F469622

General Info

Members Datasets Scaffolds Average Seq Length
617 271 1234 237

Family's Representative Sequence

Representative Sequence 3300005718|Ga0068866_10106183|Ga0068866_101061832
Length 278
Sequence MIASGAAEIVTLPSPFRAHVGKLQGLKLYLKERRTMKKIFSFTVVALLLCTGAQAQQHEADRLRHAGEVLMEILNIPDNIPKSVLDKSECVIVIPSVKKLAVGIGANYGRGAMTCRGGQSFTGPWGPPAMVALEGGNIGFQLGGQATDFVLLVVNPKGIDSILKSKVKLGADAAAAAGPKGRDAQAATDVLMHAEILTYSRSRGLFAGISLDGSTLRPDNSATEKVYGRKVSARDVVIGHKVGTPKAGQLLVSALQKASPRNLSDPKSLHEAGAEEKK

Samples

Sample ID Description Type Environment
1 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 4.86
Rhizosphere 93.52
Stem 0
Stem Tuber 0
Unclassified 24.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068866_10106183 3300005718 Unclassified 1558
2 Ga0058862_11980645 3300004803 Unclassified 854
3 Ga0065715_10023449 3300005293 Bacteria 2079
4 Ga0065715_10237222 3300005293 Bacteria 1158
5 Ga0065707_10195922 3300005295 Unclassified 1335
6 Ga0070683_100028438 3300005329 Bacteria 5052
7 Ga0070683_100050549 3300005329 Bacteria 3849
8 Ga0070683_100068644 3300005329 Bacteria 3303
9 Ga0070683_100151438 3300005329 Bacteria 2199
10 Ga0070670_100001056 3300005331 Bacteria 21882
11 Ga0070670_100004237 3300005331 Bacteria 12004
12 Ga0070670_100281962 3300005331 Bacteria 1451
13 Ga0068869_100013816 3300005334 Bacteria 5381
14 Ga0070666_10167821 3300005335 Bacteria 1536
15 Ga0070680_100081858 3300005336 Bacteria 2664
16 Ga0068868_100010310 3300005338 Bacteria 6760
17 Ga0068868_100014612 3300005338 Bacteria 5791
18 Ga0068868_100025822 3300005338 Bacteria 4472
19 Ga0070660_100002598 3300005339 Bacteria 12395
20 Ga0070689_100555856 3300005340 Bacteria 989
21 Ga0070687_100221792 3300005343 Bacteria 1158
22 Ga0070661_100033197 3300005344 Bacteria 3738
23 Ga0070669_100469806 3300005353 Unclassified 1039
24 Ga0070675_100017446 3300005354 Bacteria 5704
25 Ga0070659_100051605 3300005366 Bacteria 3234
26 Ga0070709_10019198 3300005434 Bacteria 3947
27 Ga0070709_10057178 3300005434 Unclassified 2469
28 Ga0070709_10157631 3300005434 Bacteria 1575
29 Ga0070709_10181394 3300005434 Bacteria 1478
30 Ga0070714_100006981 3300005435 Bacteria 8755
31 Ga0070714_100040722 3300005435 Bacteria 3917
32 Ga0070714_100582210 3300005435 Bacteria 1073
33 Ga0070713_100003646 3300005436 Bacteria 10190
34 Ga0070713_100008055 3300005436 Bacteria 7446
35 Ga0070713_100010846 3300005436 Bacteria 6604
36 Ga0070713_100073031 3300005436 Unclassified 2903
37 Ga0070713_100105822 3300005436 Unclassified 2445
38 Ga0070713_100116344 3300005436 Bacteria 2338
39 Ga0070713_100244282 3300005436 Unclassified 1636
40 Ga0070713_100249149 3300005436 Bacteria 1620
41 Ga0070710_10021668 3300005437 Unclassified 3353
42 Ga0070710_10161020 3300005437 Unclassified 1392
43 Ga0070710_10200389 3300005437 Unclassified 1260
44 Ga0070711_100003089 3300005439 Bacteria 9625
45 Ga0070705_100018628 3300005440 Bacteria 3642
46 Ga0070705_100167005 3300005440 Bacteria 1477
47 Ga0070705_100398151 3300005440 Bacteria 1019
48 Ga0070708_100035530 3300005445 Bacteria 4341
49 Ga0070708_100036183 3300005445 Bacteria 4305
50 Ga0070708_100056917 3300005445 Unclassified 3479
51 Ga0070708_100057686 3300005445 Bacteria 3457
52 Ga0070708_100621006 3300005445 Bacteria 1019
53 Ga0070663_100273832 3300005455 Unclassified 1343
54 Ga0070662_100018342 3300005457 Bacteria 4733
55 Ga0070681_10000453 3300005458 Bacteria 33564
56 Ga0070681_10023797 3300005458 Bacteria 6166
57 Ga0070681_10026795 3300005458 Bacteria 5795
58 Ga0070681_10140422 3300005458 Bacteria 2346
59 Ga0070681_10209142 3300005458 Bacteria 1867
60 Ga0068867_100039000 3300005459 Bacteria 3461
61 Ga0068867_100147016 3300005459 Unclassified 1848
62 Ga0070685_10140211 3300005466 Unclassified 1521
63 Ga0070706_100131844 3300005467 Bacteria 2332
64 Ga0070706_100153144 3300005467 Unclassified 2152
65 Ga0070707_100084620 3300005468 Bacteria 3065
66 Ga0070707_100095684 3300005468 Unclassified 2876
67 Ga0070707_100153097 3300005468 Bacteria 2245
68 Ga0070698_100006903 3300005471 Bacteria 12304
69 Ga0070698_100022863 3300005471 Bacteria 6537
70 Ga0070698_100423759 3300005471 Bacteria 1265
71 Ga0070699_100178761 3300005518 Unclassified 1882
72 Ga0070699_100329441 3300005518 Bacteria 1373
73 Ga0070679_100179922 3300005530 Bacteria 2087
74 Ga0070684_100088154 3300005535 Bacteria 2756
75 Ga0070684_100108052 3300005535 Bacteria 2492
76 Ga0070684_100130455 3300005535 Bacteria 2267
77 Ga0070697_100000393 3300005536 Bacteria 33883
78 Ga0070697_100054087 3300005536 Bacteria 3263
79 Ga0070697_100202723 3300005536 Unclassified 1686
80 Ga0070697_100504494 3300005536 Bacteria 1058
81 Ga0068853_100023219 3300005539 Bacteria 5189
82 Ga0068853_100051528 3300005539 Bacteria 3543
83 Ga0068853_100106426 3300005539 Bacteria 2486
84 Ga0068853_100415838 3300005539 Unclassified 1260
85 Ga0070672_100074725 3300005543 Unclassified 2704
86 Ga0070693_100026905 3300005547 Bacteria 3109
87 Ga0070693_100031033 3300005547 Bacteria 2926
88 Ga0068855_100000151 3300005563 Bacteria 88133
89 Ga0068855_100003935 3300005563 Bacteria 18132
90 Ga0068855_100014636 3300005563 Bacteria 9447
91 Ga0068855_100095279 3300005563 Bacteria 3431
92 Ga0068855_100102117 3300005563 Bacteria 3301
93 Ga0068855_100102899 3300005563 Bacteria 3287
94 Ga0068855_100410458 3300005563 Bacteria 1483
95 Ga0070664_100002608 3300005564 Bacteria 14545
96 Ga0070664_100007042 3300005564 Bacteria 9073
97 Ga0070664_100011960 3300005564 Bacteria 7047
98 Ga0068857_100000121 3300005577 Bacteria 46931
99 Ga0068857_100061371 3300005577 Bacteria 3340
100 Ga0068857_100247178 3300005577 Unclassified 1634
101 Ga0068857_100530102 3300005577 Unclassified 1108
102 Ga0068854_100002645 3300005578 Bacteria 11101
103 Ga0068854_100024169 3300005578 Bacteria 4158
104 Ga0068854_100061463 3300005578 Unclassified 2721
105 Ga0068856_100000119 3300005614 Bacteria 78324
106 Ga0068856_100002726 3300005614 Bacteria 18084
107 Ga0068856_100006181 3300005614 Bacteria 11751
108 Ga0068856_100008546 3300005614 Bacteria 9951
109 Ga0068852_100075375 3300005616 Bacteria 2976
110 Ga0068852_100181500 3300005616 Bacteria 1979
111 Ga0068852_100354113 3300005616 Bacteria 1434
112 Ga0068859_100000415 3300005617 Bacteria 42515
113 Ga0068859_100239063 3300005617 Unclassified 1905
114 Ga0068859_100769449 3300005617 Unclassified 1051
115 Ga0068864_100001710 3300005618 Bacteria 18028
116 Ga0068864_100049669 3300005618 Bacteria 3609
117 Ga0068866_10047218 3300005718 Bacteria 2170
118 Ga0068866_10056124 3300005718 Bacteria 2025
119 Ga0068861_100209421 3300005719 Bacteria 1641
120 Ga0068851_10007273 3300005834 Bacteria 5077
121 Ga0068870_10017182 3300005840 Bacteria 3472
122 Ga0068863_100005712 3300005841 Bacteria 12213
123 Ga0068863_100205159 3300005841 Bacteria 1897
124 Ga0068863_100373997 3300005841 Bacteria 1391
125 Ga0068863_100533952 3300005841 Unclassified 1157
126 Ga0068858_100001496 3300005842 Bacteria 24110
127 Ga0068858_100027450 3300005842 Bacteria 5289
128 Ga0068858_100119680 3300005842 Bacteria 2462
129 Ga0068860_100119307 3300005843 Bacteria 2525
130 Ga0068860_100406788 3300005843 Unclassified 1347
131 Ga0068860_100812699 3300005843 Unclassified 948
132 Ga0068862_100240502 3300005844 Unclassified 1646
133 Ga0068862_100291305 3300005844 Unclassified 1499
134 Ga0081540_1041944 3300005983 Bacteria 2366
135 Ga0070717_10000966 3300006028 Bacteria 19192
136 Ga0070717_10003354 3300006028 Bacteria 11437
137 Ga0070717_10056203 3300006028 Bacteria 3251
138 Ga0070717_10063383 3300006028 Bacteria 3068
139 Ga0070717_10277723 3300006028 Bacteria 1485
140 Ga0070717_10388759 3300006028 Bacteria 1252
141 Ga0070717_10396772 3300006028 Unclassified 1239
142 Ga0070715_10046875 3300006163 Bacteria 1840
143 Ga0070715_10219206 3300006163 Unclassified 977
144 Ga0070716_100000450 3300006173 Bacteria 17008
145 Ga0070716_100022418 3300006173 Unclassified 3337
146 Ga0070716_100262144 3300006173 Bacteria 1183
147 Ga0070716_100286484 3300006173 Unclassified 1139
148 Ga0070716_100335558 3300006173 Unclassified 1064
149 Ga0070712_100007133 3300006175 Bacteria 6972
150 Ga0070712_100102972 3300006175 Bacteria 2116
151 Ga0070712_100383793 3300006175 Unclassified 1157
152 Ga0070712_100916217 3300006175 Unclassified 756
153 Ga0097621_100002852 3300006237 Bacteria 11866
154 Ga0097621_100026115 3300006237 Bacteria 4578
155 Ga0097621_100041136 3300006237 Bacteria 3719
156 Ga0068871_100000258 3300006358 Bacteria 36543
157 Ga0068871_100000827 3300006358 Bacteria 20732
158 Ga0068871_100007369 3300006358 Bacteria 7852
159 Ga0068871_100055239 3300006358 Bacteria 3224
160 Ga0068871_100115251 3300006358 Bacteria 2265
161 Ga0075433_10110815 3300006852 Bacteria 2435
162 Ga0068865_100014950 3300006881 Bacteria 4943
163 Ga0068865_100042845 3300006881 Bacteria 3089
164 Ga0075436_100000368 3300006914 Bacteria 28841
165 Ga0075436_100013403 3300006914 Bacteria 5613
166 Ga0075436_100035014 3300006914 Bacteria 3463
167 Ga0075436_100072190 3300006914 Unclassified 2388
168 Ga0097620_100000415 3300006931 Bacteria 42515
169 Ga0097620_100239049 3300006931 Unclassified 1905
170 Ga0097620_100769439 3300006931 Unclassified 1051
171 Ga0097620_100969814 3300006931 Unclassified 933
172 Ga0075435_100019267 3300007076 Bacteria 5207
173 Ga0075435_100222755 3300007076 Unclassified 1602
174 Ga0099794_10011930 3300007265 Bacteria 3735
175 Ga0099794_10013313 3300007265 Unclassified 3577
176 Ga0099794_10022133 3300007265 Bacteria 2896
177 Ga0099794_10117037 3300007265 Bacteria 1338
178 Ga0099795_10000942 3300007788 Bacteria 5904
179 Ga0099795_10007794 3300007788 Unclassified 3015
180 Ga0099795_10115805 3300007788 Bacteria 1067
181 Ga0099795_10195052 3300007788 Unclassified 852
182 Ga0105240_10004947 3300009093 Bacteria 20033
183 Ga0105240_10099613 3300009093 Bacteria 3537
184 Ga0105240_10125847 3300009093 Bacteria 3080
185 Ga0105240_10248262 3300009093 Bacteria 2060
186 Ga0105240_10262209 3300009093 Bacteria 1993
187 Ga0105245_10000076 3300009098 Bacteria 102308
188 Ga0105245_10088884 3300009098 Bacteria 2839
189 Ga0105245_10259569 3300009098 Bacteria 1690
190 Ga0105241_10006972 3300009174 Bacteria 8313
191 Ga0105241_10017151 3300009174 Bacteria 5319
192 Ga0105241_10214708 3300009174 Unclassified 1614
193 Ga0105242_10055360 3300009176 Bacteria 3245
194 Ga0105242_10083847 3300009176 Bacteria 2670
195 Ga0105248_10091968 3300009177 Bacteria 3416
196 Ga0105248_10237864 3300009177 Bacteria 2050
197 Ga0105248_10394694 3300009177 Bacteria 1558
198 Ga0105237_10024941 3300009545 Bacteria 6117
199 Ga0105237_10070004 3300009545 Unclassified 3504
200 Ga0105237_10140637 3300009545 Bacteria 2408
201 Ga0105238_10000439 3300009551 Bacteria 43837
202 Ga0105238_10010036 3300009551 Bacteria 9497
203 Ga0105238_10141679 3300009551 Bacteria 2381
204 Ga0105238_10163862 3300009551 Unclassified 2199
205 Ga0105238_10194865 3300009551 Unclassified 2002
206 Ga0105249_10038016 3300009553 Bacteria 4367
207 Ga0105249_10236657 3300009553 Unclassified 1803
208 Ga0099796_10000665 3300010159 Bacteria 6015
209 Ga0099796_10056062 3300010159 Bacteria 1382
210 Ga0105239_10037520 3300010375 Bacteria 5310
211 Ga0105239_10124426 3300010375 Bacteria 2865
212 Ga0105239_10451507 3300010375 Bacteria 1458
213 Ga0105246_10098841 3300011119 Bacteria 2121
214 Ga0157371_10011209 3300013102 Bacteria 6928
215 Ga0157370_10161392 3300013104 Bacteria 2085
216 Ga0157369_10000108 3300013105 Bacteria 117027
217 Ga0157369_10039021 3300013105 Bacteria 5191
218 Ga0157369_10076715 3300013105 Bacteria 3583
219 Ga0157369_10400361 3300013105 Unclassified 1424
220 Ga0157369_10494638 3300013105 Unclassified 1265
221 Ga0157369_10960356 3300013105 Bacteria 876
222 Ga0157374_10000329 3300013296 Bacteria 43687
223 Ga0157374_10007409 3300013296 Bacteria 9359
224 Ga0157374_10011951 3300013296 Bacteria 7537
225 Ga0157374_10041783 3300013296 Bacteria 4227
226 Ga0157374_10129214 3300013296 Bacteria 2444
227 Ga0157374_10239831 3300013296 Unclassified 1783
228 Ga0157374_10311698 3300013296 Unclassified 1558
229 Ga0157378_10000030 3300013297 Bacteria 124811
230 Ga0157378_10000099 3300013297 Bacteria 81561
231 Ga0157378_10035329 3300013297 Bacteria 4420
232 Ga0157378_10040708 3300013297 Bacteria 4121
233 Ga0157378_10059572 3300013297 Bacteria 3407
234 Ga0163162_10153325 3300013306 Bacteria 2423
235 Ga0157372_10000218 3300013307 Bacteria 63626
236 Ga0157372_10002609 3300013307 Bacteria 19494
237 Ga0157372_10030123 3300013307 Bacteria 5933
238 Ga0157372_10121459 3300013307 Unclassified 3001
239 Ga0157372_10708375 3300013307 Bacteria 1171
240 Ga0157375_10055276 3300013308 Bacteria 3914
241 Ga0163163_10049606 3300014325 Bacteria 4132
242 Ga0163163_10069161 3300014325 Bacteria 3515
243 Ga0157379_10487628 3300014968 Bacteria 1141
244 Ga0157376_10053632 3300014969 Bacteria 3358
245 Ga0182006_1055150 3300015261 Unclassified 1518
246 Ga0182007_10004292 3300015262 Bacteria 6495
247 Ga0182005_1003402 3300015265 Bacteria 5412
248 Ga0207656_10076934 3300025321 Unclassified 1493
249 Ga0207692_10023505 3300025898 Unclassified 2852
250 Ga0207642_10098859 3300025899 Bacteria 1460
251 Ga0207647_10012656 3300025904 Bacteria 5865
252 Ga0207699_10025114 3300025906 Unclassified 3268
253 Ga0207699_10040857 3300025906 Bacteria 2675
254 Ga0207699_10303923 3300025906 Bacteria 1115
255 Ga0207684_10022916 3300025910 Bacteria 5332
256 Ga0207684_10055346 3300025910 Bacteria 3366
257 Ga0207654_10039782 3300025911 Bacteria 2647
258 Ga0207654_10051486 3300025911 Unclassified 2370
259 Ga0207707_10001719 3300025912 Bacteria 20144
260 Ga0207707_10008849 3300025912 Bacteria 8745
261 Ga0207707_10040029 3300025912 Bacteria 4095
262 Ga0207695_10017041 3300025913 Bacteria 8473
263 Ga0207695_10093562 3300025913 Bacteria 3015
264 Ga0207695_10204479 3300025913 Unclassified 1888
265 Ga0207695_10230728 3300025913 Bacteria 1756
266 Ga0207671_10218154 3300025914 Unclassified 1494
267 Ga0207671_10309795 3300025914 Unclassified 1248
268 Ga0207693_10005914 3300025915 Bacteria 10148
269 Ga0207693_10010173 3300025915 Bacteria 7640
270 Ga0207693_10015624 3300025915 Bacteria 6087
271 Ga0207693_10050085 3300025915 Bacteria 3280
272 Ga0207693_10120724 3300025915 Bacteria 2058
273 Ga0207693_10225816 3300025915 Bacteria 1471
274 Ga0207693_10442899 3300025915 Unclassified 1015
275 Ga0207663_10000918 3300025916 Bacteria 13463
276 Ga0207660_10021396 3300025917 Bacteria 4349
277 Ga0207660_10060973 3300025917 Bacteria 2714
278 Ga0207657_10006029 3300025919 Bacteria 12603
279 Ga0207649_10030027 3300025920 Bacteria 3215
280 Ga0207649_10545700 3300025920 Unclassified 886
281 Ga0207652_10099264 3300025921 Bacteria 2569
282 Ga0207652_10116369 3300025921 Bacteria 2375
283 Ga0207646_10000122 3300025922 Bacteria 105908
284 Ga0207646_10002647 3300025922 Bacteria 21021
285 Ga0207646_10318050 3300025922 Bacteria 1406
286 Ga0207646_10337605 3300025922 Bacteria 1361
287 Ga0207681_10005323 3300025923 Bacteria 7904
288 Ga0207694_10000866 3300025924 Bacteria 26945
289 Ga0207694_10061311 3300025924 Bacteria 2927
290 Ga0207694_10177394 3300025924 Unclassified 1726
291 Ga0207694_10386558 3300025924 Unclassified 1162
292 Ga0207650_10003541 3300025925 Bacteria 10714
293 Ga0207650_10012994 3300025925 Bacteria 5758
294 Ga0207650_10341578 3300025925 Unclassified 1230
295 Ga0207687_10000823 3300025927 Bacteria 20970
296 Ga0207687_10043589 3300025927 Bacteria 3092
297 Ga0207700_10011050 3300025928 Bacteria 5737
298 Ga0207700_10014946 3300025928 Bacteria 5102
299 Ga0207700_10075684 3300025928 Unclassified 2609
300 Ga0207700_10213618 3300025928 Bacteria 1632
301 Ga0207700_10307615 3300025928 Bacteria 1370
302 Ga0207700_10400320 3300025928 Unclassified 1203
303 Ga0207700_10460678 3300025928 Bacteria 1121
304 Ga0207700_10477264 3300025928 Unclassified 1101
305 Ga0207664_10003509 3300025929 Bacteria 10473
306 Ga0207664_10046629 3300025929 Bacteria 3403
307 Ga0207664_10189850 3300025929 Unclassified 1768
308 Ga0207664_10450336 3300025929 Bacteria 1149
309 Ga0207690_10016612 3300025932 Bacteria 4482
310 Ga0207706_10018524 3300025933 Bacteria 6264
311 Ga0207686_10310779 3300025934 Unclassified 1174
312 Ga0207670_10482608 3300025936 Bacteria 1004
313 Ga0207704_10006091 3300025938 Bacteria 5593
314 Ga0207704_10008150 3300025938 Bacteria 4991
315 Ga0207665_10000008 3300025939 Bacteria 173434
316 Ga0207665_10009854 3300025939 Bacteria 6270
317 Ga0207665_10014535 3300025939 Bacteria 5183
318 Ga0207665_10027403 3300025939 Bacteria 3765
319 Ga0207665_10229008 3300025939 Bacteria 1365
320 Ga0207665_10246286 3300025939 Bacteria 1319
321 Ga0207711_10067942 3300025941 Bacteria 3086
322 Ga0207689_10021570 3300025942 Bacteria 5415
323 Ga0207661_10007970 3300025944 Bacteria 7551
324 Ga0207661_10032024 3300025944 Bacteria 4069
325 Ga0207661_10039256 3300025944 Bacteria 3715
326 Ga0207661_10140707 3300025944 Bacteria 2076
327 Ga0207661_10210821 3300025944 Bacteria 1712
328 Ga0207661_10337192 3300025944 Bacteria 1358
329 Ga0207679_10016007 3300025945 Bacteria 4971
330 Ga0207679_10033251 3300025945 Bacteria 3628
331 Ga0207679_10276023 3300025945 Unclassified 1439
332 Ga0207667_10000510 3300025949 Bacteria 51350
333 Ga0207667_10005593 3300025949 Bacteria 15334
334 Ga0207667_10042369 3300025949 Bacteria 4839
335 Ga0207667_10078091 3300025949 Bacteria 3432
336 Ga0207667_10102360 3300025949 Bacteria 2954
337 Ga0207667_10254137 3300025949 Unclassified 1798
338 Ga0207712_10236278 3300025961 Unclassified 1470
339 Ga0207640_10010423 3300025981 Bacteria 5237
340 Ga0207640_10032267 3300025981 Bacteria 3246
341 Ga0207640_10158287 3300025981 Unclassified 1672
342 Ga0207640_10792396 3300025981 Unclassified 820
343 Ga0207677_10008174 3300026023 Bacteria 5827
344 Ga0207677_10015005 3300026023 Bacteria 4542
345 Ga0207677_10018348 3300026023 Bacteria 4197
346 Ga0207677_10653427 3300026023 Unclassified 928
347 Ga0207703_10004076 3300026035 Bacteria 12054
348 Ga0207703_10033477 3300026035 Bacteria 4074
349 Ga0207703_10133260 3300026035 Bacteria 2148
350 Ga0207639_10010442 3300026041 Bacteria 6433
351 Ga0207639_10012526 3300026041 Bacteria 5909
352 Ga0207639_10067193 3300026041 Bacteria 2789
353 Ga0207639_10107039 3300026041 Bacteria 2271
354 Ga0207678_10721985 3300026067 Bacteria 878
355 Ga0207708_10232744 3300026075 Unclassified 1480
356 Ga0207702_10000086 3300026078 Bacteria 106199
357 Ga0207702_10001869 3300026078 Bacteria 20674
358 Ga0207702_10003671 3300026078 Bacteria 13897
359 Ga0207702_10041278 3300026078 Bacteria 3868
360 Ga0207702_10091011 3300026078 Bacteria 2670
361 Ga0207702_10201810 3300026078 Bacteria 1844
362 Ga0207702_10664285 3300026078 Unclassified 1026
363 Ga0207641_10020318 3300026088 Bacteria 5454
364 Ga0207641_10057052 3300026088 Bacteria 3321
365 Ga0207641_10510713 3300026088 Unclassified 1168
366 Ga0207648_10166807 3300026089 Bacteria 1946
367 Ga0207676_10003005 3300026095 Bacteria 12026
368 Ga0207674_10000281 3300026116 Bacteria 64232
369 Ga0207674_10158899 3300026116 Bacteria 2215
370 Ga0207674_10257658 3300026116 Unclassified 1691
371 Ga0207674_10385544 3300026116 Bacteria 1355
372 Ga0207674_10564000 3300026116 Unclassified 1100
373 Ga0207675_100211883 3300026118 Bacteria 1864
374 Ga0207683_10049106 3300026121 Unclassified 3693
375 Ga0207698_10052524 3300026142 Bacteria 3123
376 Ga0207698_10314004 3300026142 Bacteria 1465
377 Ga0207698_10405018 3300026142 Unclassified 1305
378 Ga0207698_10478713 3300026142 Unclassified 1207
379 Ga0209588_1010427 3300027671 Bacteria 2795
380 Ga0209588_1051371 3300027671 Bacteria 1333
381 Ga0209588_1052219 3300027671 Bacteria 1322
382 Ga0209588_1080535 3300027671 Unclassified 1052
383 Ga0209813_10086067 3300027866 Unclassified 1047
384 Ga0207428_10032298 3300027907 Unclassified 4307
385 Ga0268265_10288285 3300028380 Unclassified 1472
386 Ga0268264_10030109 3300028381 Bacteria 4450
387 Ga0268264_10136846 3300028381 Bacteria 2179
388 Ga0265318_10000320 3300028577 Bacteria 38387
389 Ga0265332_10007388 3300031238 Bacteria 4972
390 Ga0265320_10000139 3300031240 Bacteria 61536
391 Ga0265329_10000050 3300031242 Bacteria 51098
392 Ga0265331_10000135 3300031250 Bacteria 96750
393 Ga0265316_10000531 3300031344 Bacteria 42984
394 Ga0265313_10001857 3300031595 Bacteria 19236
395 Ga0265314_10015012 3300031711 Bacteria 6166
396 Ga0265342_10000694 3300031712 Bacteria 35309
397 Ga0307409_100055875 3300031995 Bacteria 3051
398 Ga0316212_1005063 3300033547 Bacteria 1914
399 Ga0373926_0005230 3300035083 Bacteria 4272
400 Ga0373923_0211082 3300035111 Bacteria 900
401 Ga0373936_0013132 3300035113 Bacteria 3159
402 Ga0373936_0023119 3300035113 Bacteria 2421
403 Ga0373945_0007946 3300035116 Bacteria 3443
404 Ga0373945_0008692 3300035116 Unclassified 3313
405 Ga0373945_0033910 3300035116 Bacteria 1817
406 Ga0373953_0164614 3300035117 Unclassified 954
407 Ga0373954_0050930 3300035118 Bacteria 1944
408 Ga0373954_0110738 3300035118 Unclassified 1328
409 Ga0373954_0179814 3300035118 Bacteria 1037
410 Ga0373956_0020266 3300035119 Unclassified 2828
411 Ga0373957_0145265 3300035120 Bacteria 972
412 Ga0373943_0016129 3300035170 Bacteria 3403
413 Ga0373943_0039322 3300035170 Unclassified 2278
414 Ga0373943_0041482 3300035170 Bacteria 2226
415 Ga0373955_0019293 3300035172 Unclassified 3404
416 Ga0373955_0135939 3300035172 Bacteria 1438
417 Ga0373955_0212921 3300035172 Unclassified 1153
418 Ga0373924_0000027 3300035410 Bacteria 37242
419 Ga0373935_0061188 3300035692 Unclassified 2410
420 Ga0373935_0072691 3300035692 Unclassified 2221
421 Ga0373927_0015112 3300035695 Bacteria 5104
422 Ga0373927_0027441 3300035695 Bacteria 3717
423 Ga0373927_0032309 3300035695 Bacteria 3409
424 Ga0373927_0062610 3300035695 Unclassified 2406
425 Ga0373927_0077315 3300035695 Bacteria 2156
426 Ga0373927_0225011 3300035695 Bacteria 1232
427 Ga0373933_0003010 3300035724 Bacteria 9400
428 Ga0373933_0076458 3300035724 Unclassified 2045
429 Ga0373933_0214536 3300035724 Unclassified 1234
430 Ga0373933_0315576 3300035724 Bacteria 1013
431 Ga0373947_0001944 3300035725 Bacteria 12658
432 Ga0373947_0007747 3300035725 Bacteria 6205
433 Ga0373947_0034741 3300035725 Bacteria 2982
434 Ga0373937_0000913 3300036401 Bacteria 25124
435 Ga0373937_0002496 3300036401 Bacteria 15283
436 Ga0373937_0003284 3300036401 Bacteria 13565
437 Ga0373937_0069150 3300036401 Bacteria 3255
438 Ga0373937_0069466 3300036401 Unclassified 3248
439 Ga0373937_0100971 3300036401 Unclassified 2677
440 Ga0373937_0269843 3300036401 Bacteria 1606
441 Ga0373925_0012677 3300037068 Bacteria 6104
442 Ga0373925_0103971 3300037068 Unclassified 2186
443 Ga0373925_0132847 3300037068 Bacteria 1942
444 Ga0373925_0161995 3300037068 Unclassified 1762
445 Ga0373925_0334740 3300037068 Bacteria 1227
446 Ga0395905_0020117 3300037471 Bacteria 6324
447 Ga0395905_0816171 3300037471 Unclassified 836
448 Ga0395901_0605960 3300038443 Bacteria 1104
449 Ga0436365_1734879 3300039437 Bacteria 1603
450 Ga0436363_1554825 3300039450 Unclassified 2172
451 Ga0453683_0005482 3300044673 Bacteria 8851
452 Ga0453683_0178936 3300044673 Unclassified 1345
453 Ga0466966_0371011 3300044684 Bacteria 860
454 Ga0466963_0124933 3300044694 Bacteria 1773
455 Ga0466957_0000326 3300044842 Bacteria 23157
456 Ga0451576_1299712 3300045051 Unclassified 758
457 Ga0466958_0356113 3300045836 Bacteria 943
458 Ga0466967_0075988 3300045976 Unclassified 3020
459 Ga0466967_0121957 3300045976 Bacteria 2410
460 Ga0466967_0176435 3300045976 Bacteria 2013
461 Ga0466967_0408345 3300045976 Bacteria 1322
462 Ga0466967_0840057 3300045976 Bacteria 912
463 Ga0495651_0005517 3300046462 Bacteria 9649
464 Ga0495651_0018012 3300046462 Bacteria 5469
465 Ga0495653_0060360 3300046463 Unclassified 2873
466 Ga0495580_0001178 3300046472 Bacteria 22989
467 Ga0495580_0003229 3300046472 Bacteria 13950
468 Ga0495580_0038359 3300046472 Bacteria 3431
469 Ga0495580_0157698 3300046472 Bacteria 1571
470 Ga0495582_0001662 3300046473 Bacteria 12544
471 Ga0495582_0077950 3300046473 Unclassified 1838
472 Ga0495639_0055016 3300046475 Bacteria 1814
473 Ga0495639_0199785 3300046475 Bacteria 978
474 Ga0495662_0032656 3300046476 Bacteria 2515
475 Ga0495662_0067641 3300046476 Bacteria 1729
476 Ga0495594_0050101 3300046499 Unclassified 2297
477 Ga0495594_0183663 3300046499 Unclassified 1191
478 Ga0495618_0074573 3300046514 Bacteria 2160
479 Ga0495628_0073701 3300046516 Bacteria 2660
480 Ga0495628_0258706 3300046516 Unclassified 1298
481 Ga0495630_0045629 3300046517 Bacteria 3275
482 Ga0495630_0064563 3300046517 Bacteria 2751
483 Ga0495630_0096939 3300046517 Bacteria 2230
484 Ga0495666_0070534 3300046526 Bacteria 1661
485 Ga0495652_0028011 3300046529 Bacteria 4962
486 Ga0495652_0258714 3300046529 Bacteria 1286
487 Ga0495665_0001416 3300046531 Bacteria 12857
488 Ga0495665_0188668 3300046531 Unclassified 1070
489 Ga0495640_0059875 3300046533 Bacteria 2592
490 Ga0495640_0216723 3300046533 Unclassified 1208
491 Ga0495587_0000471 3300046536 Bacteria 27923
492 Ga0495587_0085547 3300046536 Bacteria 1826
493 Ga0495645_0009174 3300046543 Bacteria 6910
494 Ga0495645_0300672 3300046543 Bacteria 1048
495 Ga0495667_0078956 3300046559 Bacteria 2140
496 Ga0495667_0177904 3300046559 Bacteria 1366
497 Ga0495634_0100168 3300046642 Bacteria 1873
498 Ga0495635_0080874 3300046663 Bacteria 2224
499 Ga0495588_0122523 3300046674 Bacteria 1371
500 Ga0495623_0005475 3300046679 Bacteria 8298
501 Ga0495623_0049298 3300046679 Bacteria 2669
502 Ga0495623_0084241 3300046679 Unclassified 1962
503 Ga0495658_0160470 3300046683 Bacteria 1386
504 Ga0495669_0166020 3300046684 Unclassified 1049
505 Ga0495613_0029096 3300046689 Bacteria 4108
506 Ga0495613_0196913 3300046689 Bacteria 1422
507 Ga0495624_0264794 3300046690 Unclassified 1038
508 Ga0495649_0162373 3300046694 Unclassified 1171
509 Ga0495581_0009321 3300047315 Bacteria 5682
510 Ga0495581_0084989 3300047315 Bacteria 1834
511 Ga0495581_0138903 3300047315 Bacteria 1417
512 Ga0495604_0100131 3300047317 Unclassified 2131
513 Ga0495604_0204244 3300047317 Bacteria 1369
514 Ga0495674_0141251 3300047319 Bacteria 2024
515 Ga0495676_0619834 3300047321 Unclassified 704
516 Ga0495680_0058253 3300047322 Unclassified 2986
517 Ga0495675_0000545 3300047444 Bacteria 24377
518 Ga0495684_0112494 3300047471 Bacteria 2053
519 Ga0495684_0495902 3300047471 Unclassified 841
520 Ga0495593_0112582 3300047673 Bacteria 1389
521 Ga0495602_0000402 3300048088 Bacteria 40515
522 Ga0496101_0230521 3300048904 Unclassified 1439
523 Ga0496102_0014302 3300048905 Bacteria 6896
524 Ga0496102_0080944 3300048905 Bacteria 2993
525 Ga0496102_0158952 3300048905 Bacteria 2125
526 Ga0496103_0026387 3300048906 Bacteria 3517
527 Ga0496104_0021552 3300048907 Bacteria 5918
528 Ga0496104_0052681 3300048907 Unclassified 3844
529 Ga0496104_0124674 3300048907 Bacteria 2473
530 Ga0496104_0134223 3300048907 Bacteria 2378
531 Ga0496104_0292496 3300048907 Bacteria 1541
532 Ga0496104_0321215 3300048907 Bacteria 1461
533 Ga0496105_0083338 3300048908 Bacteria 2641
534 Ga0496107_0351693 3300048910 Unclassified 1097
535 Ga0496108_0012878 3300048911 Bacteria 6814
536 Ga0496109_0047397 3300048912 Bacteria 3907
537 Ga0496110_0005089 3300048913 Bacteria 10269
538 Ga0496110_0598999 3300048913 Bacteria 1000
539 Ga0496111_0002091 3300048914 Bacteria 11909
540 Ga0496111_0024930 3300048914 Unclassified 4218
541 Ga0496112_0002140 3300048915 Bacteria 15679
542 Ga0496112_0019958 3300048915 Bacteria 6342
543 Ga0496112_0068436 3300048915 Bacteria 3506
544 Ga0496112_0087773 3300048915 Bacteria 3078
545 Ga0496112_0131067 3300048915 Bacteria 2478
546 Ga0496112_0241543 3300048915 Bacteria 1759
547 Ga0496112_0258915 3300048915 Unclassified 1689
548 Ga0496112_0573145 3300048915 Unclassified 1062
549 Ga0496113_0011053 3300048916 Bacteria 6002
550 Ga0496113_0046287 3300048916 Bacteria 3229
551 Ga0496115_0122343 3300048918 Bacteria 2142
552 Ga0501031_0276076 3300049568 Bacteria 1091
553 Ga0501034_0117211 3300049571 Bacteria 2650
554 Ga0501034_0563574 3300049571 Bacteria 1048
555 Ga0501036_0118475 3300049572 Unclassified 2236
556 Ga0501036_0240634 3300049572 Unclassified 1518
557 Ga0501036_0559067 3300049572 Unclassified 950
558 Ga0501039_0133216 3300049575 Unclassified 1951
559 Ga0501039_0330321 3300049575 Bacteria 1198
560 Ga0501040_0050766 3300049576 Unclassified 2838
561 Ga0501042_0090970 3300049578 Unclassified 2190
562 Ga0501047_0168718 3300049581 Bacteria 2058
563 Ga0501047_0524351 3300049581 Bacteria 1010
564 Ga0501048_0058373 3300049582 Bacteria 2735
565 Ga0501069_0164366 3300049585 Bacteria 1279
566 Ga0501071_0009176 3300049587 Bacteria 6575
567 Ga0501071_0079437 3300049587 Bacteria 2398
568 Ga0501071_0094159 3300049587 Bacteria 2203
569 Ga0501072_0017202 3300049588 Bacteria 5557
570 Ga0501072_0223153 3300049588 Bacteria 1502
571 Ga0501074_0088803 3300049590 Bacteria 2214
572 Ga0501074_0093373 3300049590 Unclassified 2155
573 Ga0501074_0138106 3300049590 Bacteria 1744
574 Ga0501075_0203559 3300049591 Unclassified 1510
575 Ga0501075_0214975 3300049591 Bacteria 1466
576 Ga0501076_0040660 3300049592 Bacteria 3655
577 Ga0501076_0070739 3300049592 Bacteria 2790
578 Ga0501077_0309488 3300049593 Bacteria 1007
579 Ga0501079_0293583 3300049741 Bacteria 1271
580 Ga0501080_0310635 3300049742 Bacteria 1429
581 Ga0501081_0099571 3300049743 Bacteria 2054
582 Ga0501081_0330352 3300049743 Unclassified 1122
583 Ga0501035_0223560 3300049822 Bacteria 1607
584 Ga0501045_0032463 3300049824 Bacteria 3783
585 Ga0501045_0073185 3300049824 Bacteria 2523
586 nmdc:mga03683_543_c1 3300050489 Bacteria 10809
587 nmdc:mga00v17_1254_c1 3300050491 Bacteria 13290
588 nmdc:mga0yw44_232555_c1 3300050492 Bacteria 1224
589 nmdc:mga0k408_42192_c1 3300050493 Bacteria 2627
590 nmdc:mga06z11_40671_c1 3300050494 Bacteria 2321
591 nmdc:mga04h51_29012_c1 3300050495 Bacteria 1730
592 nmdc:mga08y16_166792_c1 3300050511 Unclassified 2288
593 nmdc:mga0n895_108799_c1 3300050512 Bacteria 2787
594 nmdc:mga0n895_222559_c1 3300050512 Bacteria 1916
595 nmdc:mga0n895_389354_c1 3300050512 Bacteria 1410
596 nmdc:mga0rr50_175175_c1 3300050513 Bacteria 1750
597 nmdc:mga0rr50_37620_c1 3300050513 Unclassified 3495
598 nmdc:mga0rr50_57743_c1 3300050513 Unclassified 2904
599 nmdc:mga08x19_146_c1 3300050514 Bacteria 60222
600 nmdc:mga08x19_155550_c1 3300050514 Unclassified 1550
601 nmdc:mga08x19_2567_c1 3300050514 Bacteria 11042
602 nmdc:mga08x19_305111_c1 3300050514 Bacteria 1106
603 nmdc:mga08x19_37383_c1 3300050514 Bacteria 3081
604 nmdc:mga08x19_59450_c1 3300050514 Unclassified 2474
605 nmdc:mga08x19_6583_c1 3300050514 Bacteria 6885
606 nmdc:mga0a205_138805_c1 3300050515 Bacteria 2331
607 Ga0495601_0014885 3300053077 Unclassified 4696
608 Ga0495601_0029313 3300053077 Bacteria 3413
609 Ga0495601_0173339 3300053077 Bacteria 1410
610 Ga0495601_0318224 3300053077 Bacteria 1013
611 Ga0495612_0016409 3300053078 Bacteria 2968
612 Ga0495595_0080569 3300053084 Bacteria 1550
613 Ga0495619_0045210 3300053085 Bacteria 2893
614 Ga0495619_0124625 3300053085 Bacteria 1768
615 Ga0501084_0034145 3300054114 Bacteria 4253
616 Ga0501084_0239851 3300054114 Unclassified 1530
617 Ga0530510_0018757 3300061734 Bacteria 4907
618 Ga0068866_10106183
619 Ga0058862_11980645
620 Ga0065715_10023449
621 Ga0065715_10237222
622 Ga0065707_10195922
623 Ga0070683_100028438
624 Ga0070683_100050549
625 Ga0070683_100068644
626 Ga0070683_100151438
627 Ga0070670_100001056
628 Ga0070670_100004237
629 Ga0070670_100281962
630 Ga0068869_100013816
631 Ga0070666_10167821
632 Ga0070680_100081858
633 Ga0068868_100010310
634 Ga0068868_100014612
635 Ga0068868_100025822
636 Ga0070660_100002598
637 Ga0070689_100555856
638 Ga0070687_100221792
639 Ga0070661_100033197
640 Ga0070669_100469806
641 Ga0070675_100017446
642 Ga0070659_100051605
643 Ga0070709_10019198
644 Ga0070709_10057178
645 Ga0070709_10157631
646 Ga0070709_10181394
647 Ga0070714_100006981
648 Ga0070714_100040722
649 Ga0070714_100582210
650 Ga0070713_100003646
651 Ga0070713_100008055
652 Ga0070713_100010846
653 Ga0070713_100073031
654 Ga0070713_100105822
655 Ga0070713_100116344
656 Ga0070713_100244282
657 Ga0070713_100249149
658 Ga0070710_10021668
659 Ga0070710_10161020
660 Ga0070710_10200389
661 Ga0070711_100003089
662 Ga0070705_100018628
663 Ga0070705_100167005
664 Ga0070705_100398151
665 Ga0070708_100035530
666 Ga0070708_100036183
667 Ga0070708_100056917
668 Ga0070708_100057686
669 Ga0070708_100621006
670 Ga0070663_100273832
671 Ga0070662_100018342
672 Ga0070681_10000453
673 Ga0070681_10023797
674 Ga0070681_10026795
675 Ga0070681_10140422
676 Ga0070681_10209142
677 Ga0068867_100039000
678 Ga0068867_100147016
679 Ga0070685_10140211
680 Ga0070706_100131844
681 Ga0070706_100153144
682 Ga0070707_100084620
683 Ga0070707_100095684
684 Ga0070707_100153097
685 Ga0070698_100006903
686 Ga0070698_100022863
687 Ga0070698_100423759
688 Ga0070699_100178761
689 Ga0070699_100329441
690 Ga0070679_100179922
691 Ga0070684_100088154
692 Ga0070684_100108052
693 Ga0070684_100130455
694 Ga0070697_100000393
695 Ga0070697_100054087
696 Ga0070697_100202723
697 Ga0070697_100504494
698 Ga0068853_100023219
699 Ga0068853_100051528
700 Ga0068853_100106426
701 Ga0068853_100415838
702 Ga0070672_100074725
703 Ga0070693_100026905
704 Ga0070693_100031033
705 Ga0068855_100000151
706 Ga0068855_100003935
707 Ga0068855_100014636
708 Ga0068855_100095279
709 Ga0068855_100102117
710 Ga0068855_100102899
711 Ga0068855_100410458
712 Ga0070664_100002608
713 Ga0070664_100007042
714 Ga0070664_100011960
715 Ga0068857_100000121
716 Ga0068857_100061371
717 Ga0068857_100247178
718 Ga0068857_100530102
719 Ga0068854_100002645
720 Ga0068854_100024169
721 Ga0068854_100061463
722 Ga0068856_100000119
723 Ga0068856_100002726
724 Ga0068856_100006181
725 Ga0068856_100008546
726 Ga0068852_100075375
727 Ga0068852_100181500
728 Ga0068852_100354113
729 Ga0068859_100000415
730 Ga0068859_100239063
731 Ga0068859_100769449
732 Ga0068864_100001710
733 Ga0068864_100049669
734 Ga0068866_10047218
735 Ga0068866_10056124
736 Ga0068861_100209421
737 Ga0068851_10007273
738 Ga0068870_10017182
739 Ga0068863_100005712
740 Ga0068863_100205159
741 Ga0068863_100373997
742 Ga0068863_100533952
743 Ga0068858_100001496
744 Ga0068858_100027450
745 Ga0068858_100119680
746 Ga0068860_100119307
747 Ga0068860_100406788
748 Ga0068860_100812699
749 Ga0068862_100240502
750 Ga0068862_100291305
751 Ga0081540_1041944
752 Ga0070717_10000966
753 Ga0070717_10003354
754 Ga0070717_10056203
755 Ga0070717_10063383
756 Ga0070717_10277723
757 Ga0070717_10388759
758 Ga0070717_10396772
759 Ga0070715_10046875
760 Ga0070715_10219206
761 Ga0070716_100000450
762 Ga0070716_100022418
763 Ga0070716_100262144
764 Ga0070716_100286484
765 Ga0070716_100335558
766 Ga0070712_100007133
767 Ga0070712_100102972
768 Ga0070712_100383793
769 Ga0070712_100916217
770 Ga0097621_100002852
771 Ga0097621_100026115
772 Ga0097621_100041136
773 Ga0068871_100000258
774 Ga0068871_100000827
775 Ga0068871_100007369
776 Ga0068871_100055239
777 Ga0068871_100115251
778 Ga0075433_10110815
779 Ga0068865_100014950
780 Ga0068865_100042845
781 Ga0075436_100000368
782 Ga0075436_100013403
783 Ga0075436_100035014
784 Ga0075436_100072190
785 Ga0097620_100000415
786 Ga0097620_100239049
787 Ga0097620_100769439
788 Ga0097620_100969814
789 Ga0075435_100019267
790 Ga0075435_100222755
791 Ga0099794_10011930
792 Ga0099794_10013313
793 Ga0099794_10022133
794 Ga0099794_10117037
795 Ga0099795_10000942
796 Ga0099795_10007794
797 Ga0099795_10115805
798 Ga0099795_10195052
799 Ga0105240_10004947
800 Ga0105240_10099613
801 Ga0105240_10125847
802 Ga0105240_10248262
803 Ga0105240_10262209
804 Ga0105245_10000076
805 Ga0105245_10088884
806 Ga0105245_10259569
807 Ga0105241_10006972
808 Ga0105241_10017151
809 Ga0105241_10214708
810 Ga0105242_10055360
811 Ga0105242_10083847
812 Ga0105248_10091968
813 Ga0105248_10237864
814 Ga0105248_10394694
815 Ga0105237_10024941
816 Ga0105237_10070004
817 Ga0105237_10140637
818 Ga0105238_10000439
819 Ga0105238_10010036
820 Ga0105238_10141679
821 Ga0105238_10163862
822 Ga0105238_10194865
823 Ga0105249_10038016
824 Ga0105249_10236657
825 Ga0099796_10000665
826 Ga0099796_10056062
827 Ga0105239_10037520
828 Ga0105239_10124426
829 Ga0105239_10451507
830 Ga0105246_10098841
831 Ga0157371_10011209
832 Ga0157370_10161392
833 Ga0157369_10000108
834 Ga0157369_10039021
835 Ga0157369_10076715
836 Ga0157369_10400361
837 Ga0157369_10494638
838 Ga0157369_10960356
839 Ga0157374_10000329
840 Ga0157374_10007409
841 Ga0157374_10011951
842 Ga0157374_10041783
843 Ga0157374_10129214
844 Ga0157374_10239831
845 Ga0157374_10311698
846 Ga0157378_10000030
847 Ga0157378_10000099
848 Ga0157378_10035329
849 Ga0157378_10040708
850 Ga0157378_10059572
851 Ga0163162_10153325
852 Ga0157372_10000218
853 Ga0157372_10002609
854 Ga0157372_10030123
855 Ga0157372_10121459
856 Ga0157372_10708375
857 Ga0157375_10055276
858 Ga0163163_10049606
859 Ga0163163_10069161
860 Ga0157379_10487628
861 Ga0157376_10053632
862 Ga0182006_1055150
863 Ga0182007_10004292
864 Ga0182005_1003402
865 Ga0207656_10076934
866 Ga0207692_10023505
867 Ga0207642_10098859
868 Ga0207647_10012656
869 Ga0207699_10025114
870 Ga0207699_10040857
871 Ga0207699_10303923
872 Ga0207684_10022916
873 Ga0207684_10055346
874 Ga0207654_10039782
875 Ga0207654_10051486
876 Ga0207707_10001719
877 Ga0207707_10008849
878 Ga0207707_10040029
879 Ga0207695_10017041
880 Ga0207695_10093562
881 Ga0207695_10204479
882 Ga0207695_10230728
883 Ga0207671_10218154
884 Ga0207671_10309795
885 Ga0207693_10005914
886 Ga0207693_10010173
887 Ga0207693_10015624
888 Ga0207693_10050085
889 Ga0207693_10120724
890 Ga0207693_10225816
891 Ga0207693_10442899
892 Ga0207663_10000918
893 Ga0207660_10021396
894 Ga0207660_10060973
895 Ga0207657_10006029
896 Ga0207649_10030027
897 Ga0207649_10545700
898 Ga0207652_10099264
899 Ga0207652_10116369
900 Ga0207646_10000122
901 Ga0207646_10002647
902 Ga0207646_10318050
903 Ga0207646_10337605
904 Ga0207681_10005323
905 Ga0207694_10000866
906 Ga0207694_10061311
907 Ga0207694_10177394
908 Ga0207694_10386558
909 Ga0207650_10003541
910 Ga0207650_10012994
911 Ga0207650_10341578
912 Ga0207687_10000823
913 Ga0207687_10043589
914 Ga0207700_10011050
915 Ga0207700_10014946
916 Ga0207700_10075684
917 Ga0207700_10213618
918 Ga0207700_10307615
919 Ga0207700_10400320
920 Ga0207700_10460678
921 Ga0207700_10477264
922 Ga0207664_10003509
923 Ga0207664_10046629
924 Ga0207664_10189850
925 Ga0207664_10450336
926 Ga0207690_10016612
927 Ga0207706_10018524
928 Ga0207686_10310779
929 Ga0207670_10482608
930 Ga0207704_10006091
931 Ga0207704_10008150
932 Ga0207665_10000008
933 Ga0207665_10009854
934 Ga0207665_10014535
935 Ga0207665_10027403
936 Ga0207665_10229008
937 Ga0207665_10246286
938 Ga0207711_10067942
939 Ga0207689_10021570
940 Ga0207661_10007970
941 Ga0207661_10032024
942 Ga0207661_10039256
943 Ga0207661_10140707
944 Ga0207661_10210821
945 Ga0207661_10337192
946 Ga0207679_10016007
947 Ga0207679_10033251
948 Ga0207679_10276023
949 Ga0207667_10000510
950 Ga0207667_10005593
951 Ga0207667_10042369
952 Ga0207667_10078091
953 Ga0207667_10102360
954 Ga0207667_10254137
955 Ga0207712_10236278
956 Ga0207640_10010423
957 Ga0207640_10032267
958 Ga0207640_10158287
959 Ga0207640_10792396
960 Ga0207677_10008174
961 Ga0207677_10015005
962 Ga0207677_10018348
963 Ga0207677_10653427
964 Ga0207703_10004076
965 Ga0207703_10033477
966 Ga0207703_10133260
967 Ga0207639_10010442
968 Ga0207639_10012526
969 Ga0207639_10067193
970 Ga0207639_10107039
971 Ga0207678_10721985
972 Ga0207708_10232744
973 Ga0207702_10000086
974 Ga0207702_10001869
975 Ga0207702_10003671
976 Ga0207702_10041278
977 Ga0207702_10091011
978 Ga0207702_10201810
979 Ga0207702_10664285
980 Ga0207641_10020318
981 Ga0207641_10057052
982 Ga0207641_10510713
983 Ga0207648_10166807
984 Ga0207676_10003005
985 Ga0207674_10000281
986 Ga0207674_10158899
987 Ga0207674_10257658
988 Ga0207674_10385544
989 Ga0207674_10564000
990 Ga0207675_100211883
991 Ga0207683_10049106
992 Ga0207698_10052524
993 Ga0207698_10314004
994 Ga0207698_10405018
995 Ga0207698_10478713
996 Ga0209588_1010427
997 Ga0209588_1051371
998 Ga0209588_1052219
999 Ga0209588_1080535
1000 Ga0209813_10086067
1001 Ga0207428_10032298
1002 Ga0268265_10288285
1003 Ga0268264_10030109
1004 Ga0268264_10136846
1005 Ga0265318_10000320
1006 Ga0265332_10007388
1007 Ga0265320_10000139
1008 Ga0265329_10000050
1009 Ga0265331_10000135
1010 Ga0265316_10000531
1011 Ga0265313_10001857
1012 Ga0265314_10015012
1013 Ga0265342_10000694
1014 Ga0307409_100055875
1015 Ga0316212_1005063
1016 Ga0373926_0005230
1017 Ga0373923_0211082
1018 Ga0373936_0013132
1019 Ga0373936_0023119
1020 Ga0373945_0007946
1021 Ga0373945_0008692
1022 Ga0373945_0033910
1023 Ga0373953_0164614
1024 Ga0373954_0050930
1025 Ga0373954_0110738
1026 Ga0373954_0179814
1027 Ga0373956_0020266
1028 Ga0373957_0145265
1029 Ga0373943_0016129
1030 Ga0373943_0039322
1031 Ga0373943_0041482
1032 Ga0373955_0019293
1033 Ga0373955_0135939
1034 Ga0373955_0212921
1035 Ga0373924_0000027
1036 Ga0373935_0061188
1037 Ga0373935_0072691
1038 Ga0373927_0015112
1039 Ga0373927_0027441
1040 Ga0373927_0032309
1041 Ga0373927_0062610
1042 Ga0373927_0077315
1043 Ga0373927_0225011
1044 Ga0373933_0003010
1045 Ga0373933_0076458
1046 Ga0373933_0214536
1047 Ga0373933_0315576
1048 Ga0373947_0001944
1049 Ga0373947_0007747
1050 Ga0373947_0034741
1051 Ga0373937_0000913
1052 Ga0373937_0002496
1053 Ga0373937_0003284
1054 Ga0373937_0069150
1055 Ga0373937_0069466
1056 Ga0373937_0100971
1057 Ga0373937_0269843
1058 Ga0373925_0012677
1059 Ga0373925_0103971
1060 Ga0373925_0132847
1061 Ga0373925_0161995
1062 Ga0373925_0334740
1063 Ga0395905_0020117
1064 Ga0395905_0816171
1065 Ga0395901_0605960
1066 Ga0436365_1734879
1067 Ga0436363_1554825
1068 Ga0453683_0005482
1069 Ga0453683_0178936
1070 Ga0466966_0371011
1071 Ga0466963_0124933
1072 Ga0466957_0000326
1073 Ga0451576_1299712
1074 Ga0466958_0356113
1075 Ga0466967_0075988
1076 Ga0466967_0121957
1077 Ga0466967_0176435
1078 Ga0466967_0408345
1079 Ga0466967_0840057
1080 Ga0495651_0005517
1081 Ga0495651_0018012
1082 Ga0495653_0060360
1083 Ga0495580_0001178
1084 Ga0495580_0003229
1085 Ga0495580_0038359
1086 Ga0495580_0157698
1087 Ga0495582_0001662
1088 Ga0495582_0077950
1089 Ga0495639_0055016
1090 Ga0495639_0199785
1091 Ga0495662_0032656
1092 Ga0495662_0067641
1093 Ga0495594_0050101
1094 Ga0495594_0183663
1095 Ga0495618_0074573
1096 Ga0495628_0073701
1097 Ga0495628_0258706
1098 Ga0495630_0045629
1099 Ga0495630_0064563
1100 Ga0495630_0096939
1101 Ga0495666_0070534
1102 Ga0495652_0028011
1103 Ga0495652_0258714
1104 Ga0495665_0001416
1105 Ga0495665_0188668
1106 Ga0495640_0059875
1107 Ga0495640_0216723
1108 Ga0495587_0000471
1109 Ga0495587_0085547
1110 Ga0495645_0009174
1111 Ga0495645_0300672
1112 Ga0495667_0078956
1113 Ga0495667_0177904
1114 Ga0495634_0100168
1115 Ga0495635_0080874
1116 Ga0495588_0122523
1117 Ga0495623_0005475
1118 Ga0495623_0049298
1119 Ga0495623_0084241
1120 Ga0495658_0160470
1121 Ga0495669_0166020
1122 Ga0495613_0029096
1123 Ga0495613_0196913
1124 Ga0495624_0264794
1125 Ga0495649_0162373
1126 Ga0495581_0009321
1127 Ga0495581_0084989
1128 Ga0495581_0138903
1129 Ga0495604_0100131
1130 Ga0495604_0204244
1131 Ga0495674_0141251
1132 Ga0495676_0619834
1133 Ga0495680_0058253
1134 Ga0495675_0000545
1135 Ga0495684_0112494
1136 Ga0495684_0495902
1137 Ga0495593_0112582
1138 Ga0495602_0000402
1139 Ga0496101_0230521
1140 Ga0496102_0014302
1141 Ga0496102_0080944
1142 Ga0496102_0158952
1143 Ga0496103_0026387
1144 Ga0496104_0021552
1145 Ga0496104_0052681
1146 Ga0496104_0124674
1147 Ga0496104_0134223
1148 Ga0496104_0292496
1149 Ga0496104_0321215
1150 Ga0496105_0083338
1151 Ga0496107_0351693
1152 Ga0496108_0012878
1153 Ga0496109_0047397
1154 Ga0496110_0005089
1155 Ga0496110_0598999
1156 Ga0496111_0002091
1157 Ga0496111_0024930
1158 Ga0496112_0002140
1159 Ga0496112_0019958
1160 Ga0496112_0068436
1161 Ga0496112_0087773
1162 Ga0496112_0131067
1163 Ga0496112_0241543
1164 Ga0496112_0258915
1165 Ga0496112_0573145
1166 Ga0496113_0011053
1167 Ga0496113_0046287
1168 Ga0496115_0122343
1169 Ga0501031_0276076
1170 Ga0501034_0117211
1171 Ga0501034_0563574
1172 Ga0501036_0118475
1173 Ga0501036_0240634
1174 Ga0501036_0559067
1175 Ga0501039_0133216
1176 Ga0501039_0330321
1177 Ga0501040_0050766
1178 Ga0501042_0090970
1179 Ga0501047_0168718
1180 Ga0501047_0524351
1181 Ga0501048_0058373
1182 Ga0501069_0164366
1183 Ga0501071_0009176
1184 Ga0501071_0079437
1185 Ga0501071_0094159
1186 Ga0501072_0017202
1187 Ga0501072_0223153
1188 Ga0501074_0088803
1189 Ga0501074_0093373
1190 Ga0501074_0138106
1191 Ga0501075_0203559
1192 Ga0501075_0214975
1193 Ga0501076_0040660
1194 Ga0501076_0070739
1195 Ga0501077_0309488
1196 Ga0501079_0293583
1197 Ga0501080_0310635
1198 Ga0501081_0099571
1199 Ga0501081_0330352
1200 Ga0501035_0223560
1201 Ga0501045_0032463
1202 Ga0501045_0073185
1203 nmdc:mga03683_543_c1
1204 nmdc:mga00v17_1254_c1
1205 nmdc:mga0yw44_232555_c1
1206 nmdc:mga0k408_42192_c1
1207 nmdc:mga06z11_40671_c1
1208 nmdc:mga04h51_29012_c1
1209 nmdc:mga08y16_166792_c1
1210 nmdc:mga0n895_108799_c1
1211 nmdc:mga0n895_222559_c1
1212 nmdc:mga0n895_389354_c1
1213 nmdc:mga0rr50_175175_c1
1214 nmdc:mga0rr50_37620_c1
1215 nmdc:mga0rr50_57743_c1
1216 nmdc:mga08x19_146_c1
1217 nmdc:mga08x19_155550_c1
1218 nmdc:mga08x19_2567_c1
1219 nmdc:mga08x19_305111_c1
1220 nmdc:mga08x19_37383_c1
1221 nmdc:mga08x19_59450_c1
1222 nmdc:mga08x19_6583_c1
1223 nmdc:mga0a205_138805_c1
1224 Ga0495601_0014885
1225 Ga0495601_0029313
1226 Ga0495601_0173339
1227 Ga0495601_0318224
1228 Ga0495612_0016409
1229 Ga0495595_0080569
1230 Ga0495619_0045210
1231 Ga0495619_0124625
1232 Ga0501084_0034145
1233 Ga0501084_0239851
1234 Ga0530510_0018757

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04366

Ysc84

Las17-binding protein actin regulator

134

258

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rfq-assembly1.cif.gz_A structure of bacterial sylf domain containing protein, beta cell expansion factor a (befa) 0.7212 50 185
7q1v-assembly1.cif.gz_D arches protomer (trimer of trwg/virb8peri) structure from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.6197 55 100
6aa7-assembly1.cif.gz_A fluorescent protein from acropora digitifera 0.6192 53 121
4dkn-assembly1.cif.gz_A crystal structure of amphioxus green fluorescent protein, gfpa1 0.5849 54 119
2ddd-assembly1.cif.gz_A unique behavior of a histidine responsible for an engineered green-to-red photoconversion process 0.5486 53 122
ID Description Score Start End Superfamily
1xaeB00 Mainly Beta;Beta Barrel;Green Fluorescent Protein;Green fluorescent protein 0.4755 53 127 2.40.155.10
af_P54036_1_116_2.40.50.1000 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.4718 57 122 2.40.50.1000
af_Q25811_2_74_2.40.50.1000 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.4644 57 119 2.40.50.1000
6neqQ00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.4578 57 120 2.40.50.140
5y01A00 Mainly Beta;Beta Barrel;Green Fluorescent Protein;Green fluorescent protein 0.454 55 127 2.40.155.10
ID Description Score Start End GO Terms
AF-A0A1F2RBR5-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8621 22 231 GO:0035091
AF-Q1INT5-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8576 19 229 GO:0035091
AF-A0A2V9BQ86-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8575 18 229 GO:0035091
AF-A0A523I5E4-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8572 17 227 GO:0035091
AF-A0A2V9LYD1-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8565 18 234 GO:0035091

Map