Bacteria | 1149 |
| 309 | Ga0207690_10016612 | 3300025932 | Bacteria | 4482 |
| 310 | Ga0207706_10018524 | 3300025933 | Bacteria | 6264 |
| 311 | Ga0207686_10310779 | 3300025934 | Unclassified | 1174 |
| 312 | Ga0207670_10482608 | 3300025936 | Bacteria | 1004 |
| 313 | Ga0207704_10006091 | 3300025938 | Bacteria | 5593 |
| 314 | Ga0207704_10008150 | 3300025938 | Bacteria | 4991 |
| 315 | Ga0207665_10000008 | 3300025939 | Bacteria | 173434 |
| 316 | Ga0207665_10009854 | 3300025939 | Bacteria | 6270 |
| 317 | Ga0207665_10014535 | 3300025939 | Bacteria | 5183 |
| 318 | Ga0207665_10027403 | 3300025939 | Bacteria | 3765 |
| 319 | Ga0207665_10229008 | 3300025939 | Bacteria | 1365 |
| 320 | Ga0207665_10246286 | 3300025939 | Bacteria | 1319 |
| 321 | Ga0207711_10067942 | 3300025941 | Bacteria | 3086 |
| 322 | Ga0207689_10021570 | 3300025942 | Bacteria | 5415 |
| 323 | Ga0207661_10007970 | 3300025944 | Bacteria | 7551 |
| 324 | Ga0207661_10032024 | 3300025944 | Bacteria | 4069 |
| 325 | Ga0207661_10039256 | 3300025944 | Bacteria | 3715 |
| 326 | Ga0207661_10140707 | 3300025944 | Bacteria | 2076 |
| 327 | Ga0207661_10210821 | 3300025944 | Bacteria | 1712 |
| 328 | Ga0207661_10337192 | 3300025944 | Bacteria | 1358 |
| 329 | Ga0207679_10016007 | 3300025945 | Bacteria | 4971 |
| 330 | Ga0207679_10033251 | 3300025945 | Bacteria | 3628 |
| 331 | Ga0207679_10276023 | 3300025945 | Unclassified | 1439 |
| 332 | Ga0207667_10000510 | 3300025949 | Bacteria | 51350 |
| 333 | Ga0207667_10005593 | 3300025949 | Bacteria | 15334 |
| 334 | Ga0207667_10042369 | 3300025949 | Bacteria | 4839 |
| 335 | Ga0207667_10078091 | 3300025949 | Bacteria | 3432 |
| 336 | Ga0207667_10102360 | 3300025949 | Bacteria | 2954 |
| 337 | Ga0207667_10254137 | 3300025949 | Unclassified | 1798 |
| 338 | Ga0207712_10236278 | 3300025961 | Unclassified | 1470 |
| 339 | Ga0207640_10010423 | 3300025981 | Bacteria | 5237 |
| 340 | Ga0207640_10032267 | 3300025981 | Bacteria | 3246 |
| 341 | Ga0207640_10158287 | 3300025981 | Unclassified | 1672 |
| 342 | Ga0207640_10792396 | 3300025981 | Unclassified | 820 |
| 343 | Ga0207677_10008174 | 3300026023 | Bacteria | 5827 |
| 344 | Ga0207677_10015005 | 3300026023 | Bacteria | 4542 |
| 345 | Ga0207677_10018348 | 3300026023 | Bacteria | 4197 |
| 346 | Ga0207677_10653427 | 3300026023 | Unclassified | 928 |
| 347 | Ga0207703_10004076 | 3300026035 | Bacteria | 12054 |
| 348 | Ga0207703_10033477 | 3300026035 | Bacteria | 4074 |
| 349 | Ga0207703_10133260 | 3300026035 | Bacteria | 2148 |
| 350 | Ga0207639_10010442 | 3300026041 | Bacteria | 6433 |
| 351 | Ga0207639_10012526 | 3300026041 | Bacteria | 5909 |
| 352 | Ga0207639_10067193 | 3300026041 | Bacteria | 2789 |
| 353 | Ga0207639_10107039 | 3300026041 | Bacteria | 2271 |
| 354 | Ga0207678_10721985 | 3300026067 | Bacteria | 878 |
| 355 | Ga0207708_10232744 | 3300026075 | Unclassified | 1480 |
| 356 | Ga0207702_10000086 | 3300026078 | Bacteria | 106199 |
| 357 | Ga0207702_10001869 | 3300026078 | Bacteria | 20674 |
| 358 | Ga0207702_10003671 | 3300026078 | Bacteria | 13897 |
| 359 | Ga0207702_10041278 | 3300026078 | Bacteria | 3868 |
| 360 | Ga0207702_10091011 | 3300026078 | Bacteria | 2670 |
| 361 | Ga0207702_10201810 | 3300026078 | Bacteria | 1844 |
| 362 | Ga0207702_10664285 | 3300026078 | Unclassified | 1026 |
| 363 | Ga0207641_10020318 | 3300026088 | Bacteria | 5454 |
| 364 | Ga0207641_10057052 | 3300026088 | Bacteria | 3321 |
| 365 | Ga0207641_10510713 | 3300026088 | Unclassified | 1168 |
| 366 | Ga0207648_10166807 | 3300026089 | Bacteria | 1946 |
| 367 | Ga0207676_10003005 | 3300026095 | Bacteria | 12026 |
| 368 | Ga0207674_10000281 | 3300026116 | Bacteria | 64232 |
| 369 | Ga0207674_10158899 | 3300026116 | Bacteria | 2215 |
| 370 | Ga0207674_10257658 | 3300026116 | Unclassified | 1691 |
| 371 | Ga0207674_10385544 | 3300026116 | Bacteria | 1355 |
| 372 | Ga0207674_10564000 | 3300026116 | Unclassified | 1100 |
| 373 | Ga0207675_100211883 | 3300026118 | Bacteria | 1864 |
| 374 | Ga0207683_10049106 | 3300026121 | Unclassified | 3693 |
| 375 | Ga0207698_10052524 | 3300026142 | Bacteria | 3123 |
| 376 | Ga0207698_10314004 | 3300026142 | Bacteria | 1465 |
| 377 | Ga0207698_10405018 | 3300026142 | Unclassified | 1305 |
| 378 | Ga0207698_10478713 | 3300026142 | Unclassified | 1207 |
| 379 | Ga0209588_1010427 | 3300027671 | Bacteria | 2795 |
| 380 | Ga0209588_1051371 | 3300027671 | Bacteria | 1333 |
| 381 | Ga0209588_1052219 | 3300027671 | Bacteria | 1322 |
| 382 | Ga0209588_1080535 | 3300027671 | Unclassified | 1052 |
| 383 | Ga0209813_10086067 | 3300027866 | Unclassified | 1047 |
| 384 | Ga0207428_10032298 | 3300027907 | Unclassified | 4307 |
| 385 | Ga0268265_10288285 | 3300028380 | Unclassified | 1472 |
| 386 | Ga0268264_10030109 | 3300028381 | Bacteria | 4450 |
| 387 | Ga0268264_10136846 | 3300028381 | Bacteria | 2179 |
| 388 | Ga0265318_10000320 | 3300028577 | Bacteria | 38387 |
| 389 | Ga0265332_10007388 | 3300031238 | Bacteria | 4972 |
| 390 | Ga0265320_10000139 | 3300031240 | Bacteria | 61536 |
| 391 | Ga0265329_10000050 | 3300031242 | Bacteria | 51098 |
| 392 | Ga0265331_10000135 | 3300031250 | Bacteria | 96750 |
| 393 | Ga0265316_10000531 | 3300031344 | Bacteria | 42984 |
| 394 | Ga0265313_10001857 | 3300031595 | Bacteria | 19236 |
| 395 | Ga0265314_10015012 | 3300031711 | Bacteria | 6166 |
| 396 | Ga0265342_10000694 | 3300031712 | Bacteria | 35309 |
| 397 | Ga0307409_100055875 | 3300031995 | Bacteria | 3051 |
| 398 | Ga0316212_1005063 | 3300033547 | Bacteria | 1914 |
| 399 | Ga0373926_0005230 | 3300035083 | Bacteria | 4272 |
| 400 | Ga0373923_0211082 | 3300035111 | Bacteria | 900 |
| 401 | Ga0373936_0013132 | 3300035113 | Bacteria | 3159 |
| 402 | Ga0373936_0023119 | 3300035113 | Bacteria | 2421 |
| 403 | Ga0373945_0007946 | 3300035116 | Bacteria | 3443 |
| 404 | Ga0373945_0008692 | 3300035116 | Unclassified | 3313 |
| 405 | Ga0373945_0033910 | 3300035116 | Bacteria | 1817 |
| 406 | Ga0373953_0164614 | 3300035117 | Unclassified | 954 |
| 407 | Ga0373954_0050930 | 3300035118 | Bacteria | 1944 |
| 408 | Ga0373954_0110738 | 3300035118 | Unclassified | 1328 |
| 409 | Ga0373954_0179814 | 3300035118 | Bacteria | 1037 |
| 410 | Ga0373956_0020266 | 3300035119 | Unclassified | 2828 |
| 411 | Ga0373957_0145265 | 3300035120 | Bacteria | 972 |
| 412 | Ga0373943_0016129 | 3300035170 | Bacteria | 3403 |
| 413 | Ga0373943_0039322 | 3300035170 | Unclassified | 2278 |
| 414 | Ga0373943_0041482 | 3300035170 | Bacteria | 2226 |
| 415 | Ga0373955_0019293 | 3300035172 | Unclassified | 3404 |
| 416 | Ga0373955_0135939 | 3300035172 | Bacteria | 1438 |
| 417 | Ga0373955_0212921 | 3300035172 | Unclassified | 1153 |
| 418 | Ga0373924_0000027 | 3300035410 | Bacteria | 37242 |
| 419 | Ga0373935_0061188 | 3300035692 | Unclassified | 2410 |
| 420 | Ga0373935_0072691 | 3300035692 | Unclassified | 2221 |
| 421 | Ga0373927_0015112 | 3300035695 | Bacteria | 5104 |
| 422 | Ga0373927_0027441 | 3300035695 | Bacteria | 3717 |
| 423 | Ga0373927_0032309 | 3300035695 | Bacteria | 3409 |
| 424 | Ga0373927_0062610 | 3300035695 | Unclassified | 2406 |
| 425 | Ga0373927_0077315 | 3300035695 | Bacteria | 2156 |
| 426 | Ga0373927_0225011 | 3300035695 | Bacteria | 1232 |
| 427 | Ga0373933_0003010 | 3300035724 | Bacteria | 9400 |
| 428 | Ga0373933_0076458 | 3300035724 | Unclassified | 2045 |
| 429 | Ga0373933_0214536 | 3300035724 | Unclassified | 1234 |
| 430 | Ga0373933_0315576 | 3300035724 | Bacteria | 1013 |
| 431 | Ga0373947_0001944 | 3300035725 | Bacteria | 12658 |
| 432 | Ga0373947_0007747 | 3300035725 | Bacteria | 6205 |
| 433 | Ga0373947_0034741 | 3300035725 | Bacteria | 2982 |
| 434 | Ga0373937_0000913 | 3300036401 | Bacteria | 25124 |
| 435 | Ga0373937_0002496 | 3300036401 | Bacteria | 15283 |
| 436 | Ga0373937_0003284 | 3300036401 | Bacteria | 13565 |
| 437 | Ga0373937_0069150 | 3300036401 | Bacteria | 3255 |
| 438 | Ga0373937_0069466 | 3300036401 | Unclassified | 3248 |
| 439 | Ga0373937_0100971 | 3300036401 | Unclassified | 2677 |
| 440 | Ga0373937_0269843 | 3300036401 | Bacteria | 1606 |
| 441 | Ga0373925_0012677 | 3300037068 | Bacteria | 6104 |
| 442 | Ga0373925_0103971 | 3300037068 | Unclassified | 2186 |
| 443 | Ga0373925_0132847 | 3300037068 | Bacteria | 1942 |
| 444 | Ga0373925_0161995 | 3300037068 | Unclassified | 1762 |
| 445 | Ga0373925_0334740 | 3300037068 | Bacteria | 1227 |
| 446 | Ga0395905_0020117 | 3300037471 | Bacteria | 6324 |
| 447 | Ga0395905_0816171 | 3300037471 | Unclassified | 836 |
| 448 | Ga0395901_0605960 | 3300038443 | Bacteria | 1104 |
| 449 | Ga0436365_1734879 | 3300039437 | Bacteria | 1603 |
| 450 | Ga0436363_1554825 | 3300039450 | Unclassified | 2172 |
| 451 | Ga0453683_0005482 | 3300044673 | Bacteria | 8851 |
| 452 | Ga0453683_0178936 | 3300044673 | Unclassified | 1345 |
| 453 | Ga0466966_0371011 | 3300044684 | Bacteria | 860 |
| 454 | Ga0466963_0124933 | 3300044694 | Bacteria | 1773 |
| 455 | Ga0466957_0000326 | 3300044842 | Bacteria | 23157 |
| 456 | Ga0451576_1299712 | 3300045051 | Unclassified | 758 |
| 457 | Ga0466958_0356113 | 3300045836 | Bacteria | 943 |
| 458 | Ga0466967_0075988 | 3300045976 | Unclassified | 3020 |
| 459 | Ga0466967_0121957 | 3300045976 | Bacteria | 2410 |
| 460 | Ga0466967_0176435 | 3300045976 | Bacteria | 2013 |
| 461 | Ga0466967_0408345 | 3300045976 | Bacteria | 1322 |
| 462 | Ga0466967_0840057 | 3300045976 | Bacteria | 912 |
| 463 | Ga0495651_0005517 | 3300046462 | Bacteria | 9649 |
| 464 | Ga0495651_0018012 | 3300046462 | Bacteria | 5469 |
| 465 | Ga0495653_0060360 | 3300046463 | Unclassified | 2873 |
| 466 | Ga0495580_0001178 | 3300046472 | Bacteria | 22989 |
| 467 | Ga0495580_0003229 | 3300046472 | Bacteria | 13950 |
| 468 | Ga0495580_0038359 | 3300046472 | Bacteria | 3431 |
| 469 | Ga0495580_0157698 | 3300046472 | Bacteria | 1571 |
| 470 | Ga0495582_0001662 | 3300046473 | Bacteria | 12544 |
| 471 | Ga0495582_0077950 | 3300046473 | Unclassified | 1838 |
| 472 | Ga0495639_0055016 | 3300046475 | Bacteria | 1814 |
| 473 | Ga0495639_0199785 | 3300046475 | Bacteria | 978 |
| 474 | Ga0495662_0032656 | 3300046476 | Bacteria | 2515 |
| 475 | Ga0495662_0067641 | 3300046476 | Bacteria | 1729 |
| 476 | Ga0495594_0050101 | 3300046499 | Unclassified | 2297 |
| 477 | Ga0495594_0183663 | 3300046499 | Unclassified | 1191 |
| 478 | Ga0495618_0074573 | 3300046514 | Bacteria | 2160 |
| 479 | Ga0495628_0073701 | 3300046516 | Bacteria | 2660 |
| 480 | Ga0495628_0258706 | 3300046516 | Unclassified | 1298 |
| 481 | Ga0495630_0045629 | 3300046517 | Bacteria | 3275 |
| 482 | Ga0495630_0064563 | 3300046517 | Bacteria | 2751 |
| 483 | Ga0495630_0096939 | 3300046517 | Bacteria | 2230 |
| 484 | Ga0495666_0070534 | 3300046526 | Bacteria | 1661 |
| 485 | Ga0495652_0028011 | 3300046529 | Bacteria | 4962 |
| 486 | Ga0495652_0258714 | 3300046529 | Bacteria | 1286 |
| 487 | Ga0495665_0001416 | 3300046531 | Bacteria | 12857 |
| 488 | Ga0495665_0188668 | 3300046531 | Unclassified | 1070 |
| 489 | Ga0495640_0059875 | 3300046533 | Bacteria | 2592 |
| 490 | Ga0495640_0216723 | 3300046533 | Unclassified | 1208 |
| 491 | Ga0495587_0000471 | 3300046536 | Bacteria | 27923 |
| 492 | Ga0495587_0085547 | 3300046536 | Bacteria | 1826 |
| 493 | Ga0495645_0009174 | 3300046543 | Bacteria | 6910 |
| 494 | Ga0495645_0300672 | 3300046543 | Bacteria | 1048 |
| 495 | Ga0495667_0078956 | 3300046559 | Bacteria | 2140 |
| 496 | Ga0495667_0177904 | 3300046559 | Bacteria | 1366 |
| 497 | Ga0495634_0100168 | 3300046642 | Bacteria | 1873 |
| 498 | Ga0495635_0080874 | 3300046663 | Bacteria | 2224 |
| 499 | Ga0495588_0122523 | 3300046674 | Bacteria | 1371 |
| 500 | Ga0495623_0005475 | 3300046679 | Bacteria | 8298 |
| 501 | Ga0495623_0049298 | 3300046679 | Bacteria | 2669 |
| 502 | Ga0495623_0084241 | 3300046679 | Unclassified | 1962 |
| 503 | Ga0495658_0160470 | 3300046683 | Bacteria | 1386 |
| 504 | Ga0495669_0166020 | 3300046684 | Unclassified | 1049 |
| 505 | Ga0495613_0029096 | 3300046689 | Bacteria | 4108 |
| 506 | Ga0495613_0196913 | 3300046689 | Bacteria | 1422 |
| 507 | Ga0495624_0264794 | 3300046690 | Unclassified | 1038 |
| 508 | Ga0495649_0162373 | 3300046694 | Unclassified | 1171 |
| 509 | Ga0495581_0009321 | 3300047315 | Bacteria | 5682 |
| 510 | Ga0495581_0084989 | 3300047315 | Bacteria | 1834 |
| 511 | Ga0495581_0138903 | 3300047315 | Bacteria | 1417 |
| 512 | Ga0495604_0100131 | 3300047317 | Unclassified | 2131 |
| 513 | Ga0495604_0204244 | 3300047317 | Bacteria | 1369 |
| 514 | Ga0495674_0141251 | 3300047319 | Bacteria | 2024 |
| 515 | Ga0495676_0619834 | 3300047321 | Unclassified | 704 |
| 516 | Ga0495680_0058253 | 3300047322 | Unclassified | 2986 |
| 517 | Ga0495675_0000545 | 3300047444 | Bacteria | 24377 |
| 518 | Ga0495684_0112494 | 3300047471 | Bacteria | 2053 |
| 519 | Ga0495684_0495902 | 3300047471 | Unclassified | 841 |
| 520 | Ga0495593_0112582 | 3300047673 | Bacteria | 1389 |
| 521 | Ga0495602_0000402 | 3300048088 | Bacteria | 40515 |
| 522 | Ga0496101_0230521 | 3300048904 | Unclassified | 1439 |
| 523 | Ga0496102_0014302 | 3300048905 | Bacteria | 6896 |
| 524 | Ga0496102_0080944 | 3300048905 | Bacteria | 2993 |
| 525 | Ga0496102_0158952 | 3300048905 | Bacteria | 2125 |
| 526 | Ga0496103_0026387 | 3300048906 | Bacteria | 3517 |
| 527 | Ga0496104_0021552 | 3300048907 | Bacteria | 5918 |
| 528 | Ga0496104_0052681 | 3300048907 | Unclassified | 3844 |
| 529 | Ga0496104_0124674 | 3300048907 | Bacteria | 2473 |
| 530 | Ga0496104_0134223 | 3300048907 | Bacteria | 2378 |
| 531 | Ga0496104_0292496 | 3300048907 | Bacteria | 1541 |
| 532 | Ga0496104_0321215 | 3300048907 | Bacteria | 1461 |
| 533 | Ga0496105_0083338 | 3300048908 | Bacteria | 2641 |
| 534 | Ga0496107_0351693 | 3300048910 | Unclassified | 1097 |
| 535 | Ga0496108_0012878 | 3300048911 | Bacteria | 6814 |
| 536 | Ga0496109_0047397 | 3300048912 | Bacteria | 3907 |
| 537 | Ga0496110_0005089 | 3300048913 | Bacteria | 10269 |
| 538 | Ga0496110_0598999 | 3300048913 | Bacteria | 1000 |
| 539 | Ga0496111_0002091 | 3300048914 | Bacteria | 11909 |
| 540 | Ga0496111_0024930 | 3300048914 | Unclassified | 4218 |
| 541 | Ga0496112_0002140 | 3300048915 | Bacteria | 15679 |
| 542 | Ga0496112_0019958 | 3300048915 | Bacteria | 6342 |
| 543 | Ga0496112_0068436 | 3300048915 | Bacteria | 3506 |
| 544 | Ga0496112_0087773 | 3300048915 | Bacteria | 3078 |
| 545 | Ga0496112_0131067 | 3300048915 | Bacteria | 2478 |
| 546 | Ga0496112_0241543 | 3300048915 | Bacteria | 1759 |
| 547 | Ga0496112_0258915 | 3300048915 | Unclassified | 1689 |
| 548 | Ga0496112_0573145 | 3300048915 | Unclassified | 1062 |
| 549 | Ga0496113_0011053 | 3300048916 | Bacteria | 6002 |
| 550 | Ga0496113_0046287 | 3300048916 | Bacteria | 3229 |
| 551 | Ga0496115_0122343 | 3300048918 | Bacteria | 2142 |
| 552 | Ga0501031_0276076 | 3300049568 | Bacteria | 1091 |
| 553 | Ga0501034_0117211 | 3300049571 | Bacteria | 2650 |
| 554 | Ga0501034_0563574 | 3300049571 | Bacteria | 1048 |
| 555 | Ga0501036_0118475 | 3300049572 | Unclassified | 2236 |
| 556 | Ga0501036_0240634 | 3300049572 | Unclassified | 1518 |
| 557 | Ga0501036_0559067 | 3300049572 | Unclassified | 950 |
| 558 | Ga0501039_0133216 | 3300049575 | Unclassified | 1951 |
| 559 | Ga0501039_0330321 | 3300049575 | Bacteria | 1198 |
| 560 | Ga0501040_0050766 | 3300049576 | Unclassified | 2838 |
| 561 | Ga0501042_0090970 | 3300049578 | Unclassified | 2190 |
| 562 | Ga0501047_0168718 | 3300049581 | Bacteria | 2058 |
| 563 | Ga0501047_0524351 | 3300049581 | Bacteria | 1010 |
| 564 | Ga0501048_0058373 | 3300049582 | Bacteria | 2735 |
| 565 | Ga0501069_0164366 | 3300049585 | Bacteria | 1279 |
| 566 | Ga0501071_0009176 | 3300049587 | Bacteria | 6575 |
| 567 | Ga0501071_0079437 | 3300049587 | Bacteria | 2398 |
| 568 | Ga0501071_0094159 | 3300049587 | Bacteria | 2203 |
| 569 | Ga0501072_0017202 | 3300049588 | Bacteria | 5557 |
| 570 | Ga0501072_0223153 | 3300049588 | Bacteria | 1502 |
| 571 | Ga0501074_0088803 | 3300049590 | Bacteria | 2214 |
| 572 | Ga0501074_0093373 | 3300049590 | Unclassified | 2155 |
| 573 | Ga0501074_0138106 | 3300049590 | Bacteria | 1744 |
| 574 | Ga0501075_0203559 | 3300049591 | Unclassified | 1510 |
| 575 | Ga0501075_0214975 | 3300049591 | Bacteria | 1466 |
| 576 | Ga0501076_0040660 | 3300049592 | Bacteria | 3655 |
| 577 | Ga0501076_0070739 | 3300049592 | Bacteria | 2790 |
| 578 | Ga0501077_0309488 | 3300049593 | Bacteria | 1007 |
| 579 | Ga0501079_0293583 | 3300049741 | Bacteria | 1271 |
| 580 | Ga0501080_0310635 | 3300049742 | Bacteria | 1429 |
| 581 | Ga0501081_0099571 | 3300049743 | Bacteria | 2054 |
| 582 | Ga0501081_0330352 | 3300049743 | Unclassified | 1122 |
| 583 | Ga0501035_0223560 | 3300049822 | Bacteria | 1607 |
| 584 | Ga0501045_0032463 | 3300049824 | Bacteria | 3783 |
| 585 | Ga0501045_0073185 | 3300049824 | Bacteria | 2523 |
| 586 | nmdc:mga03683_543_c1 | 3300050489 | Bacteria | 10809 |
| 587 | nmdc:mga00v17_1254_c1 | 3300050491 | Bacteria | 13290 |
| 588 | nmdc:mga0yw44_232555_c1 | 3300050492 | Bacteria | 1224 |
| 589 | nmdc:mga0k408_42192_c1 | 3300050493 | Bacteria | 2627 |
| 590 | nmdc:mga06z11_40671_c1 | 3300050494 | Bacteria | 2321 |
| 591 | nmdc:mga04h51_29012_c1 | 3300050495 | Bacteria | 1730 |
| 592 | nmdc:mga08y16_166792_c1 | 3300050511 | Unclassified | 2288 |
| 593 | nmdc:mga0n895_108799_c1 | 3300050512 | Bacteria | 2787 |
| 594 | nmdc:mga0n895_222559_c1 | 3300050512 | Bacteria | 1916 |
| 595 | nmdc:mga0n895_389354_c1 | 3300050512 | Bacteria | 1410 |
| 596 | nmdc:mga0rr50_175175_c1 | 3300050513 | Bacteria | 1750 |
| 597 | nmdc:mga0rr50_37620_c1 | 3300050513 | Unclassified | 3495 |
| 598 | nmdc:mga0rr50_57743_c1 | 3300050513 | Unclassified | 2904 |
| 599 | nmdc:mga08x19_146_c1 | 3300050514 | Bacteria | 60222 |
| 600 | nmdc:mga08x19_155550_c1 | 3300050514 | Unclassified | 1550 |
| 601 | nmdc:mga08x19_2567_c1 | 3300050514 | Bacteria | 11042 |
| 602 | nmdc:mga08x19_305111_c1 | 3300050514 | Bacteria | 1106 |
| 603 | nmdc:mga08x19_37383_c1 | 3300050514 | Bacteria | 3081 |
| 604 | nmdc:mga08x19_59450_c1 | 3300050514 | Unclassified | 2474 |
| 605 | nmdc:mga08x19_6583_c1 | 3300050514 | Bacteria | 6885 |
| 606 | nmdc:mga0a205_138805_c1 | 3300050515 | Bacteria | 2331 |
| 607 | Ga0495601_0014885 | 3300053077 | Unclassified | 4696 |
| 608 | Ga0495601_0029313 | 3300053077 | Bacteria | 3413 |
| 609 | Ga0495601_0173339 | 3300053077 | Bacteria | 1410 |
| 610 | Ga0495601_0318224 | 3300053077 | Bacteria | 1013 |
| 611 | Ga0495612_0016409 | 3300053078 | Bacteria | 2968 |
| 612 | Ga0495595_0080569 | 3300053084 | Bacteria | 1550 |
| 613 | Ga0495619_0045210 | 3300053085 | Bacteria | 2893 |
| 614 | Ga0495619_0124625 | 3300053085 | Bacteria | 1768 |
| 615 | Ga0501084_0034145 | 3300054114 | Bacteria | 4253 |
| 616 | Ga0501084_0239851 | 3300054114 | Unclassified | 1530 |
| 617 | Ga0530510_0018757 | 3300061734 | Bacteria | 4907 |
| 618 | Ga0068866_10106183 | |||
| 619 | Ga0058862_11980645 | |||
| 620 | Ga0065715_10023449 | |||
| 621 | Ga0065715_10237222 | |||
| 622 | Ga0065707_10195922 | |||
| 623 | Ga0070683_100028438 | |||
| 624 | Ga0070683_100050549 | |||
| 625 | Ga0070683_100068644 | |||
| 626 | Ga0070683_100151438 | |||
| 627 | Ga0070670_100001056 | |||
| 628 | Ga0070670_100004237 | |||
| 629 | Ga0070670_100281962 | |||
| 630 | Ga0068869_100013816 | |||
| 631 | Ga0070666_10167821 | |||
| 632 | Ga0070680_100081858 | |||
| 633 | Ga0068868_100010310 | |||
| 634 | Ga0068868_100014612 | |||
| 635 | Ga0068868_100025822 | |||
| 636 | Ga0070660_100002598 | |||
| 637 | Ga0070689_100555856 | |||
| 638 | Ga0070687_100221792 | |||
| 639 | Ga0070661_100033197 | |||
| 640 | Ga0070669_100469806 | |||
| 641 | Ga0070675_100017446 | |||
| 642 | Ga0070659_100051605 | |||
| 643 | Ga0070709_10019198 | |||
| 644 | Ga0070709_10057178 | |||
| 645 | Ga0070709_10157631 | |||
| 646 | Ga0070709_10181394 | |||
| 647 | Ga0070714_100006981 | |||
| 648 | Ga0070714_100040722 | |||
| 649 | Ga0070714_100582210 | |||
| 650 | Ga0070713_100003646 | |||
| 651 | Ga0070713_100008055 | |||
| 652 | Ga0070713_100010846 | |||
| 653 | Ga0070713_100073031 | |||
| 654 | Ga0070713_100105822 | |||
| 655 | Ga0070713_100116344 | |||
| 656 | Ga0070713_100244282 | |||
| 657 | Ga0070713_100249149 | |||
| 658 | Ga0070710_10021668 | |||
| 659 | Ga0070710_10161020 | |||
| 660 | Ga0070710_10200389 | |||
| 661 | Ga0070711_100003089 | |||
| 662 | Ga0070705_100018628 | |||
| 663 | Ga0070705_100167005 | |||
| 664 | Ga0070705_100398151 | |||
| 665 | Ga0070708_100035530 | |||
| 666 | Ga0070708_100036183 | |||
| 667 | Ga0070708_100056917 | |||
| 668 | Ga0070708_100057686 | |||
| 669 | Ga0070708_100621006 | |||
| 670 | Ga0070663_100273832 | |||
| 671 | Ga0070662_100018342 | |||
| 672 | Ga0070681_10000453 | |||
| 673 | Ga0070681_10023797 | |||
| 674 | Ga0070681_10026795 | |||
| 675 | Ga0070681_10140422 | |||
| 676 | Ga0070681_10209142 | |||
| 677 | Ga0068867_100039000 | |||
| 678 | Ga0068867_100147016 | |||
| 679 | Ga0070685_10140211 | |||
| 680 | Ga0070706_100131844 | |||
| 681 | Ga0070706_100153144 | |||
| 682 | Ga0070707_100084620 | |||
| 683 | Ga0070707_100095684 | |||
| 684 | Ga0070707_100153097 | |||
| 685 | Ga0070698_100006903 | |||
| 686 | Ga0070698_100022863 | |||
| 687 | Ga0070698_100423759 | |||
| 688 | Ga0070699_100178761 | |||
| 689 | Ga0070699_100329441 | |||
| 690 | Ga0070679_100179922 | |||
| 691 | Ga0070684_100088154 | |||
| 692 | Ga0070684_100108052 | |||
| 693 | Ga0070684_100130455 | |||
| 694 | Ga0070697_100000393 | |||
| 695 | Ga0070697_100054087 | |||
| 696 | Ga0070697_100202723 | |||
| 697 | Ga0070697_100504494 | |||
| 698 | Ga0068853_100023219 | |||
| 699 | Ga0068853_100051528 | |||
| 700 | Ga0068853_100106426 | |||
| 701 | Ga0068853_100415838 | |||
| 702 | Ga0070672_100074725 | |||
| 703 | Ga0070693_100026905 | |||
| 704 | Ga0070693_100031033 | |||
| 705 | Ga0068855_100000151 | |||
| 706 | Ga0068855_100003935 | |||
| 707 | Ga0068855_100014636 | |||
| 708 | Ga0068855_100095279 | |||
| 709 | Ga0068855_100102117 | |||
| 710 | Ga0068855_100102899 | |||
| 711 | Ga0068855_100410458 | |||
| 712 | Ga0070664_100002608 | |||
| 713 | Ga0070664_100007042 | |||
| 714 | Ga0070664_100011960 | |||
| 715 | Ga0068857_100000121 | |||
| 716 | Ga0068857_100061371 | |||
| 717 | Ga0068857_100247178 | |||
| 718 | Ga0068857_100530102 | |||
| 719 | Ga0068854_100002645 | |||
| 720 | Ga0068854_100024169 | |||
| 721 | Ga0068854_100061463 | |||
| 722 | Ga0068856_100000119 | |||
| 723 | Ga0068856_100002726 | |||
| 724 | Ga0068856_100006181 | |||
| 725 | Ga0068856_100008546 | |||
| 726 | Ga0068852_100075375 | |||
| 727 | Ga0068852_100181500 | |||
| 728 | Ga0068852_100354113 | |||
| 729 | Ga0068859_100000415 | |||
| 730 | Ga0068859_100239063 | |||
| 731 | Ga0068859_100769449 | |||
| 732 | Ga0068864_100001710 | |||
| 733 | Ga0068864_100049669 | |||
| 734 | Ga0068866_10047218 | |||
| 735 | Ga0068866_10056124 | |||
| 736 | Ga0068861_100209421 | |||
| 737 | Ga0068851_10007273 | |||
| 738 | Ga0068870_10017182 | |||
| 739 | Ga0068863_100005712 | |||
| 740 | Ga0068863_100205159 | |||
| 741 | Ga0068863_100373997 | |||
| 742 | Ga0068863_100533952 | |||
| 743 | Ga0068858_100001496 | |||
| 744 | Ga0068858_100027450 | |||
| 745 | Ga0068858_100119680 | |||
| 746 | Ga0068860_100119307 | |||
| 747 | Ga0068860_100406788 | |||
| 748 | Ga0068860_100812699 | |||
| 749 | Ga0068862_100240502 | |||
| 750 | Ga0068862_100291305 | |||
| 751 | Ga0081540_1041944 | |||
| 752 | Ga0070717_10000966 | |||
| 753 | Ga0070717_10003354 | |||
| 754 | Ga0070717_10056203 | |||
| 755 | Ga0070717_10063383 | |||
| 756 | Ga0070717_10277723 | |||
| 757 | Ga0070717_10388759 | |||
| 758 | Ga0070717_10396772 | |||
| 759 | Ga0070715_10046875 | |||
| 760 | Ga0070715_10219206 | |||
| 761 | Ga0070716_100000450 | |||
| 762 | Ga0070716_100022418 | |||
| 763 | Ga0070716_100262144 | |||
| 764 | Ga0070716_100286484 | |||
| 765 | Ga0070716_100335558 | |||
| 766 | Ga0070712_100007133 | |||
| 767 | Ga0070712_100102972 | |||
| 768 | Ga0070712_100383793 | |||
| 769 | Ga0070712_100916217 | |||
| 770 | Ga0097621_100002852 | |||
| 771 | Ga0097621_100026115 | |||
| 772 | Ga0097621_100041136 | |||
| 773 | Ga0068871_100000258 | |||
| 774 | Ga0068871_100000827 | |||
| 775 | Ga0068871_100007369 | |||
| 776 | Ga0068871_100055239 | |||
| 777 | Ga0068871_100115251 | |||
| 778 | Ga0075433_10110815 | |||
| 779 | Ga0068865_100014950 | |||
| 780 | Ga0068865_100042845 | |||
| 781 | Ga0075436_100000368 | |||
| 782 | Ga0075436_100013403 | |||
| 783 | Ga0075436_100035014 | |||
| 784 | Ga0075436_100072190 | |||
| 785 | Ga0097620_100000415 | |||
| 786 | Ga0097620_100239049 | |||
| 787 | Ga0097620_100769439 | |||
| 788 | Ga0097620_100969814 | |||
| 789 | Ga0075435_100019267 | |||
| 790 | Ga0075435_100222755 | |||
| 791 | Ga0099794_10011930 | |||
| 792 | Ga0099794_10013313 | |||
| 793 | Ga0099794_10022133 | |||
| 794 | Ga0099794_10117037 | |||
| 795 | Ga0099795_10000942 | |||
| 796 | Ga0099795_10007794 | |||
| 797 | Ga0099795_10115805 | |||
| 798 | Ga0099795_10195052 | |||
| 799 | Ga0105240_10004947 | |||
| 800 | Ga0105240_10099613 | |||
| 801 | Ga0105240_10125847 | |||
| 802 | Ga0105240_10248262 | |||
| 803 | Ga0105240_10262209 | |||
| 804 | Ga0105245_10000076 | |||
| 805 | Ga0105245_10088884 | |||
| 806 | Ga0105245_10259569 | |||
| 807 | Ga0105241_10006972 | |||
| 808 | Ga0105241_10017151 | |||
| 809 | Ga0105241_10214708 | |||
| 810 | Ga0105242_10055360 | |||
| 811 | Ga0105242_10083847 | |||
| 812 | Ga0105248_10091968 | |||
| 813 | Ga0105248_10237864 | |||
| 814 | Ga0105248_10394694 | |||
| 815 | Ga0105237_10024941 | |||
| 816 | Ga0105237_10070004 | |||
| 817 | Ga0105237_10140637 | |||
| 818 | Ga0105238_10000439 | |||
| 819 | Ga0105238_10010036 | |||
| 820 | Ga0105238_10141679 | |||
| 821 | Ga0105238_10163862 | |||
| 822 | Ga0105238_10194865 | |||
| 823 | Ga0105249_10038016 | |||
| 824 | Ga0105249_10236657 | |||
| 825 | Ga0099796_10000665 | |||
| 826 | Ga0099796_10056062 | |||
| 827 | Ga0105239_10037520 | |||
| 828 | Ga0105239_10124426 | |||
| 829 | Ga0105239_10451507 | |||
| 830 | Ga0105246_10098841 | |||
| 831 | Ga0157371_10011209 | |||
| 832 | Ga0157370_10161392 | |||
| 833 | Ga0157369_10000108 | |||
| 834 | Ga0157369_10039021 | |||
| 835 | Ga0157369_10076715 | |||
| 836 | Ga0157369_10400361 | |||
| 837 | Ga0157369_10494638 | |||
| 838 | Ga0157369_10960356 | |||
| 839 | Ga0157374_10000329 | |||
| 840 | Ga0157374_10007409 | |||
| 841 | Ga0157374_10011951 | |||
| 842 | Ga0157374_10041783 | |||
| 843 | Ga0157374_10129214 | |||
| 844 | Ga0157374_10239831 | |||
| 845 | Ga0157374_10311698 | |||
| 846 | Ga0157378_10000030 | |||
| 847 | Ga0157378_10000099 | |||
| 848 | Ga0157378_10035329 | |||
| 849 | Ga0157378_10040708 | |||
| 850 | Ga0157378_10059572 | |||
| 851 | Ga0163162_10153325 | |||
| 852 | Ga0157372_10000218 | |||
| 853 | Ga0157372_10002609 | |||
| 854 | Ga0157372_10030123 | |||
| 855 | Ga0157372_10121459 | |||
| 856 | Ga0157372_10708375 | |||
| 857 | Ga0157375_10055276 | |||
| 858 | Ga0163163_10049606 | |||
| 859 | Ga0163163_10069161 | |||
| 860 | Ga0157379_10487628 | |||
| 861 | Ga0157376_10053632 | |||
| 862 | Ga0182006_1055150 | |||
| 863 | Ga0182007_10004292 | |||
| 864 | Ga0182005_1003402 | |||
| 865 | Ga0207656_10076934 | |||
| 866 | Ga0207692_10023505 | |||
| 867 | Ga0207642_10098859 | |||
| 868 | Ga0207647_10012656 | |||
| 869 | Ga0207699_10025114 | |||
| 870 | Ga0207699_10040857 | |||
| 871 | Ga0207699_10303923 | |||
| 872 | Ga0207684_10022916 | |||
| 873 | Ga0207684_10055346 | |||
| 874 | Ga0207654_10039782 | |||
| 875 | Ga0207654_10051486 | |||
| 876 | Ga0207707_10001719 | |||
| 877 | Ga0207707_10008849 | |||
| 878 | Ga0207707_10040029 | |||
| 879 | Ga0207695_10017041 | |||
| 880 | Ga0207695_10093562 | |||
| 881 | Ga0207695_10204479 | |||
| 882 | Ga0207695_10230728 | |||
| 883 | Ga0207671_10218154 | |||
| 884 | Ga0207671_10309795 | |||
| 885 | Ga0207693_10005914 | |||
| 886 | Ga0207693_10010173 | |||
| 887 | Ga0207693_10015624 | |||
| 888 | Ga0207693_10050085 | |||
| 889 | Ga0207693_10120724 | |||
| 890 | Ga0207693_10225816 | |||
| 891 | Ga0207693_10442899 | |||
| 892 | Ga0207663_10000918 | |||
| 893 | Ga0207660_10021396 | |||
| 894 | Ga0207660_10060973 | |||
| 895 | Ga0207657_10006029 | |||
| 896 | Ga0207649_10030027 | |||
| 897 | Ga0207649_10545700 | |||
| 898 | Ga0207652_10099264 | |||
| 899 | Ga0207652_10116369 | |||
| 900 | Ga0207646_10000122 | |||
| 901 | Ga0207646_10002647 | |||
| 902 | Ga0207646_10318050 | |||
| 903 | Ga0207646_10337605 | |||
| 904 | Ga0207681_10005323 | |||
| 905 | Ga0207694_10000866 | |||
| 906 | Ga0207694_10061311 | |||
| 907 | Ga0207694_10177394 | |||
| 908 | Ga0207694_10386558 | |||
| 909 | Ga0207650_10003541 | |||
| 910 | Ga0207650_10012994 | |||
| 911 | Ga0207650_10341578 | |||
| 912 | Ga0207687_10000823 | |||
| 913 | Ga0207687_10043589 | |||
| 914 | Ga0207700_10011050 | |||
| 915 | Ga0207700_10014946 | |||
| 916 | Ga0207700_10075684 | |||
| 917 | Ga0207700_10213618 | |||
| 918 | Ga0207700_10307615 | |||
| 919 | Ga0207700_10400320 | |||
| 920 | Ga0207700_10460678 | |||
| 921 | Ga0207700_10477264 | |||
| 922 | Ga0207664_10003509 | |||
| 923 | Ga0207664_10046629 | |||
| 924 | Ga0207664_10189850 | |||
| 925 | Ga0207664_10450336 | |||
| 926 | Ga0207690_10016612 | |||
| 927 | Ga0207706_10018524 | |||
| 928 | Ga0207686_10310779 | |||
| 929 | Ga0207670_10482608 | |||
| 930 | Ga0207704_10006091 | |||
| 931 | Ga0207704_10008150 | |||
| 932 | Ga0207665_10000008 | |||
| 933 | Ga0207665_10009854 | |||
| 934 | Ga0207665_10014535 | |||
| 935 | Ga0207665_10027403 | |||
| 936 | Ga0207665_10229008 | |||
| 937 | Ga0207665_10246286 | |||
| 938 | Ga0207711_10067942 | |||
| 939 | Ga0207689_10021570 | |||
| 940 | Ga0207661_10007970 | |||
| 941 | Ga0207661_10032024 | |||
| 942 | Ga0207661_10039256 | |||
| 943 | Ga0207661_10140707 | |||
| 944 | Ga0207661_10210821 | |||
| 945 | Ga0207661_10337192 | |||
| 946 | Ga0207679_10016007 | |||
| 947 | Ga0207679_10033251 | |||
| 948 | Ga0207679_10276023 | |||
| 949 | Ga0207667_10000510 | |||
| 950 | Ga0207667_10005593 | |||
| 951 | Ga0207667_10042369 | |||
| 952 | Ga0207667_10078091 | |||
| 953 | Ga0207667_10102360 | |||
| 954 | Ga0207667_10254137 | |||
| 955 | Ga0207712_10236278 | |||
| 956 | Ga0207640_10010423 | |||
| 957 | Ga0207640_10032267 | |||
| 958 | Ga0207640_10158287 | |||
| 959 | Ga0207640_10792396 | |||
| 960 | Ga0207677_10008174 | |||
| 961 | Ga0207677_10015005 | |||
| 962 | Ga0207677_10018348 | |||
| 963 | Ga0207677_10653427 | |||
| 964 | Ga0207703_10004076 | |||
| 965 | Ga0207703_10033477 | |||
| 966 | Ga0207703_10133260 | |||
| 967 | Ga0207639_10010442 | |||
| 968 | Ga0207639_10012526 | |||
| 969 | Ga0207639_10067193 | |||
| 970 | Ga0207639_10107039 | |||
| 971 | Ga0207678_10721985 | |||
| 972 | Ga0207708_10232744 | |||
| 973 | Ga0207702_10000086 | |||
| 974 | Ga0207702_10001869 | |||
| 975 | Ga0207702_10003671 | |||
| 976 | Ga0207702_10041278 | |||
| 977 | Ga0207702_10091011 | |||
| 978 | Ga0207702_10201810 | |||
| 979 | Ga0207702_10664285 | |||
| 980 | Ga0207641_10020318 | |||
| 981 | Ga0207641_10057052 | |||
| 982 | Ga0207641_10510713 | |||
| 983 | Ga0207648_10166807 | |||
| 984 | Ga0207676_10003005 | |||
| 985 | Ga0207674_10000281 | |||
| 986 | Ga0207674_10158899 | |||
| 987 | Ga0207674_10257658 | |||
| 988 | Ga0207674_10385544 | |||
| 989 | Ga0207674_10564000 | |||
| 990 | Ga0207675_100211883 | |||
| 991 | Ga0207683_10049106 | |||
| 992 | Ga0207698_10052524 | |||
| 993 | Ga0207698_10314004 | |||
| 994 | Ga0207698_10405018 | |||
| 995 | Ga0207698_10478713 | |||
| 996 | Ga0209588_1010427 | |||
| 997 | Ga0209588_1051371 | |||
| 998 | Ga0209588_1052219 | |||
| 999 | Ga0209588_1080535 | |||
| 1000 | Ga0209813_10086067 | |||
| 1001 | Ga0207428_10032298 | |||
| 1002 | Ga0268265_10288285 | |||
| 1003 | Ga0268264_10030109 | |||
| 1004 | Ga0268264_10136846 | |||
| 1005 | Ga0265318_10000320 | |||
| 1006 | Ga0265332_10007388 | |||
| 1007 | Ga0265320_10000139 | |||
| 1008 | Ga0265329_10000050 | |||
| 1009 | Ga0265331_10000135 | |||
| 1010 | Ga0265316_10000531 | |||
| 1011 | Ga0265313_10001857 | |||
| 1012 | Ga0265314_10015012 | |||
| 1013 | Ga0265342_10000694 | |||
| 1014 | Ga0307409_100055875 | |||
| 1015 | Ga0316212_1005063 | |||
| 1016 | Ga0373926_0005230 | |||
| 1017 | Ga0373923_0211082 | |||
| 1018 | Ga0373936_0013132 | |||
| 1019 | Ga0373936_0023119 | |||
| 1020 | Ga0373945_0007946 | |||
| 1021 | Ga0373945_0008692 | |||
| 1022 | Ga0373945_0033910 | |||
| 1023 | Ga0373953_0164614 | |||
| 1024 | Ga0373954_0050930 | |||
| 1025 | Ga0373954_0110738 | |||
| 1026 | Ga0373954_0179814 | |||
| 1027 | Ga0373956_0020266 | |||
| 1028 | Ga0373957_0145265 | |||
| 1029 | Ga0373943_0016129 | |||
| 1030 | Ga0373943_0039322 | |||
| 1031 | Ga0373943_0041482 | |||
| 1032 | Ga0373955_0019293 | |||
| 1033 | Ga0373955_0135939 | |||
| 1034 | Ga0373955_0212921 | |||
| 1035 | Ga0373924_0000027 | |||
| 1036 | Ga0373935_0061188 | |||
| 1037 | Ga0373935_0072691 | |||
| 1038 | Ga0373927_0015112 | |||
| 1039 | Ga0373927_0027441 | |||
| 1040 | Ga0373927_0032309 | |||
| 1041 | Ga0373927_0062610 | |||
| 1042 | Ga0373927_0077315 | |||
| 1043 | Ga0373927_0225011 | |||
| 1044 | Ga0373933_0003010 | |||
| 1045 | Ga0373933_0076458 | |||
| 1046 | Ga0373933_0214536 | |||
| 1047 | Ga0373933_0315576 | |||
| 1048 | Ga0373947_0001944 | |||
| 1049 | Ga0373947_0007747 | |||
| 1050 | Ga0373947_0034741 | |||
| 1051 | Ga0373937_0000913 | |||
| 1052 | Ga0373937_0002496 | |||
| 1053 | Ga0373937_0003284 | |||
| 1054 | Ga0373937_0069150 | |||
| 1055 | Ga0373937_0069466 | |||
| 1056 | Ga0373937_0100971 | |||
| 1057 | Ga0373937_0269843 | |||
| 1058 | Ga0373925_0012677 | |||
| 1059 | Ga0373925_0103971 | |||
| 1060 | Ga0373925_0132847 | |||
| 1061 | Ga0373925_0161995 | |||
| 1062 | Ga0373925_0334740 | |||
| 1063 | Ga0395905_0020117 | |||
| 1064 | Ga0395905_0816171 | |||
| 1065 | Ga0395901_0605960 | |||
| 1066 | Ga0436365_1734879 | |||
| 1067 | Ga0436363_1554825 | |||
| 1068 | Ga0453683_0005482 | |||
| 1069 | Ga0453683_0178936 | |||
| 1070 | Ga0466966_0371011 | |||
| 1071 | Ga0466963_0124933 | |||
| 1072 | Ga0466957_0000326 | |||
| 1073 | Ga0451576_1299712 | |||
| 1074 | Ga0466958_0356113 | |||
| 1075 | Ga0466967_0075988 | |||
| 1076 | Ga0466967_0121957 | |||
| 1077 | Ga0466967_0176435 | |||
| 1078 | Ga0466967_0408345 | |||
| 1079 | Ga0466967_0840057 | |||
| 1080 | Ga0495651_0005517 | |||
| 1081 | Ga0495651_0018012 | |||
| 1082 | Ga0495653_0060360 | |||
| 1083 | Ga0495580_0001178 | |||
| 1084 | Ga0495580_0003229 | |||
| 1085 | Ga0495580_0038359 | |||
| 1086 | Ga0495580_0157698 | |||
| 1087 | Ga0495582_0001662 | |||
| 1088 | Ga0495582_0077950 | |||
| 1089 | Ga0495639_0055016 | |||
| 1090 | Ga0495639_0199785 | |||
| 1091 | Ga0495662_0032656 | |||
| 1092 | Ga0495662_0067641 | |||
| 1093 | Ga0495594_0050101 | |||
| 1094 | Ga0495594_0183663 | |||
| 1095 | Ga0495618_0074573 | |||
| 1096 | Ga0495628_0073701 | |||
| 1097 | Ga0495628_0258706 | |||
| 1098 | Ga0495630_0045629 | |||
| 1099 | Ga0495630_0064563 | |||
| 1100 | Ga0495630_0096939 | |||
| 1101 | Ga0495666_0070534 | |||
| 1102 | Ga0495652_0028011 | |||
| 1103 | Ga0495652_0258714 | |||
| 1104 | Ga0495665_0001416 | |||
| 1105 | Ga0495665_0188668 | |||
| 1106 | Ga0495640_0059875 | |||
| 1107 | Ga0495640_0216723 | |||
| 1108 | Ga0495587_0000471 | |||
| 1109 | Ga0495587_0085547 | |||
| 1110 | Ga0495645_0009174 | |||
| 1111 | Ga0495645_0300672 | |||
| 1112 | Ga0495667_0078956 | |||
| 1113 | Ga0495667_0177904 | |||
| 1114 | Ga0495634_0100168 | |||
| 1115 | Ga0495635_0080874 | |||
| 1116 | Ga0495588_0122523 | |||
| 1117 | Ga0495623_0005475 | |||
| 1118 | Ga0495623_0049298 | |||
| 1119 | Ga0495623_0084241 | |||
| 1120 | Ga0495658_0160470 | |||
| 1121 | Ga0495669_0166020 | |||
| 1122 | Ga0495613_0029096 | |||
| 1123 | Ga0495613_0196913 | |||
| 1124 | Ga0495624_0264794 | |||
| 1125 | Ga0495649_0162373 | |||
| 1126 | Ga0495581_0009321 | |||
| 1127 | Ga0495581_0084989 | |||
| 1128 | Ga0495581_0138903 | |||
| 1129 | Ga0495604_0100131 | |||
| 1130 | Ga0495604_0204244 | |||
| 1131 | Ga0495674_0141251 | |||
| 1132 | Ga0495676_0619834 | |||
| 1133 | Ga0495680_0058253 | |||
| 1134 | Ga0495675_0000545 | |||
| 1135 | Ga0495684_0112494 | |||
| 1136 | Ga0495684_0495902 | |||
| 1137 | Ga0495593_0112582 | |||
| 1138 | Ga0495602_0000402 | |||
| 1139 | Ga0496101_0230521 | |||
| 1140 | Ga0496102_0014302 | |||
| 1141 | Ga0496102_0080944 | |||
| 1142 | Ga0496102_0158952 | |||
| 1143 | Ga0496103_0026387 | |||
| 1144 | Ga0496104_0021552 | |||
| 1145 | Ga0496104_0052681 | |||
| 1146 | Ga0496104_0124674 | |||
| 1147 | Ga0496104_0134223 | |||
| 1148 | Ga0496104_0292496 | |||
| 1149 | Ga0496104_0321215 | |||
| 1150 | Ga0496105_0083338 | |||
| 1151 | Ga0496107_0351693 | |||
| 1152 | Ga0496108_0012878 | |||
| 1153 | Ga0496109_0047397 | |||
| 1154 | Ga0496110_0005089 | |||
| 1155 | Ga0496110_0598999 | |||
| 1156 | Ga0496111_0002091 | |||
| 1157 | Ga0496111_0024930 | |||
| 1158 | Ga0496112_0002140 | |||
| 1159 | Ga0496112_0019958 | |||
| 1160 | Ga0496112_0068436 | |||
| 1161 | Ga0496112_0087773 | |||
| 1162 | Ga0496112_0131067 | |||
| 1163 | Ga0496112_0241543 | |||
| 1164 | Ga0496112_0258915 | |||
| 1165 | Ga0496112_0573145 | |||
| 1166 | Ga0496113_0011053 | |||
| 1167 | Ga0496113_0046287 | |||
| 1168 | Ga0496115_0122343 | |||
| 1169 | Ga0501031_0276076 | |||
| 1170 | Ga0501034_0117211 | |||
| 1171 | Ga0501034_0563574 | |||
| 1172 | Ga0501036_0118475 | |||
| 1173 | Ga0501036_0240634 | |||
| 1174 | Ga0501036_0559067 | |||
| 1175 | Ga0501039_0133216 | |||
| 1176 | Ga0501039_0330321 | |||
| 1177 | Ga0501040_0050766 | |||
| 1178 | Ga0501042_0090970 | |||
| 1179 | Ga0501047_0168718 | |||
| 1180 | Ga0501047_0524351 | |||
| 1181 | Ga0501048_0058373 | |||
| 1182 | Ga0501069_0164366 | |||
| 1183 | Ga0501071_0009176 | |||
| 1184 | Ga0501071_0079437 | |||
| 1185 | Ga0501071_0094159 | |||
| 1186 | Ga0501072_0017202 | |||
| 1187 | Ga0501072_0223153 | |||
| 1188 | Ga0501074_0088803 | |||
| 1189 | Ga0501074_0093373 | |||
| 1190 | Ga0501074_0138106 | |||
| 1191 | Ga0501075_0203559 | |||
| 1192 | Ga0501075_0214975 | |||
| 1193 | Ga0501076_0040660 | |||
| 1194 | Ga0501076_0070739 | |||
| 1195 | Ga0501077_0309488 | |||
| 1196 | Ga0501079_0293583 | |||
| 1197 | Ga0501080_0310635 | |||
| 1198 | Ga0501081_0099571 | |||
| 1199 | Ga0501081_0330352 | |||
| 1200 | Ga0501035_0223560 | |||
| 1201 | Ga0501045_0032463 | |||
| 1202 | Ga0501045_0073185 | |||
| 1203 | nmdc:mga03683_543_c1 | |||
| 1204 | nmdc:mga00v17_1254_c1 | |||
| 1205 | nmdc:mga0yw44_232555_c1 | |||
| 1206 | nmdc:mga0k408_42192_c1 | |||
| 1207 | nmdc:mga06z11_40671_c1 | |||
| 1208 | nmdc:mga04h51_29012_c1 | |||
| 1209 | nmdc:mga08y16_166792_c1 | |||
| 1210 | nmdc:mga0n895_108799_c1 | |||
| 1211 | nmdc:mga0n895_222559_c1 | |||
| 1212 | nmdc:mga0n895_389354_c1 | |||
| 1213 | nmdc:mga0rr50_175175_c1 | |||
| 1214 | nmdc:mga0rr50_37620_c1 | |||
| 1215 | nmdc:mga0rr50_57743_c1 | |||
| 1216 | nmdc:mga08x19_146_c1 | |||
| 1217 | nmdc:mga08x19_155550_c1 | |||
| 1218 | nmdc:mga08x19_2567_c1 | |||
| 1219 | nmdc:mga08x19_305111_c1 | |||
| 1220 | nmdc:mga08x19_37383_c1 | |||
| 1221 | nmdc:mga08x19_59450_c1 | |||
| 1222 | nmdc:mga08x19_6583_c1 | |||
| 1223 | nmdc:mga0a205_138805_c1 | |||
| 1224 | Ga0495601_0014885 | |||
| 1225 | Ga0495601_0029313 | |||
| 1226 | Ga0495601_0173339 | |||
| 1227 | Ga0495601_0318224 | |||
| 1228 | Ga0495612_0016409 | |||
| 1229 | Ga0495595_0080569 | |||
| 1230 | Ga0495619_0045210 | |||
| 1231 | Ga0495619_0124625 | |||
| 1232 | Ga0501084_0034145 | |||
| 1233 | Ga0501084_0239851 | |||
| 1234 | Ga0530510_0018757 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rfq-assembly1.cif.gz_A | structure of bacterial sylf domain containing protein, beta cell expansion factor a (befa) | 0.7212 | 50 | 185 |
| 7q1v-assembly1.cif.gz_D | arches protomer (trimer of trwg/virb8peri) structure from the fully-assembled r388 type iv secretion system determined by cryo-em. | 0.6197 | 55 | 100 |
| 6aa7-assembly1.cif.gz_A | fluorescent protein from acropora digitifera | 0.6192 | 53 | 121 |
| 4dkn-assembly1.cif.gz_A | crystal structure of amphioxus green fluorescent protein, gfpa1 | 0.5849 | 54 | 119 |
| 2ddd-assembly1.cif.gz_A | unique behavior of a histidine responsible for an engineered green-to-red photoconversion process | 0.5486 | 53 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xaeB00 | Mainly Beta;Beta Barrel;Green Fluorescent Protein;Green fluorescent protein | 0.4755 | 53 | 127 | 2.40.155.10 |
| af_P54036_1_116_2.40.50.1000 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.4718 | 57 | 122 | 2.40.50.1000 |
| af_Q25811_2_74_2.40.50.1000 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.4644 | 57 | 119 | 2.40.50.1000 |
| 6neqQ00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.4578 | 57 | 120 | 2.40.50.140 |
| 5y01A00 | Mainly Beta;Beta Barrel;Green Fluorescent Protein;Green fluorescent protein | 0.454 | 55 | 127 | 2.40.155.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2RBR5-F1-model_v4 | Ysc84 actin-binding domain-containing protein | 0.8621 | 22 | 231 |
GO:0035091
|
| AF-Q1INT5-F1-model_v4 | Ysc84 actin-binding domain-containing protein | 0.8576 | 19 | 229 |
GO:0035091
|
| AF-A0A2V9BQ86-F1-model_v4 | Ysc84 actin-binding domain-containing protein | 0.8575 | 18 | 229 |
GO:0035091
|
| AF-A0A523I5E4-F1-model_v4 | Ysc84 actin-binding domain-containing protein | 0.8572 | 17 | 227 |
GO:0035091
|
| AF-A0A2V9LYD1-F1-model_v4 | Ysc84 actin-binding domain-containing protein | 0.8565 | 18 | 234 |
GO:0035091
|