F469546
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 616 | 263 | 616 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10350963|Ga0157380_103509632 |
| Length | 172 |
| Sequence | MKSELEKLYAAIESIETAMMTTRRADGHLRSRAMANQKQADGADLWFVCREGTAKLADLANDDHVNLTYYYRDSNREWVSVSGTAALSRDRAKIRELYAPDWKVWFANEGDPRHGTPDDPRMVLIGVTVHGAEFLEVNKPRPVILFELVKGWLTGNEPELGEMHELVEPRRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 102 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 103 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 191 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 192 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 193 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 194 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 195 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 196 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 197 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 198 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 199 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 200 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 201 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 202 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 203 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 219 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 236 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 243 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 244 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 245 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 246 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 247 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 248 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 258 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.41 |
| Nodule | 0 |
| Rhizoplane | 3.57 |
| Rhizosphere | 92.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_10885647 | 2162886012 | Bacteria | 1147 |
| 2 | 2214914668 | 2209111006 | Bacteria | 1382 |
| 3 | ARcpr5yngRDRAFT_c001452 | 3300000043 | Bacteria | 2612 |
| 4 | ARSoilOldRDRAFT_c003721 | 3300000044 | Unclassified | 1307 |
| 5 | ARCol0yngRDRAFT_1001318 | 3300000652 | Bacteria | 2061 |
| 6 | Ga0065714_10108127 | 3300005288 | Unclassified | 1482 |
| 7 | Ga0065712_10015439 | 3300005290 | Bacteria | 2144 |
| 8 | Ga0065712_10071300 | 3300005290 | Bacteria | 5354 |
| 9 | Ga0065715_10039893 | 3300005293 | Bacteria | 1190 |
| 10 | Ga0065715_10168703 | 3300005293 | Bacteria | 1526 |
| 11 | Ga0065715_10171781 | 3300005293 | Bacteria | 1541 |
| 12 | Ga0070658_11383248 | 3300005327 | Unclassified | 611 |
| 13 | Ga0070676_10001487 | 3300005328 | Bacteria | 11850 |
| 14 | Ga0070676_10317341 | 3300005328 | Bacteria | 1061 |
| 15 | Ga0070676_10339610 | 3300005328 | Bacteria | 1029 |
| 16 | Ga0070676_10997446 | 3300005328 | Bacteria | 628 |
| 17 | Ga0070683_100001000 | 3300005329 | Bacteria | 21167 |
| 18 | Ga0070683_100065612 | 3300005329 | Bacteria | 3380 |
| 19 | Ga0070683_101221949 | 3300005329 | Bacteria | 722 |
| 20 | Ga0070690_100014476 | 3300005330 | Bacteria | 4680 |
| 21 | Ga0070690_100046096 | 3300005330 | Unclassified | 2771 |
| 22 | Ga0070690_100509954 | 3300005330 | Bacteria | 901 |
| 23 | Ga0070690_101204028 | 3300005330 | Unclassified | 604 |
| 24 | Ga0070670_100043521 | 3300005331 | Bacteria | 3859 |
| 25 | Ga0070670_100109640 | 3300005331 | Bacteria | 2378 |
| 26 | Ga0070670_100140026 | 3300005331 | Bacteria | 2092 |
| 27 | Ga0070670_100240690 | 3300005331 | Bacteria | 1575 |
| 28 | Ga0070670_101202757 | 3300005331 | Bacteria | 693 |
| 29 | Ga0070670_101217352 | 3300005331 | Bacteria | 688 |
| 30 | Ga0070670_101434682 | 3300005331 | Unclassified | 633 |
| 31 | Ga0070677_10066440 | 3300005333 | Bacteria | 1504 |
| 32 | Ga0068869_100015138 | 3300005334 | Bacteria | 5166 |
| 33 | Ga0068869_100554294 | 3300005334 | Unclassified | 966 |
| 34 | Ga0070666_10019278 | 3300005335 | Bacteria | 4401 |
| 35 | Ga0070666_10020885 | 3300005335 | Bacteria | 4238 |
| 36 | Ga0070666_10332195 | 3300005335 | Bacteria | 1085 |
| 37 | Ga0070666_10430510 | 3300005335 | Unclassified | 951 |
| 38 | Ga0070666_10460252 | 3300005335 | Bacteria | 919 |
| 39 | Ga0070680_100030389 | 3300005336 | Bacteria | 4340 |
| 40 | Ga0070680_100338788 | 3300005336 | Bacteria | 1278 |
| 41 | Ga0070680_100373260 | 3300005336 | Bacteria | 1214 |
| 42 | Ga0070680_101563442 | 3300005336 | Unclassified | 571 |
| 43 | Ga0070682_100018353 | 3300005337 | Bacteria | 4088 |
| 44 | Ga0070682_101382082 | 3300005337 | Unclassified | 601 |
| 45 | Ga0068868_100055228 | 3300005338 | Unclassified | 3132 |
| 46 | Ga0068868_100609508 | 3300005338 | Unclassified | 968 |
| 47 | Ga0070660_100003048 | 3300005339 | Bacteria | 11529 |
| 48 | Ga0070689_100035358 | 3300005340 | Bacteria | 3818 |
| 49 | Ga0070691_10015617 | 3300005341 | Bacteria | 3488 |
| 50 | Ga0070691_10300663 | 3300005341 | Unclassified | 877 |
| 51 | Ga0070687_100038930 | 3300005343 | Bacteria | 2386 |
| 52 | Ga0070687_100340490 | 3300005343 | Bacteria | 965 |
| 53 | Ga0070661_100013334 | 3300005344 | Bacteria | 5770 |
| 54 | Ga0070661_100058547 | 3300005344 | Bacteria | 2824 |
| 55 | Ga0070692_10007733 | 3300005345 | Bacteria | 4757 |
| 56 | Ga0070692_10502139 | 3300005345 | Bacteria | 786 |
| 57 | Ga0070668_100063226 | 3300005347 | Bacteria | 2869 |
| 58 | Ga0070668_100244092 | 3300005347 | Bacteria | 1489 |
| 59 | Ga0070668_100262250 | 3300005347 | Bacteria | 1437 |
| 60 | Ga0070668_100291494 | 3300005347 | Bacteria | 1366 |
| 61 | Ga0070668_100585634 | 3300005347 | Unclassified | 974 |
| 62 | Ga0070669_100004979 | 3300005353 | Bacteria | 9601 |
| 63 | Ga0070669_100078935 | 3300005353 | Unclassified | 2447 |
| 64 | Ga0070669_100083179 | 3300005353 | Bacteria | 2387 |
| 65 | Ga0070669_100095343 | 3300005353 | Unclassified | 2237 |
| 66 | Ga0070669_100095747 | 3300005353 | Unclassified | 2233 |
| 67 | Ga0070669_100413054 | 3300005353 | Unclassified | 1106 |
| 68 | Ga0070669_101112315 | 3300005353 | Bacteria | 681 |
| 69 | Ga0070675_100000839 | 3300005354 | Bacteria | 21786 |
| 70 | Ga0070675_100028143 | 3300005354 | Bacteria | 4523 |
| 71 | Ga0070675_100030688 | 3300005354 | Bacteria | 4340 |
| 72 | Ga0070675_100237936 | 3300005354 | Unclassified | 1590 |
| 73 | Ga0070675_100387460 | 3300005354 | Bacteria | 1245 |
| 74 | Ga0070671_100010564 | 3300005355 | Bacteria | 7414 |
| 75 | Ga0070671_100119327 | 3300005355 | Bacteria | 2219 |
| 76 | Ga0070671_100640755 | 3300005355 | Bacteria | 920 |
| 77 | Ga0070671_101303718 | 3300005355 | Bacteria | 640 |
| 78 | Ga0070674_100007020 | 3300005356 | Bacteria | 6617 |
| 79 | Ga0070674_100054600 | 3300005356 | Bacteria | 2764 |
| 80 | Ga0070674_100405551 | 3300005356 | Bacteria | 1115 |
| 81 | Ga0070674_101242608 | 3300005356 | Bacteria | 662 |
| 82 | Ga0070673_100004148 | 3300005364 | Bacteria | 9127 |
| 83 | Ga0070673_100007827 | 3300005364 | Bacteria | 7078 |
| 84 | Ga0070673_100153819 | 3300005364 | Bacteria | 1950 |
| 85 | Ga0070673_100247227 | 3300005364 | Bacteria | 1553 |
| 86 | Ga0070673_100252461 | 3300005364 | Bacteria | 1538 |
| 87 | Ga0070673_100470318 | 3300005364 | Bacteria | 1133 |
| 88 | Ga0070673_100500153 | 3300005364 | Bacteria | 1099 |
| 89 | Ga0070673_101025961 | 3300005364 | Bacteria | 769 |
| 90 | Ga0070673_101099553 | 3300005364 | Bacteria | 742 |
| 91 | Ga0070688_100047455 | 3300005365 | Bacteria | 2664 |
| 92 | Ga0070659_100000725 | 3300005366 | Bacteria | 23943 |
| 93 | Ga0070659_100065634 | 3300005366 | Bacteria | 2875 |
| 94 | Ga0070667_100011331 | 3300005367 | Bacteria | 7374 |
| 95 | Ga0070667_100193162 | 3300005367 | Bacteria | 1804 |
| 96 | Ga0070667_100382699 | 3300005367 | Bacteria | 1278 |
| 97 | Ga0070667_100591504 | 3300005367 | Bacteria | 1022 |
| 98 | Ga0070701_10648344 | 3300005438 | Bacteria | 705 |
| 99 | Ga0070711_100417246 | 3300005439 | Bacteria | 1093 |
| 100 | Ga0070700_100015909 | 3300005441 | Bacteria | 4274 |
| 101 | Ga0070700_100056930 | 3300005441 | Bacteria | 2452 |
| 102 | Ga0070700_100598304 | 3300005441 | Bacteria | 864 |
| 103 | Ga0070700_100602759 | 3300005441 | Bacteria | 861 |
| 104 | Ga0070700_100902370 | 3300005441 | Bacteria | 720 |
| 105 | Ga0070694_100171006 | 3300005444 | Bacteria | 1601 |
| 106 | Ga0070663_100028201 | 3300005455 | Bacteria | 3820 |
| 107 | Ga0070663_100031144 | 3300005455 | Bacteria | 3664 |
| 108 | Ga0070663_100058518 | 3300005455 | Bacteria | 2767 |
| 109 | Ga0070663_100420451 | 3300005455 | Bacteria | 1096 |
| 110 | Ga0070663_101521468 | 3300005455 | Unclassified | 595 |
| 111 | Ga0070678_100147383 | 3300005456 | Bacteria | 1891 |
| 112 | Ga0070678_100198527 | 3300005456 | Unclassified | 1654 |
| 113 | Ga0070678_100276767 | 3300005456 | Bacteria | 1417 |
| 114 | Ga0070678_100885733 | 3300005456 | Bacteria | 815 |
| 115 | Ga0070662_100002254 | 3300005457 | Bacteria | 11828 |
| 116 | Ga0070662_100026981 | 3300005457 | Bacteria | 3982 |
| 117 | Ga0070662_100080277 | 3300005457 | Unclassified | 2428 |
| 118 | Ga0070662_100089958 | 3300005457 | Bacteria | 2303 |
| 119 | Ga0070681_10056134 | 3300005458 | Bacteria | 3920 |
| 120 | Ga0070681_10075157 | 3300005458 | Bacteria | 3339 |
| 121 | Ga0070681_10337799 | 3300005458 | Unclassified | 1416 |
| 122 | Ga0068867_100002587 | 3300005459 | Bacteria | 12749 |
| 123 | Ga0068867_100254943 | 3300005459 | Bacteria | 1428 |
| 124 | Ga0068867_100518781 | 3300005459 | Bacteria | 1027 |
| 125 | Ga0068867_100814593 | 3300005459 | Unclassified | 834 |
| 126 | Ga0068867_101299806 | 3300005459 | Bacteria | 671 |
| 127 | Ga0070685_10091484 | 3300005466 | Bacteria | 1842 |
| 128 | Ga0070699_100568064 | 3300005518 | Unclassified | 1033 |
| 129 | Ga0070679_100065393 | 3300005530 | Bacteria | 3625 |
| 130 | Ga0070679_100287104 | 3300005530 | Bacteria | 1597 |
| 131 | Ga0070684_100002014 | 3300005535 | Bacteria | 14950 |
| 132 | Ga0070684_100011230 | 3300005535 | Bacteria | 7131 |
| 133 | Ga0070684_100563507 | 3300005535 | Unclassified | 1058 |
| 134 | Ga0068853_100015152 | 3300005539 | Bacteria | 6338 |
| 135 | Ga0068853_100989011 | 3300005539 | Bacteria | 810 |
| 136 | Ga0068853_101049058 | 3300005539 | Unclassified | 785 |
| 137 | Ga0068853_101121678 | 3300005539 | Bacteria | 759 |
| 138 | Ga0070672_100020589 | 3300005543 | Bacteria | 4814 |
| 139 | Ga0070672_100057584 | 3300005543 | Bacteria | 3051 |
| 140 | Ga0070672_100161157 | 3300005543 | Bacteria | 1861 |
| 141 | Ga0070672_100246860 | 3300005543 | Bacteria | 1503 |
| 142 | Ga0070672_100428747 | 3300005543 | Bacteria | 1137 |
| 143 | Ga0070672_100718002 | 3300005543 | Bacteria | 876 |
| 144 | Ga0070686_100000375 | 3300005544 | Bacteria | 28474 |
| 145 | Ga0070686_100107038 | 3300005544 | Bacteria | 1898 |
| 146 | Ga0070686_100283359 | 3300005544 | Bacteria | 1223 |
| 147 | Ga0070695_100042162 | 3300005545 | Bacteria | 2896 |
| 148 | Ga0070696_100120447 | 3300005546 | Bacteria | 1899 |
| 149 | Ga0070696_100161749 | 3300005546 | Bacteria | 1650 |
| 150 | Ga0070696_100721265 | 3300005546 | Bacteria | 814 |
| 151 | Ga0070693_100078459 | 3300005547 | Bacteria | 1962 |
| 152 | Ga0070665_100010852 | 3300005548 | Bacteria | 9213 |
| 153 | Ga0070665_101764352 | 3300005548 | Bacteria | 626 |
| 154 | Ga0068855_100022327 | 3300005563 | Bacteria | 7583 |
| 155 | Ga0068855_101362343 | 3300005563 | Unclassified | 732 |
| 156 | Ga0070664_100000114 | 3300005564 | Bacteria | 53137 |
| 157 | Ga0070664_100001191 | 3300005564 | Bacteria | 20716 |
| 158 | Ga0070664_100010322 | 3300005564 | Bacteria | 7579 |
| 159 | Ga0070664_100152079 | 3300005564 | Bacteria | 2043 |
| 160 | Ga0070664_100391171 | 3300005564 | Bacteria | 1270 |
| 161 | Ga0070664_100446563 | 3300005564 | Bacteria | 1187 |
| 162 | Ga0068857_100103226 | 3300005577 | Bacteria | 2560 |
| 163 | Ga0068857_100118739 | 3300005577 | Bacteria | 2380 |
| 164 | Ga0068854_100012913 | 3300005578 | Bacteria | 5469 |
| 165 | Ga0068854_100231819 | 3300005578 | Bacteria | 1466 |
| 166 | Ga0068854_100911735 | 3300005578 | Bacteria | 773 |
| 167 | Ga0068856_100007822 | 3300005614 | Bacteria | 10437 |
| 168 | Ga0068856_100557339 | 3300005614 | Unclassified | 1167 |
| 169 | Ga0070702_100051333 | 3300005615 | Bacteria | 2360 |
| 170 | Ga0070702_100181798 | 3300005615 | Bacteria | 1377 |
| 171 | Ga0070702_100240139 | 3300005615 | Bacteria | 1222 |
| 172 | Ga0068852_100152956 | 3300005616 | Unclassified | 2147 |
| 173 | Ga0068859_100011781 | 3300005617 | Bacteria | 8786 |
| 174 | Ga0068859_100299917 | 3300005617 | Unclassified | 1700 |
| 175 | Ga0068864_100039795 | 3300005618 | Bacteria | 4018 |
| 176 | Ga0068864_100044705 | 3300005618 | Bacteria | 3798 |
| 177 | Ga0068864_100315555 | 3300005618 | Bacteria | 1467 |
| 178 | Ga0068864_100386575 | 3300005618 | Bacteria | 1327 |
| 179 | Ga0068864_100709016 | 3300005618 | Bacteria | 983 |
| 180 | Ga0068866_10089598 | 3300005718 | Unclassified | 1672 |
| 181 | Ga0068866_10293293 | 3300005718 | Unclassified | 1013 |
| 182 | Ga0068866_10362316 | 3300005718 | Bacteria | 924 |
| 183 | Ga0068866_10613316 | 3300005718 | Bacteria | 736 |
| 184 | Ga0068861_100113855 | 3300005719 | Unclassified | 2171 |
| 185 | Ga0068861_100253547 | 3300005719 | Bacteria | 1502 |
| 186 | Ga0068861_100368083 | 3300005719 | Bacteria | 1266 |
| 187 | Ga0068861_100979376 | 3300005719 | Bacteria | 806 |
| 188 | Ga0068861_101220422 | 3300005719 | Bacteria | 728 |
| 189 | Ga0068851_10147618 | 3300005834 | Bacteria | 1283 |
| 190 | Ga0068851_10162938 | 3300005834 | Bacteria | 1226 |
| 191 | Ga0068851_10586971 | 3300005834 | Bacteria | 677 |
| 192 | Ga0068870_10502920 | 3300005840 | Unclassified | 808 |
| 193 | Ga0068863_100032965 | 3300005841 | Bacteria | 4935 |
| 194 | Ga0068863_100129465 | 3300005841 | Bacteria | 2409 |
| 195 | Ga0068863_100377743 | 3300005841 | Bacteria | 1383 |
| 196 | Ga0068863_100851760 | 3300005841 | Bacteria | 910 |
| 197 | Ga0068858_100010864 | 3300005842 | Bacteria | 8605 |
| 198 | Ga0068858_100518474 | 3300005842 | Bacteria | 1153 |
| 199 | Ga0068858_100828281 | 3300005842 | Bacteria | 903 |
| 200 | Ga0068860_100009059 | 3300005843 | Bacteria | 9906 |
| 201 | Ga0068860_100158474 | 3300005843 | Bacteria | 2182 |
| 202 | Ga0068860_100571045 | 3300005843 | Unclassified | 1134 |
| 203 | Ga0068862_100025864 | 3300005844 | Bacteria | 4930 |
| 204 | Ga0068862_100403507 | 3300005844 | Bacteria | 1279 |
| 205 | Ga0068862_101027724 | 3300005844 | Bacteria | 816 |
| 206 | Ga0075368_10008568 | 3300006042 | Bacteria | 3647 |
| 207 | Ga0075364_10590998 | 3300006051 | Unclassified | 758 |
| 208 | Ga0075432_10002038 | 3300006058 | Bacteria | 6723 |
| 209 | Ga0075432_10116839 | 3300006058 | Bacteria | 999 |
| 210 | Ga0075362_10233397 | 3300006177 | Bacteria | 901 |
| 211 | Ga0075367_10003622 | 3300006178 | Bacteria | 7406 |
| 212 | Ga0075367_10395618 | 3300006178 | Unclassified | 874 |
| 213 | Ga0075367_10503649 | 3300006178 | Unclassified | 768 |
| 214 | Ga0075366_10055335 | 3300006195 | Bacteria | 2357 |
| 215 | Ga0097621_100226451 | 3300006237 | Bacteria | 1631 |
| 216 | Ga0097621_100793336 | 3300006237 | Unclassified | 877 |
| 217 | Ga0075370_10004713 | 3300006353 | Bacteria | 6662 |
| 218 | Ga0068871_100001944 | 3300006358 | Bacteria | 13989 |
| 219 | Ga0068871_100909368 | 3300006358 | Bacteria | 816 |
| 220 | Ga0068871_101091478 | 3300006358 | Bacteria | 746 |
| 221 | Ga0068871_101202694 | 3300006358 | Unclassified | 711 |
| 222 | Ga0075428_100021566 | 3300006844 | Bacteria | 7132 |
| 223 | Ga0075428_100204960 | 3300006844 | Bacteria | 2131 |
| 224 | Ga0075428_101321257 | 3300006844 | Bacteria | 758 |
| 225 | Ga0075430_100280578 | 3300006846 | Bacteria | 1378 |
| 226 | Ga0075431_100220513 | 3300006847 | Bacteria | 1935 |
| 227 | Ga0075433_10140646 | 3300006852 | Bacteria | 2145 |
| 228 | Ga0075434_100976746 | 3300006871 | Unclassified | 861 |
| 229 | Ga0075429_100044193 | 3300006880 | Bacteria | 3875 |
| 230 | Ga0075429_100633856 | 3300006880 | Bacteria | 936 |
| 231 | Ga0068865_100013065 | 3300006881 | Bacteria | 5237 |
| 232 | Ga0068865_100065405 | 3300006881 | Bacteria | 2562 |
| 233 | Ga0068865_100153580 | 3300006881 | Bacteria | 1749 |
| 234 | Ga0068865_100297381 | 3300006881 | Bacteria | 1291 |
| 235 | Ga0097620_100011782 | 3300006931 | Bacteria | 8786 |
| 236 | Ga0097620_100299920 | 3300006931 | Unclassified | 1700 |
| 237 | Ga0097620_100360045 | 3300006931 | Bacteria | 1550 |
| 238 | Ga0075435_100006040 | 3300007076 | Bacteria | 8527 |
| 239 | Ga0111539_10080502 | 3300009094 | Bacteria | 3831 |
| 240 | Ga0111539_10098176 | 3300009094 | Bacteria | 3441 |
| 241 | Ga0111539_10193964 | 3300009094 | Bacteria | 2369 |
| 242 | Ga0111539_10484912 | 3300009094 | Bacteria | 1440 |
| 243 | Ga0111539_10519644 | 3300009094 | Unclassified | 1387 |
| 244 | Ga0105245_10015486 | 3300009098 | Bacteria | 6649 |
| 245 | Ga0114129_10019183 | 3300009147 | Bacteria | 9742 |
| 246 | Ga0114129_10033996 | 3300009147 | Bacteria | 7201 |
| 247 | Ga0114129_10365854 | 3300009147 | Bacteria | 1907 |
| 248 | Ga0114129_10579456 | 3300009147 | Unclassified | 1456 |
| 249 | Ga0114129_10911284 | 3300009147 | Bacteria | 1113 |
| 250 | Ga0105243_10029240 | 3300009148 | Bacteria | 4237 |
| 251 | Ga0105243_10065131 | 3300009148 | Bacteria | 2926 |
| 252 | Ga0105243_10124002 | 3300009148 | Bacteria | 2183 |
| 253 | Ga0105241_10034415 | 3300009174 | Bacteria | 3806 |
| 254 | Ga0105242_10012710 | 3300009176 | Bacteria | 6484 |
| 255 | Ga0105242_10024384 | 3300009176 | Bacteria | 4777 |
| 256 | Ga0105242_10235893 | 3300009176 | Bacteria | 1642 |
| 257 | Ga0105242_11849556 | 3300009176 | Bacteria | 643 |
| 258 | Ga0105248_10003724 | 3300009177 | Bacteria | 16906 |
| 259 | Ga0105248_10062496 | 3300009177 | Bacteria | 4181 |
| 260 | Ga0105248_10113195 | 3300009177 | Unclassified | 3060 |
| 261 | Ga0105248_10227291 | 3300009177 | Bacteria | 2101 |
| 262 | Ga0105248_10639756 | 3300009177 | Bacteria | 1200 |
| 263 | Ga0105248_10684367 | 3300009177 | Bacteria | 1157 |
| 264 | Ga0105248_10698889 | 3300009177 | Unclassified | 1144 |
| 265 | Ga0105248_10738528 | 3300009177 | Unclassified | 1111 |
| 266 | Ga0105238_10183773 | 3300009551 | Bacteria | 2067 |
| 267 | Ga0105238_10271288 | 3300009551 | Unclassified | 1677 |
| 268 | Ga0105249_10037113 | 3300009553 | Bacteria | 4422 |
| 269 | Ga0105249_10124466 | 3300009553 | Bacteria | 2453 |
| 270 | Ga0105249_10257340 | 3300009553 | Bacteria | 1733 |
| 271 | Ga0105249_10346235 | 3300009553 | Bacteria | 1504 |
| 272 | Ga0105239_10112907 | 3300010375 | Bacteria | 3013 |
| 273 | Ga0105239_10289132 | 3300010375 | Bacteria | 1846 |
| 274 | Ga0105239_11534316 | 3300010375 | Bacteria | 770 |
| 275 | Ga0105246_10216157 | 3300011119 | Bacteria | 1499 |
| 276 | Ga0105246_10648530 | 3300011119 | Bacteria | 919 |
| 277 | Ga0157318_1000751 | 3300012482 | Bacteria | 1491 |
| 278 | Ga0157319_1014951 | 3300012497 | Bacteria | 688 |
| 279 | Ga0157315_1027216 | 3300012508 | Unclassified | 647 |
| 280 | Ga0157373_10004088 | 3300013100 | Bacteria | 10991 |
| 281 | Ga0157371_10006712 | 3300013102 | Bacteria | 9411 |
| 282 | Ga0157371_10585129 | 3300013102 | Unclassified | 829 |
| 283 | Ga0157374_10005208 | 3300013296 | Bacteria | 10902 |
| 284 | Ga0157374_10024270 | 3300013296 | Bacteria | 5434 |
| 285 | Ga0157374_10261131 | 3300013296 | Unclassified | 1706 |
| 286 | Ga0157378_10169969 | 3300013297 | Bacteria | 2044 |
| 287 | Ga0157378_10268321 | 3300013297 | Bacteria | 1640 |
| 288 | Ga0163162_10022490 | 3300013306 | Bacteria | 6212 |
| 289 | Ga0163162_10295303 | 3300013306 | Bacteria | 1752 |
| 290 | Ga0163162_12148921 | 3300013306 | Bacteria | 641 |
| 291 | Ga0157372_10008721 | 3300013307 | Bacteria | 10768 |
| 292 | Ga0157372_10088937 | 3300013307 | Unclassified | 3508 |
| 293 | Ga0157375_10141938 | 3300013308 | Bacteria | 2529 |
| 294 | Ga0157375_10377729 | 3300013308 | Bacteria | 1584 |
| 295 | Ga0157375_10885692 | 3300013308 | Unclassified | 1037 |
| 296 | Ga0163163_10020594 | 3300014325 | Bacteria | 6215 |
| 297 | Ga0163163_10021756 | 3300014325 | Bacteria | 6058 |
| 298 | Ga0163163_10047937 | 3300014325 | Bacteria | 4200 |
| 299 | Ga0163163_11478215 | 3300014325 | Bacteria | 741 |
| 300 | Ga0157380_10006025 | 3300014326 | Bacteria | 8491 |
| 301 | Ga0157380_10059059 | 3300014326 | Bacteria | 3059 |
| 302 | Ga0157380_10071826 | 3300014326 | Bacteria | 2801 |
| 303 | Ga0157380_10123070 | 3300014326 | Unclassified | 2200 |
| 304 | Ga0157380_10130260 | 3300014326 | Bacteria | 2145 |
| 305 | Ga0157380_10350963 | 3300014326 | Bacteria | 1380 |
| 306 | Ga0157377_10121566 | 3300014745 | Bacteria | 1583 |
| 307 | Ga0157377_10177787 | 3300014745 | Bacteria | 1336 |
| 308 | Ga0157379_10004109 | 3300014968 | Bacteria | 12417 |
| 309 | Ga0157379_11094418 | 3300014968 | Bacteria | 763 |
| 310 | Ga0157376_10010996 | 3300014969 | Bacteria | 6650 |
| 311 | Ga0157376_10173717 | 3300014969 | Bacteria | 1964 |
| 312 | Ga0157376_10262986 | 3300014969 | Bacteria | 1617 |
| 313 | Ga0157376_10430592 | 3300014969 | Bacteria | 1282 |
| 314 | Ga0163161_10147057 | 3300017792 | Unclassified | 1788 |
| 315 | Ga0163161_10471017 | 3300017792 | Bacteria | 1018 |
| 316 | Ga0206351_10940915 | 3300020077 | Unclassified | 769 |
| 317 | Ga0206350_11192982 | 3300020080 | Unclassified | 852 |
| 318 | Ga0207673_1049399 | 3300025290 | Bacteria | 595 |
| 319 | Ga0207697_10041412 | 3300025315 | Unclassified | 1892 |
| 320 | Ga0207656_10148570 | 3300025321 | Bacteria | 1108 |
| 321 | Ga0207682_10135441 | 3300025893 | Bacteria | 1102 |
| 322 | Ga0207682_10222950 | 3300025893 | Unclassified | 872 |
| 323 | Ga0207682_10288179 | 3300025893 | Bacteria | 768 |
| 324 | Ga0207682_10375375 | 3300025893 | Bacteria | 671 |
| 325 | Ga0207688_10019315 | 3300025901 | Bacteria | 3711 |
| 326 | Ga0207680_10003033 | 3300025903 | Bacteria | 7875 |
| 327 | Ga0207680_10021092 | 3300025903 | Bacteria | 3520 |
| 328 | Ga0207680_10050528 | 3300025903 | Bacteria | 2481 |
| 329 | Ga0207680_10519998 | 3300025903 | Bacteria | 848 |
| 330 | Ga0207647_10161473 | 3300025904 | Bacteria | 1307 |
| 331 | Ga0207645_10002100 | 3300025907 | Bacteria | 15942 |
| 332 | Ga0207645_10113431 | 3300025907 | Bacteria | 1756 |
| 333 | Ga0207645_10118507 | 3300025907 | Bacteria | 1717 |
| 334 | Ga0207645_10717826 | 3300025907 | Bacteria | 679 |
| 335 | Ga0207643_10407083 | 3300025908 | Unclassified | 861 |
| 336 | Ga0207643_10450280 | 3300025908 | Unclassified | 819 |
| 337 | Ga0207705_11003546 | 3300025909 | Unclassified | 645 |
| 338 | Ga0207707_10060647 | 3300025912 | Bacteria | 3290 |
| 339 | Ga0207707_10363187 | 3300025912 | Bacteria | 1246 |
| 340 | Ga0207660_10054061 | 3300025917 | Bacteria | 2864 |
| 341 | Ga0207660_10369486 | 3300025917 | Unclassified | 1152 |
| 342 | Ga0207662_10010192 | 3300025918 | Bacteria | 5182 |
| 343 | Ga0207662_10034269 | 3300025918 | Bacteria | 2963 |
| 344 | Ga0207657_10000533 | 3300025919 | Bacteria | 40456 |
| 345 | Ga0207657_10550610 | 3300025919 | Unclassified | 902 |
| 346 | Ga0207649_10007195 | 3300025920 | Bacteria | 6050 |
| 347 | Ga0207649_10434050 | 3300025920 | Bacteria | 988 |
| 348 | Ga0207649_10709383 | 3300025920 | Bacteria | 781 |
| 349 | Ga0207649_11312283 | 3300025920 | Bacteria | 572 |
| 350 | Ga0207681_10003378 | 3300025923 | Bacteria | 9988 |
| 351 | Ga0207681_10099286 | 3300025923 | Bacteria | 2096 |
| 352 | Ga0207681_10151214 | 3300025923 | Unclassified | 1740 |
| 353 | Ga0207681_10178947 | 3300025923 | Bacteria | 1614 |
| 354 | Ga0207681_10640829 | 3300025923 | Bacteria | 880 |
| 355 | Ga0207681_10818963 | 3300025923 | Unclassified | 778 |
| 356 | Ga0207681_10929025 | 3300025923 | Unclassified | 729 |
| 357 | Ga0207694_10457288 | 3300025924 | Bacteria | 1066 |
| 358 | Ga0207694_10567075 | 3300025924 | Bacteria | 954 |
| 359 | Ga0207650_10013311 | 3300025925 | Bacteria | 5694 |
| 360 | Ga0207650_10030949 | 3300025925 | Unclassified | 3861 |
| 361 | Ga0207650_10081359 | 3300025925 | Bacteria | 2457 |
| 362 | Ga0207650_10093388 | 3300025925 | Bacteria | 2303 |
| 363 | Ga0207650_10123652 | 3300025925 | Bacteria | 2017 |
| 364 | Ga0207659_10001283 | 3300025926 | Bacteria | 15013 |
| 365 | Ga0207659_10008656 | 3300025926 | Bacteria | 6330 |
| 366 | Ga0207659_10029224 | 3300025926 | Bacteria | 3755 |
| 367 | Ga0207659_10033382 | 3300025926 | Bacteria | 3542 |
| 368 | Ga0207659_10338728 | 3300025926 | Bacteria | 1245 |
| 369 | Ga0207687_10138613 | 3300025927 | Bacteria | 1843 |
| 370 | Ga0207644_10016669 | 3300025931 | Bacteria | 4947 |
| 371 | Ga0207644_10125946 | 3300025931 | Bacteria | 1955 |
| 372 | Ga0207644_10606119 | 3300025931 | Unclassified | 909 |
| 373 | Ga0207690_10004002 | 3300025932 | Bacteria | 8701 |
| 374 | Ga0207690_10304407 | 3300025932 | Bacteria | 1248 |
| 375 | Ga0207706_10000219 | 3300025933 | Bacteria | 62762 |
| 376 | Ga0207706_10028982 | 3300025933 | Bacteria | 4943 |
| 377 | Ga0207706_10096007 | 3300025933 | Bacteria | 2607 |
| 378 | Ga0207706_10103939 | 3300025933 | Bacteria | 2499 |
| 379 | Ga0207706_10317037 | 3300025933 | Bacteria | 1357 |
| 380 | Ga0207686_10107010 | 3300025934 | Unclassified | 1879 |
| 381 | Ga0207686_10452050 | 3300025934 | Bacteria | 988 |
| 382 | Ga0207709_10049387 | 3300025935 | Bacteria | 2568 |
| 383 | Ga0207709_10072574 | 3300025935 | Unclassified | 2190 |
| 384 | Ga0207670_10099660 | 3300025936 | Bacteria | 2073 |
| 385 | Ga0207670_10232005 | 3300025936 | Bacteria | 1418 |
| 386 | Ga0207670_10895219 | 3300025936 | Bacteria | 743 |
| 387 | Ga0207669_10002768 | 3300025937 | Bacteria | 7523 |
| 388 | Ga0207669_10024022 | 3300025937 | Bacteria | 3269 |
| 389 | Ga0207669_10417691 | 3300025937 | Bacteria | 1055 |
| 390 | Ga0207669_10535457 | 3300025937 | Bacteria | 943 |
| 391 | Ga0207704_10027688 | 3300025938 | Bacteria | 3132 |
| 392 | Ga0207704_10056925 | 3300025938 | Bacteria | 2398 |
| 393 | Ga0207704_10343905 | 3300025938 | Bacteria | 1159 |
| 394 | Ga0207691_10001676 | 3300025940 | Bacteria | 21893 |
| 395 | Ga0207691_10063829 | 3300025940 | Bacteria | 3339 |
| 396 | Ga0207691_10086466 | 3300025940 | Bacteria | 2813 |
| 397 | Ga0207691_10184364 | 3300025940 | Bacteria | 1822 |
| 398 | Ga0207691_10222160 | 3300025940 | Unclassified | 1638 |
| 399 | Ga0207691_10224439 | 3300025940 | Bacteria | 1628 |
| 400 | Ga0207711_10050313 | 3300025941 | Bacteria | 3567 |
| 401 | Ga0207711_10235943 | 3300025941 | Bacteria | 1676 |
| 402 | Ga0207711_10370801 | 3300025941 | Bacteria | 1327 |
| 403 | Ga0207711_10453998 | 3300025941 | Unclassified | 1193 |
| 404 | Ga0207711_10517602 | 3300025941 | Bacteria | 1112 |
| 405 | Ga0207711_10579413 | 3300025941 | Unclassified | 1047 |
| 406 | Ga0207689_10005037 | 3300025942 | Bacteria | 11906 |
| 407 | Ga0207689_10571856 | 3300025942 | Bacteria | 950 |
| 408 | Ga0207661_10001718 | 3300025944 | Bacteria | 14980 |
| 409 | Ga0207661_10110033 | 3300025944 | Bacteria | 2328 |
| 410 | Ga0207661_10428618 | 3300025944 | Bacteria | 1202 |
| 411 | Ga0207661_11050272 | 3300025944 | Bacteria | 750 |
| 412 | Ga0207679_10048221 | 3300025945 | Bacteria | 3099 |
| 413 | Ga0207679_10162611 | 3300025945 | Bacteria | 1829 |
| 414 | Ga0207679_10165684 | 3300025945 | Bacteria | 1814 |
| 415 | Ga0207679_10341994 | 3300025945 | Unclassified | 1301 |
| 416 | Ga0207667_10009864 | 3300025949 | Bacteria | 11209 |
| 417 | Ga0207667_10379941 | 3300025949 | Bacteria | 1439 |
| 418 | Ga0207667_11083921 | 3300025949 | Unclassified | 785 |
| 419 | Ga0207651_10006456 | 3300025960 | Bacteria | 6141 |
| 420 | Ga0207651_10011031 | 3300025960 | Bacteria | 5036 |
| 421 | Ga0207651_10125255 | 3300025960 | Bacteria | 1956 |
| 422 | Ga0207651_10199966 | 3300025960 | Bacteria | 1601 |
| 423 | Ga0207651_10270808 | 3300025960 | Bacteria | 1399 |
| 424 | Ga0207651_11050040 | 3300025960 | Bacteria | 729 |
| 425 | Ga0207651_11211288 | 3300025960 | Bacteria | 678 |
| 426 | Ga0207712_10032506 | 3300025961 | Unclassified | 3523 |
| 427 | Ga0207712_10442250 | 3300025961 | Unclassified | 1101 |
| 428 | Ga0207712_11009979 | 3300025961 | Unclassified | 738 |
| 429 | Ga0207668_10060085 | 3300025972 | Unclassified | 2666 |
| 430 | Ga0207668_10260440 | 3300025972 | Unclassified | 1413 |
| 431 | Ga0207640_10070040 | 3300025981 | Unclassified | 2357 |
| 432 | Ga0207640_10249434 | 3300025981 | Unclassified | 1377 |
| 433 | Ga0207640_10305864 | 3300025981 | Bacteria | 1260 |
| 434 | Ga0207640_10318519 | 3300025981 | Bacteria | 1237 |
| 435 | Ga0207640_10362995 | 3300025981 | Bacteria | 1168 |
| 436 | Ga0207658_10018258 | 3300025986 | Bacteria | 4840 |
| 437 | Ga0207658_10026505 | 3300025986 | Bacteria | 4063 |
| 438 | Ga0207658_10342289 | 3300025986 | Unclassified | 1300 |
| 439 | Ga0207677_10569688 | 3300026023 | Unclassified | 990 |
| 440 | Ga0207703_10006392 | 3300026035 | Bacteria | 9420 |
| 441 | Ga0207703_10167861 | 3300026035 | Unclassified | 1928 |
| 442 | Ga0207703_11303603 | 3300026035 | Bacteria | 698 |
| 443 | Ga0207639_10001625 | 3300026041 | Bacteria | 15122 |
| 444 | Ga0207639_10594919 | 3300026041 | Bacteria | 1019 |
| 445 | Ga0207639_10725371 | 3300026041 | Bacteria | 923 |
| 446 | Ga0207678_10003817 | 3300026067 | Bacteria | 13555 |
| 447 | Ga0207678_10042425 | 3300026067 | Bacteria | 3941 |
| 448 | Ga0207678_10050844 | 3300026067 | Bacteria | 3580 |
| 449 | Ga0207678_10140125 | 3300026067 | Bacteria | 2064 |
| 450 | Ga0207678_10218462 | 3300026067 | Bacteria | 1631 |
| 451 | Ga0207678_10287692 | 3300026067 | Bacteria | 1411 |
| 452 | Ga0207678_10532406 | 3300026067 | Unclassified | 1026 |
| 453 | Ga0207678_10867634 | 3300026067 | Unclassified | 798 |
| 454 | Ga0207708_10057188 | 3300026075 | Bacteria | 2976 |
| 455 | Ga0207708_10282979 | 3300026075 | Unclassified | 1344 |
| 456 | Ga0207708_11347659 | 3300026075 | Bacteria | 626 |
| 457 | Ga0207708_11601476 | 3300026075 | Unclassified | 572 |
| 458 | Ga0207702_10010293 | 3300026078 | Bacteria | 7835 |
| 459 | Ga0207641_10186133 | 3300026088 | Bacteria | 1905 |
| 460 | Ga0207641_10449683 | 3300026088 | Bacteria | 1245 |
| 461 | Ga0207641_10645128 | 3300026088 | Unclassified | 1039 |
| 462 | Ga0207648_10003597 | 3300026089 | Bacteria | 16210 |
| 463 | Ga0207648_10091008 | 3300026089 | Unclassified | 2667 |
| 464 | Ga0207648_10160787 | 3300026089 | Bacteria | 1983 |
| 465 | Ga0207648_10484456 | 3300026089 | Bacteria | 1130 |
| 466 | Ga0207676_10062089 | 3300026095 | Bacteria | 2962 |
| 467 | Ga0207676_10135373 | 3300026095 | Bacteria | 2101 |
| 468 | Ga0207676_10153286 | 3300026095 | Bacteria | 1987 |
| 469 | Ga0207674_10121473 | 3300026116 | Bacteria | 2580 |
| 470 | Ga0207674_10181032 | 3300026116 | Bacteria | 2059 |
| 471 | Ga0207675_100115533 | 3300026118 | Bacteria | 2536 |
| 472 | Ga0207675_100448188 | 3300026118 | Bacteria | 1279 |
| 473 | Ga0207675_100651884 | 3300026118 | Bacteria | 1059 |
| 474 | Ga0207675_100684903 | 3300026118 | Bacteria | 1033 |
| 475 | Ga0207683_10002113 | 3300026121 | Bacteria | 17472 |
| 476 | Ga0207683_10002565 | 3300026121 | Bacteria | 15843 |
| 477 | Ga0207683_10308607 | 3300026121 | Unclassified | 1448 |
| 478 | Ga0207698_10126716 | 3300026142 | Unclassified | 2173 |
| 479 | Ga0207428_10004183 | 3300027907 | Bacteria | 13832 |
| 480 | Ga0207428_10047845 | 3300027907 | Bacteria | 3434 |
| 481 | Ga0207428_10252871 | 3300027907 | Bacteria | 1314 |
| 482 | Ga0268266_10008392 | 3300028379 | Bacteria | 9185 |
| 483 | Ga0268265_11005841 | 3300028380 | Unclassified | 824 |
| 484 | Ga0268265_11540510 | 3300028380 | Unclassified | 669 |
| 485 | Ga0268264_10013683 | 3300028381 | Bacteria | 6679 |
| 486 | Ga0268264_10175886 | 3300028381 | Bacteria | 1940 |
| 487 | Ga0268264_10457716 | 3300028381 | Bacteria | 1237 |
| 488 | Ga0307408_100070015 | 3300031548 | Bacteria | 2589 |
| 489 | Ga0307405_10069483 | 3300031731 | Bacteria | 2258 |
| 490 | Ga0307413_10057840 | 3300031824 | Bacteria | 2373 |
| 491 | Ga0307413_10192783 | 3300031824 | Unclassified | 1464 |
| 492 | Ga0307413_10469656 | 3300031824 | Bacteria | 1003 |
| 493 | Ga0307413_10497766 | 3300031824 | Bacteria | 978 |
| 494 | Ga0307413_10782743 | 3300031824 | Unclassified | 800 |
| 495 | Ga0307410_10007757 | 3300031852 | Bacteria | 5899 |
| 496 | Ga0307410_10024534 | 3300031852 | Bacteria | 3768 |
| 497 | Ga0307406_10153838 | 3300031901 | Unclassified | 1644 |
| 498 | Ga0307406_11022886 | 3300031901 | Bacteria | 710 |
| 499 | Ga0307407_10349577 | 3300031903 | Unclassified | 1046 |
| 500 | Ga0307412_10221980 | 3300031911 | Bacteria | 1449 |
| 501 | Ga0307409_100024776 | 3300031995 | Unclassified | 4193 |
| 502 | Ga0307409_100963559 | 3300031995 | Unclassified | 869 |
| 503 | Ga0307416_100125936 | 3300032002 | Bacteria | 2294 |
| 504 | Ga0307416_100276836 | 3300032002 | Bacteria | 1652 |
| 505 | Ga0307416_100788725 | 3300032002 | Unclassified | 1045 |
| 506 | Ga0307414_10055817 | 3300032004 | Bacteria | 2767 |
| 507 | Ga0307414_10086248 | 3300032004 | Unclassified | 2316 |
| 508 | Ga0307414_11162893 | 3300032004 | Unclassified | 714 |
| 509 | Ga0307411_10022436 | 3300032005 | Bacteria | 3716 |
| 510 | Ga0307415_100122865 | 3300032126 | Bacteria | 1950 |
| 511 | Ga0307415_100526648 | 3300032126 | Bacteria | 1038 |
| 512 | Ga0373949_0203189 | 3300035090 | Bacteria | 596 |
| 513 | Ga0373941_0263286 | 3300035115 | Bacteria | 677 |
| 514 | Ga0436365_1611331 | 3300039437 | Bacteria | 619 |
| 515 | Ga0451835_0496515 | 3300041492 | Bacteria | 988 |
| 516 | Ga0451853_0326133 | 3300041512 | Bacteria | 947 |
| 517 | Ga0451853_1696582 | 3300041512 | Bacteria | 910 |
| 518 | Ga0439441_031210 | 3300042001 | Bacteria | 1033 |
| 519 | Ga0439452_086272 | 3300042010 | Unclassified | 681 |
| 520 | Ga0439454_009635 | 3300042011 | Bacteria | 1258 |
| 521 | Ga0439456_015881 | 3300042013 | Bacteria | 1574 |
| 522 | Ga0439462_0073247 | 3300042015 | Bacteria | 931 |
| 523 | Ga0450920_022472 | 3300042122 | Bacteria | 1222 |
| 524 | Ga0450923_151877 | 3300042125 | Bacteria | 561 |
| 525 | Ga0450896_001706 | 3300042133 | Bacteria | 2759 |
| 526 | Ga0439434_0106924 | 3300042435 | Bacteria | 904 |
| 527 | Ga0439444_0053144 | 3300042437 | Bacteria | 828 |
| 528 | Ga0450916_044684 | 3300042530 | Bacteria | 683 |
| 529 | Ga0439440_0085938 | 3300042993 | Bacteria | 838 |
| 530 | Ga0451576_0246809 | 3300045051 | Bacteria | 1866 |
| 531 | Ga0451576_0619941 | 3300045051 | Bacteria | 1137 |
| 532 | Ga0496100_0519463 | 3300048903 | Bacteria | 919 |
| 533 | Ga0496100_0842501 | 3300048903 | Bacteria | 719 |
| 534 | Ga0496101_0894577 | 3300048904 | Bacteria | 699 |
| 535 | Ga0496102_0122272 | 3300048905 | Unclassified | 2432 |
| 536 | Ga0496102_0226040 | 3300048905 | Unclassified | 1765 |
| 537 | Ga0496102_1334303 | 3300048905 | Bacteria | 636 |
| 538 | Ga0496103_0017377 | 3300048906 | Bacteria | 4305 |
| 539 | Ga0496103_0626475 | 3300048906 | Bacteria | 684 |
| 540 | Ga0496104_0004172 | 3300048907 | Bacteria | 12542 |
| 541 | Ga0496105_0003653 | 3300048908 | Bacteria | 11436 |
| 542 | Ga0496106_0011772 | 3300048909 | Bacteria | 6457 |
| 543 | Ga0496106_0915055 | 3300048909 | Bacteria | 692 |
| 544 | Ga0496107_0020615 | 3300048910 | Bacteria | 4657 |
| 545 | Ga0496108_0005527 | 3300048911 | Bacteria | 10225 |
| 546 | Ga0496109_0004989 | 3300048912 | Bacteria | 11082 |
| 547 | Ga0496109_0721017 | 3300048912 | Bacteria | 935 |
| 548 | Ga0496110_0018192 | 3300048913 | Bacteria | 5888 |
| 549 | Ga0496111_0018723 | 3300048914 | Bacteria | 4800 |
| 550 | Ga0496112_0000128 | 3300048915 | Bacteria | 47314 |
| 551 | Ga0496114_0222054 | 3300048917 | Bacteria | 1659 |
| 552 | Ga0496114_0357039 | 3300048917 | Bacteria | 1293 |
| 553 | Ga0496114_1240533 | 3300048917 | Bacteria | 632 |
| 554 | Ga0501036_0182159 | 3300049572 | Unclassified | 1768 |
| 555 | Ga0501037_0129549 | 3300049573 | Unclassified | 1810 |
| 556 | Ga0501038_0130154 | 3300049574 | Bacteria | 2067 |
| 557 | Ga0501039_0033391 | 3300049575 | Bacteria | 3968 |
| 558 | Ga0501040_0015014 | 3300049576 | Bacteria | 5117 |
| 559 | Ga0501041_0031027 | 3300049577 | Bacteria | 3227 |
| 560 | Ga0501042_0842776 | 3300049578 | Unclassified | 667 |
| 561 | Ga0501046_0097293 | 3300049580 | Unclassified | 2261 |
| 562 | Ga0501068_0033386 | 3300049584 | Unclassified | 3065 |
| 563 | Ga0501071_0017204 | 3300049587 | Unclassified | 4983 |
| 564 | Ga0501072_0003433 | 3300049588 | Bacteria | 11934 |
| 565 | Ga0501073_0042715 | 3300049589 | Unclassified | 3199 |
| 566 | Ga0501074_0090580 | 3300049590 | Unclassified | 2190 |
| 567 | Ga0501075_0023010 | 3300049591 | Bacteria | 4558 |
| 568 | Ga0501076_0027124 | 3300049592 | Bacteria | 4443 |
| 569 | Ga0501077_0008388 | 3300049593 | Bacteria | 6397 |
| 570 | Ga0501249_064323 | 3300049679 | Bacteria | 852 |
| 571 | Ga0501079_0018383 | 3300049741 | Bacteria | 5342 |
| 572 | Ga0501080_0078907 | 3300049742 | Bacteria | 3061 |
| 573 | Ga0501081_0004029 | 3300049743 | Bacteria | 9422 |
| 574 | Ga0501083_0476327 | 3300049744 | Unclassified | 812 |
| 575 | Ga0501044_0265258 | 3300049823 | Unclassified | 1655 |
| 576 | Ga0501045_0024719 | 3300049824 | Unclassified | 4314 |
| 577 | nmdc:mga03n38_84475_c1 | 3300050490 | Bacteria | 1499 |
| 578 | nmdc:mga00v17_122369_c1 | 3300050491 | Bacteria | 1658 |
| 579 | nmdc:mga00v17_256798_c1 | 3300050491 | Bacteria | 1133 |
| 580 | nmdc:mga0k408_254918_c1 | 3300050493 | Bacteria | 1047 |
| 581 | nmdc:mga0k408_30918_c1 | 3300050493 | Bacteria | 3055 |
| 582 | nmdc:mga0k408_609101_c1 | 3300050493 | Bacteria | 644 |
| 583 | nmdc:mga06z11_18396_c1 | 3300050494 | Bacteria | 3191 |
| 584 | nmdc:mga06z11_23683_c1 | 3300050494 | Bacteria | 2888 |
| 585 | nmdc:mga06z11_99892_c1 | 3300050494 | Unclassified | 1590 |
| 586 | nmdc:mga04h51_5574_c1 | 3300050495 | Bacteria | 3215 |
| 587 | nmdc:mga07m45_39922_c1 | 3300050496 | Bacteria | 2625 |
| 588 | nmdc:mga07m45_542089_c1 | 3300050496 | Bacteria | 673 |
| 589 | nmdc:mga05p37_103222_c1 | 3300050507 | Bacteria | 3510 |
| 590 | nmdc:mga05p37_12916_c1 | 3300050507 | Bacteria | 9988 |
| 591 | nmdc:mga05p37_61347_c1 | 3300050507 | Bacteria | 4629 |
| 592 | nmdc:mga05p37_69299_c1 | 3300050507 | Bacteria | 4338 |
| 593 | nmdc:mga05p37_728694_c1 | 3300050507 | Bacteria | 1097 |
| 594 | nmdc:mga09592_174096_c1 | 3300050508 | Unclassified | 1861 |
| 595 | nmdc:mga0qj67_269080_c1 | 3300050509 | Bacteria | 1382 |
| 596 | nmdc:mga0qj67_456656_c1 | 3300050509 | Bacteria | 1029 |
| 597 | nmdc:mga06r32_713718_c1 | 3300050510 | Bacteria | 968 |
| 598 | nmdc:mga06r32_842078_c1 | 3300050510 | Unclassified | 876 |
| 599 | nmdc:mga08y16_23043_c1 | 3300050511 | Bacteria | 6574 |
| 600 | nmdc:mga08y16_518062_c1 | 3300050511 | Bacteria | 1210 |
| 601 | nmdc:mga08y16_62039_c1 | 3300050511 | Bacteria | 3904 |
| 602 | nmdc:mga08y16_634628_c1 | 3300050511 | Bacteria | 1074 |
| 603 | nmdc:mga08y16_65605_c1 | 3300050511 | Bacteria | 3790 |
| 604 | nmdc:mga08y16_7018_c1 | 3300050511 | Bacteria | 11816 |
| 605 | nmdc:mga0n895_918166_c1 | 3300050512 | Unclassified | 860 |
| 606 | nmdc:mga0rr50_32544_c1 | 3300050513 | Bacteria | 3716 |
| 607 | nmdc:mga08x19_502107_c1 | 3300050514 | Bacteria | 856 |
| 608 | nmdc:mga0a205_156672_c1 | 3300050515 | Bacteria | 2176 |
| 609 | Ga0500568_0005753 | 3300053139 | Bacteria | 6348 |
| 610 | Ga0501084_0041431 | 3300054114 | Unclassified | 3852 |
| 611 | Ga0587073_0014554 | 3300059492 | Bacteria | 1402 |
| 612 | Ga0587080_010817 | 3300059503 | Bacteria | 1352 |
| 613 | Ga0587088_025243 | 3300059508 | Unclassified | 1024 |
| 614 | Ga0501082_0020249 | 3300060353 | Bacteria | 5734 |
| 615 | Ga0501082_1730408 | 3300060353 | Bacteria | 545 |
| 616 | Ga0530510_0674378 | 3300061734 | Unclassified | 787 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005539 | Ga0068853_101121678 | Ga0068853_1011216782 | 157 |
| 2 | 3300028380 | Ga0268265_11005841 | Ga0268265_110058411 | 157 |
| 3 | 3300026067 | Ga0207678_10532406 | Ga0207678_105324062 | 158 |
| 4 | 3300009176 | Ga0105242_11849556 | Ga0105242_118495561 | 159 |
| 5 | 3300014326 | Ga0157380_10123070 | Ga0157380_101230702 | 165 |
| 6 | 3300060353 | Ga0501082_1730408 | Ga0501082_1730408_18_518 | 166 |
| 7 | 2209111006 | 2214914668 | 2213973872 | 167 |
| 8 | 3300000043 | ARcpr5yngRDRAFT_c001452 | ARcpr5yngRDRAFT_0014523 | 167 |
| 9 | 3300000044 | ARSoilOldRDRAFT_c003721 | ARSoilOldRDRAFT_0037212 | 167 |
| 10 | 3300000652 | ARCol0yngRDRAFT_1001318 | ARCol0yngRDRAFT_10013183 | 167 |
| 11 | 3300005288 | Ga0065714_10108127 | Ga0065714_101081271 | 167 |
| 12 | 3300005290 | Ga0065712_10015439 | Ga0065712_100154392 | 167 |
| 13 | 3300005290 | Ga0065712_10071300 | Ga0065712_100713003 | 167 |
| 14 | 3300005293 | Ga0065715_10039893 | Ga0065715_100398932 | 167 |
| 15 | 3300005293 | Ga0065715_10171781 | Ga0065715_101717812 | 167 |
| 16 | 3300005328 | Ga0070676_10317341 | Ga0070676_103173412 | 167 |
| 17 | 3300005328 | Ga0070676_10339610 | Ga0070676_103396102 | 167 |
| 18 | 3300005329 | Ga0070683_100001000 | Ga0070683_10000100017 | 167 |
| 19 | 3300005329 | Ga0070683_100065612 | Ga0070683_1000656122 | 167 |
| 20 | 3300005329 | Ga0070683_101221949 | Ga0070683_1012219491 | 167 |
| 21 | 3300005330 | Ga0070690_100014476 | Ga0070690_1000144764 | 167 |
| 22 | 3300005331 | Ga0070670_100109640 | Ga0070670_1001096402 | 167 |
| 23 | 3300005331 | Ga0070670_100140026 | Ga0070670_1001400263 | 167 |
| 24 | 3300005334 | Ga0068869_100554294 | Ga0068869_1005542942 | 167 |
| 25 | 3300005335 | Ga0070666_10332195 | Ga0070666_103321952 | 167 |
| 26 | 3300005336 | Ga0070680_100030389 | Ga0070680_1000303895 | 167 |
| 27 | 3300005336 | Ga0070680_100338788 | Ga0070680_1003387881 | 167 |
| 28 | 3300005336 | Ga0070680_100373260 | Ga0070680_1003732601 | 167 |
| 29 | 3300005336 | Ga0070680_101563442 | Ga0070680_1015634421 | 167 |
| 30 | 3300005337 | Ga0070682_100018353 | Ga0070682_1000183534 | 167 |
| 31 | 3300005338 | Ga0068868_100609508 | Ga0068868_1006095082 | 167 |
| 32 | 3300005341 | Ga0070691_10015617 | Ga0070691_100156175 | 167 |
| 33 | 3300005341 | Ga0070691_10300663 | Ga0070691_103006631 | 167 |
| 34 | 3300005343 | Ga0070687_100038930 | Ga0070687_1000389303 | 167 |
| 35 | 3300005343 | Ga0070687_100340490 | Ga0070687_1003404902 | 167 |
| 36 | 3300005344 | Ga0070661_100013334 | Ga0070661_1000133345 | 167 |
| 37 | 3300005345 | Ga0070692_10007733 | Ga0070692_100077334 | 167 |
| 38 | 3300005347 | Ga0070668_100063226 | Ga0070668_1000632262 | 167 |
| 39 | 3300005347 | Ga0070668_100244092 | Ga0070668_1002440922 | 167 |
| 40 | 3300005347 | Ga0070668_100291494 | Ga0070668_1002914942 | 167 |
| 41 | 3300005353 | Ga0070669_100083179 | Ga0070669_1000831791 | 167 |
| 42 | 3300005353 | Ga0070669_101112315 | Ga0070669_1011123151 | 167 |
| 43 | 3300005354 | Ga0070675_100387460 | Ga0070675_1003874602 | 167 |
| 44 | 3300005355 | Ga0070671_100119327 | Ga0070671_1001193272 | 167 |
| 45 | 3300005355 | Ga0070671_100640755 | Ga0070671_1006407551 | 167 |
| 46 | 3300005364 | Ga0070673_100153819 | Ga0070673_1001538192 | 167 |
| 47 | 3300005364 | Ga0070673_101025961 | Ga0070673_1010259611 | 167 |
| 48 | 3300005366 | Ga0070659_100065634 | Ga0070659_1000656343 | 167 |
| 49 | 3300005367 | Ga0070667_100193162 | Ga0070667_1001931623 | 167 |
| 50 | 3300005367 | Ga0070667_100591504 | Ga0070667_1005915042 | 167 |
| 51 | 3300005438 | Ga0070701_10648344 | Ga0070701_106483441 | 167 |
| 52 | 3300005439 | Ga0070711_100417246 | Ga0070711_1004172461 | 167 |
| 53 | 3300005441 | Ga0070700_100015909 | Ga0070700_1000159094 | 167 |
| 54 | 3300005441 | Ga0070700_100056930 | Ga0070700_1000569303 | 167 |
| 55 | 3300005441 | Ga0070700_100598304 | Ga0070700_1005983041 | 167 |
| 56 | 3300005441 | Ga0070700_100602759 | Ga0070700_1006027591 | 167 |
| 57 | 3300005441 | Ga0070700_100902370 | Ga0070700_1009023701 | 167 |
| 58 | 3300005444 | Ga0070694_100171006 | Ga0070694_1001710062 | 167 |
| 59 | 3300005455 | Ga0070663_100028201 | Ga0070663_1000282013 | 167 |
| 60 | 3300005455 | Ga0070663_101521468 | Ga0070663_1015214681 | 167 |
| 61 | 3300005456 | Ga0070678_100276767 | Ga0070678_1002767671 | 167 |
| 62 | 3300005456 | Ga0070678_100885733 | Ga0070678_1008857331 | 167 |
| 63 | 3300005457 | Ga0070662_100026981 | Ga0070662_1000269812 | 167 |
| 64 | 3300005457 | Ga0070662_100080277 | Ga0070662_1000802772 | 167 |
| 65 | 3300005457 | Ga0070662_100089958 | Ga0070662_1000899582 | 167 |
| 66 | 3300005458 | Ga0070681_10075157 | Ga0070681_100751575 | 167 |
| 67 | 3300005458 | Ga0070681_10337799 | Ga0070681_103377991 | 167 |
| 68 | 3300005459 | Ga0068867_100254943 | Ga0068867_1002549432 | 167 |
| 69 | 3300005459 | Ga0068867_100814593 | Ga0068867_1008145932 | 167 |
| 70 | 3300005466 | Ga0070685_10091484 | Ga0070685_100914842 | 167 |
| 71 | 3300005518 | Ga0070699_100568064 | Ga0070699_1005680641 | 167 |
| 72 | 3300005530 | Ga0070679_100065393 | Ga0070679_1000653934 | 167 |
| 73 | 3300005535 | Ga0070684_100002014 | Ga0070684_1000020146 | 167 |
| 74 | 3300005535 | Ga0070684_100563507 | Ga0070684_1005635071 | 167 |
| 75 | 3300005539 | Ga0068853_100989011 | Ga0068853_1009890111 | 167 |
| 76 | 3300005539 | Ga0068853_101049058 | Ga0068853_1010490582 | 167 |
| 77 | 3300005543 | Ga0070672_100020589 | Ga0070672_1000205894 | 167 |
| 78 | 3300005543 | Ga0070672_100718002 | Ga0070672_1007180022 | 167 |
| 79 | 3300005544 | Ga0070686_100107038 | Ga0070686_1001070382 | 167 |
| 80 | 3300005544 | Ga0070686_100283359 | Ga0070686_1002833592 | 167 |
| 81 | 3300005545 | Ga0070695_100042162 | Ga0070695_1000421623 | 167 |
| 82 | 3300005546 | Ga0070696_100161749 | Ga0070696_1001617493 | 167 |
| 83 | 3300005547 | Ga0070693_100078459 | Ga0070693_1000784592 | 167 |
| 84 | 3300005548 | Ga0070665_101764352 | Ga0070665_1017643521 | 167 |
| 85 | 3300005563 | Ga0068855_101362343 | Ga0068855_1013623431 | 167 |
| 86 | 3300005564 | Ga0070664_100001191 | Ga0070664_10000119130 | 167 |
| 87 | 3300005564 | Ga0070664_100010322 | Ga0070664_1000103226 | 167 |
| 88 | 3300005564 | Ga0070664_100152079 | Ga0070664_1001520792 | 167 |
| 89 | 3300005564 | Ga0070664_100446563 | Ga0070664_1004465631 | 167 |
| 90 | 3300005577 | Ga0068857_100103226 | Ga0068857_1001032263 | 167 |
| 91 | 3300005577 | Ga0068857_100118739 | Ga0068857_1001187392 | 167 |
| 92 | 3300005578 | Ga0068854_100911735 | Ga0068854_1009117351 | 167 |
| 93 | 3300005614 | Ga0068856_100557339 | Ga0068856_1005573391 | 167 |
| 94 | 3300005615 | Ga0070702_100051333 | Ga0070702_1000513332 | 167 |
| 95 | 3300005617 | Ga0068859_100299917 | Ga0068859_1002999172 | 167 |
| 96 | 3300005618 | Ga0068864_100039795 | Ga0068864_1000397954 | 167 |
| 97 | 3300005618 | Ga0068864_100044705 | Ga0068864_1000447052 | 167 |
| 98 | 3300005618 | Ga0068864_100386575 | Ga0068864_1003865752 | 167 |
| 99 | 3300005718 | Ga0068866_10293293 | Ga0068866_102932932 | 167 |
| 100 | 3300005718 | Ga0068866_10362316 | Ga0068866_103623162 | 167 |
| 101 | 3300005718 | Ga0068866_10613316 | Ga0068866_106133161 | 167 |
| 102 | 3300005719 | Ga0068861_100113855 | Ga0068861_1001138553 | 167 |
| 103 | 3300005719 | Ga0068861_100253547 | Ga0068861_1002535472 | 167 |
| 104 | 3300005719 | Ga0068861_100368083 | Ga0068861_1003680833 | 167 |
| 105 | 3300005840 | Ga0068870_10502920 | Ga0068870_105029202 | 167 |
| 106 | 3300005841 | Ga0068863_100851760 | Ga0068863_1008517601 | 167 |
| 107 | 3300005842 | Ga0068858_100518474 | Ga0068858_1005184741 | 167 |
| 108 | 3300005842 | Ga0068858_100828281 | Ga0068858_1008282811 | 167 |
| 109 | 3300005843 | Ga0068860_100158474 | Ga0068860_1001584742 | 167 |
| 110 | 3300005844 | Ga0068862_100025864 | Ga0068862_1000258643 | 167 |
| 111 | 3300006058 | Ga0075432_10002038 | Ga0075432_100020385 | 167 |
| 112 | 3300006058 | Ga0075432_10116839 | Ga0075432_101168392 | 167 |
| 113 | 3300006844 | Ga0075428_100021566 | Ga0075428_1000215664 | 167 |
| 114 | 3300006844 | Ga0075428_100204960 | Ga0075428_1002049602 | 167 |
| 115 | 3300006852 | Ga0075433_10140646 | Ga0075433_101406463 | 167 |
| 116 | 3300006871 | Ga0075434_100976746 | Ga0075434_1009767461 | 167 |
| 117 | 3300006880 | Ga0075429_100633856 | Ga0075429_1006338562 | 167 |
| 118 | 3300006881 | Ga0068865_100065405 | Ga0068865_1000654052 | 167 |
| 119 | 3300006881 | Ga0068865_100153580 | Ga0068865_1001535802 | 167 |
| 120 | 3300006931 | Ga0097620_100299920 | Ga0097620_1002999202 | 167 |
| 121 | 3300007076 | Ga0075435_100006040 | Ga0075435_1000060407 | 167 |
| 122 | 3300009094 | Ga0111539_10080502 | Ga0111539_100805023 | 167 |
| 123 | 3300009094 | Ga0111539_10193964 | Ga0111539_101939642 | 167 |
| 124 | 3300009094 | Ga0111539_10484912 | Ga0111539_104849122 | 167 |
| 125 | 3300009098 | Ga0105245_10015486 | Ga0105245_100154865 | 167 |
| 126 | 3300009147 | Ga0114129_10019183 | Ga0114129_100191835 | 167 |
| 127 | 3300009147 | Ga0114129_10365854 | Ga0114129_103658542 | 167 |
| 128 | 3300009147 | Ga0114129_10579456 | Ga0114129_105794563 | 167 |
| 129 | 3300009148 | Ga0105243_10029240 | Ga0105243_100292403 | 167 |
| 130 | 3300009148 | Ga0105243_10065131 | Ga0105243_100651314 | 167 |
| 131 | 3300009148 | Ga0105243_10124002 | Ga0105243_101240022 | 167 |
| 132 | 3300009174 | Ga0105241_10034415 | Ga0105241_100344153 | 167 |
| 133 | 3300009176 | Ga0105242_10012710 | Ga0105242_100127104 | 167 |
| 134 | 3300009176 | Ga0105242_10024384 | Ga0105242_100243844 | 167 |
| 135 | 3300009177 | Ga0105248_10003724 | Ga0105248_100037243 | 167 |
| 136 | 3300009177 | Ga0105248_10062496 | Ga0105248_100624964 | 167 |
| 137 | 3300009177 | Ga0105248_10684367 | Ga0105248_106843671 | 167 |
| 138 | 3300009553 | Ga0105249_10037113 | Ga0105249_100371132 | 167 |
| 139 | 3300009553 | Ga0105249_10257340 | Ga0105249_102573403 | 167 |
| 140 | 3300009553 | Ga0105249_10346235 | Ga0105249_103462352 | 167 |
| 141 | 3300010375 | Ga0105239_10112907 | Ga0105239_101129073 | 167 |
| 142 | 3300010375 | Ga0105239_10289132 | Ga0105239_102891321 | 167 |
| 143 | 3300010375 | Ga0105239_11534316 | Ga0105239_115343161 | 167 |
| 144 | 3300011119 | Ga0105246_10216157 | Ga0105246_102161572 | 167 |
| 145 | 3300012482 | Ga0157318_1000751 | Ga0157318_10007512 | 167 |
| 146 | 3300012497 | Ga0157319_1014951 | Ga0157319_10149511 | 167 |
| 147 | 3300012508 | Ga0157315_1027216 | Ga0157315_10272161 | 167 |
| 148 | 3300013102 | Ga0157371_10585129 | Ga0157371_105851291 | 167 |
| 149 | 3300013296 | Ga0157374_10024270 | Ga0157374_100242705 | 167 |
| 150 | 3300013297 | Ga0157378_10268321 | Ga0157378_102683212 | 167 |
| 151 | 3300013306 | Ga0163162_10295303 | Ga0163162_102953031 | 167 |
| 152 | 3300013307 | Ga0157372_10088937 | Ga0157372_100889374 | 167 |
| 153 | 3300013308 | Ga0157375_10377729 | Ga0157375_103777292 | 167 |
| 154 | 3300013308 | Ga0157375_10885692 | Ga0157375_108856922 | 167 |
| 155 | 3300014325 | Ga0163163_10020594 | Ga0163163_100205944 | 167 |
| 156 | 3300014325 | Ga0163163_10047937 | Ga0163163_100479373 | 167 |
| 157 | 3300014326 | Ga0157380_10006025 | Ga0157380_100060259 | 167 |
| 158 | 3300014326 | Ga0157380_10130260 | Ga0157380_101302602 | 167 |
| 159 | 3300014745 | Ga0157377_10121566 | Ga0157377_101215663 | 167 |
| 160 | 3300014968 | Ga0157379_11094418 | Ga0157379_110944181 | 167 |
| 161 | 3300020077 | Ga0206351_10940915 | Ga0206351_109409151 | 167 |
| 162 | 3300020080 | Ga0206350_11192982 | Ga0206350_111929821 | 167 |
| 163 | 3300025893 | Ga0207682_10135441 | Ga0207682_101354412 | 167 |
| 164 | 3300025901 | Ga0207688_10019315 | Ga0207688_100193153 | 167 |
| 165 | 3300025903 | Ga0207680_10021092 | Ga0207680_100210923 | 167 |
| 166 | 3300025904 | Ga0207647_10161473 | Ga0207647_101614732 | 167 |
| 167 | 3300025907 | Ga0207645_10113431 | Ga0207645_101134313 | 167 |
| 168 | 3300025907 | Ga0207645_10118507 | Ga0207645_101185072 | 167 |
| 169 | 3300025908 | Ga0207643_10450280 | Ga0207643_104502801 | 167 |
| 170 | 3300025912 | Ga0207707_10060647 | Ga0207707_100606475 | 167 |
| 171 | 3300025917 | Ga0207660_10054061 | Ga0207660_100540612 | 167 |
| 172 | 3300025917 | Ga0207660_10369486 | Ga0207660_103694862 | 167 |
| 173 | 3300025918 | Ga0207662_10034269 | Ga0207662_100342692 | 167 |
| 174 | 3300025920 | Ga0207649_10434050 | Ga0207649_104340501 | 167 |
| 175 | 3300025920 | Ga0207649_10709383 | Ga0207649_107093832 | 167 |
| 176 | 3300025920 | Ga0207649_11312283 | Ga0207649_113122831 | 167 |
| 177 | 3300025923 | Ga0207681_10178947 | Ga0207681_101789472 | 167 |
| 178 | 3300025923 | Ga0207681_10640829 | Ga0207681_106408291 | 167 |
| 179 | 3300025923 | Ga0207681_10818963 | Ga0207681_108189632 | 167 |
| 180 | 3300025925 | Ga0207650_10013311 | Ga0207650_100133119 | 167 |
| 181 | 3300025925 | Ga0207650_10030949 | Ga0207650_100309492 | 167 |
| 182 | 3300025926 | Ga0207659_10338728 | Ga0207659_103387281 | 167 |
| 183 | 3300025927 | Ga0207687_10138613 | Ga0207687_101386132 | 167 |
| 184 | 3300025931 | Ga0207644_10125946 | Ga0207644_101259462 | 167 |
| 185 | 3300025932 | Ga0207690_10304407 | Ga0207690_103044071 | 167 |
| 186 | 3300025933 | Ga0207706_10028982 | Ga0207706_100289824 | 167 |
| 187 | 3300025933 | Ga0207706_10096007 | Ga0207706_100960072 | 167 |
| 188 | 3300025933 | Ga0207706_10103939 | Ga0207706_101039392 | 167 |
| 189 | 3300025934 | Ga0207686_10107010 | Ga0207686_101070102 | 167 |
| 190 | 3300025935 | Ga0207709_10049387 | Ga0207709_100493874 | 167 |
| 191 | 3300025935 | Ga0207709_10072574 | Ga0207709_100725742 | 167 |
| 192 | 3300025936 | Ga0207670_10232005 | Ga0207670_102320052 | 167 |
| 193 | 3300025936 | Ga0207670_10895219 | Ga0207670_108952191 | 167 |
| 194 | 3300025938 | Ga0207704_10027688 | Ga0207704_100276883 | 167 |
| 195 | 3300025940 | Ga0207691_10086466 | Ga0207691_100864662 | 167 |
| 196 | 3300025940 | Ga0207691_10224439 | Ga0207691_102244392 | 167 |
| 197 | 3300025941 | Ga0207711_10050313 | Ga0207711_100503134 | 167 |
| 198 | 3300025942 | Ga0207689_10571856 | Ga0207689_105718561 | 167 |
| 199 | 3300025944 | Ga0207661_10001718 | Ga0207661_1000171818 | 167 |
| 200 | 3300025944 | Ga0207661_10110033 | Ga0207661_101100333 | 167 |
| 201 | 3300025945 | Ga0207679_10048221 | Ga0207679_100482212 | 167 |
| 202 | 3300025945 | Ga0207679_10162611 | Ga0207679_101626112 | 167 |
| 203 | 3300025945 | Ga0207679_10341994 | Ga0207679_103419942 | 167 |
| 204 | 3300025949 | Ga0207667_10379941 | Ga0207667_103799413 | 167 |
| 205 | 3300025949 | Ga0207667_11083921 | Ga0207667_110839211 | 167 |
| 206 | 3300025960 | Ga0207651_10125255 | Ga0207651_101252554 | 167 |
| 207 | 3300025960 | Ga0207651_10270808 | Ga0207651_102708082 | 167 |
| 208 | 3300025961 | Ga0207712_10032506 | Ga0207712_100325063 | 167 |
| 209 | 3300025961 | Ga0207712_10442250 | Ga0207712_104422502 | 167 |
| 210 | 3300025972 | Ga0207668_10260440 | Ga0207668_102604402 | 167 |
| 211 | 3300025981 | Ga0207640_10249434 | Ga0207640_102494342 | 167 |
| 212 | 3300025981 | Ga0207640_10318519 | Ga0207640_103185192 | 167 |
| 213 | 3300025986 | Ga0207658_10018258 | Ga0207658_100182582 | 167 |
| 214 | 3300026023 | Ga0207677_10569688 | Ga0207677_105696882 | 167 |
| 215 | 3300026035 | Ga0207703_10167861 | Ga0207703_101678612 | 167 |
| 216 | 3300026035 | Ga0207703_11303603 | Ga0207703_113036031 | 167 |
| 217 | 3300026041 | Ga0207639_10594919 | Ga0207639_105949192 | 167 |
| 218 | 3300026067 | Ga0207678_10042425 | Ga0207678_100424251 | 167 |
| 219 | 3300026067 | Ga0207678_10218462 | Ga0207678_102184622 | 167 |
| 220 | 3300026075 | Ga0207708_10057188 | Ga0207708_100571882 | 167 |
| 221 | 3300026075 | Ga0207708_10282979 | Ga0207708_102829793 | 167 |
| 222 | 3300026075 | Ga0207708_11601476 | Ga0207708_116014761 | 167 |
| 223 | 3300026089 | Ga0207648_10160787 | Ga0207648_101607872 | 167 |
| 224 | 3300026089 | Ga0207648_10484456 | Ga0207648_104844562 | 167 |
| 225 | 3300026095 | Ga0207676_10153286 | Ga0207676_101532861 | 167 |
| 226 | 3300026116 | Ga0207674_10121473 | Ga0207674_101214732 | 167 |
| 227 | 3300026116 | Ga0207674_10181032 | Ga0207674_101810322 | 167 |
| 228 | 3300027907 | Ga0207428_10004183 | Ga0207428_100041839 | 167 |
| 229 | 3300027907 | Ga0207428_10047845 | Ga0207428_100478453 | 167 |
| 230 | 3300028380 | Ga0268265_11540510 | Ga0268265_115405101 | 167 |
| 231 | 3300028381 | Ga0268264_10457716 | Ga0268264_104577162 | 167 |
| 232 | 3300031731 | Ga0307405_10069483 | Ga0307405_100694832 | 167 |
| 233 | 3300031824 | Ga0307413_10057840 | Ga0307413_100578402 | 167 |
| 234 | 3300031824 | Ga0307413_10497766 | Ga0307413_104977662 | 167 |
| 235 | 3300031852 | Ga0307410_10024534 | Ga0307410_100245344 | 167 |
| 236 | 3300031901 | Ga0307406_10153838 | Ga0307406_101538381 | 167 |
| 237 | 3300031903 | Ga0307407_10349577 | Ga0307407_103495771 | 167 |
| 238 | 3300031911 | Ga0307412_10221980 | Ga0307412_102219802 | 167 |
| 239 | 3300031995 | Ga0307409_100963559 | Ga0307409_1009635591 | 167 |
| 240 | 3300032002 | Ga0307416_100125936 | Ga0307416_1001259361 | 167 |
| 241 | 3300032002 | Ga0307416_100276836 | Ga0307416_1002768361 | 167 |
| 242 | 3300032004 | Ga0307414_10055817 | Ga0307414_100558173 | 167 |
| 243 | 3300032004 | Ga0307414_11162893 | Ga0307414_111628931 | 167 |
| 244 | 3300032005 | Ga0307411_10022436 | Ga0307411_100224362 | 167 |
| 245 | 3300032126 | Ga0307415_100122865 | Ga0307415_1001228652 | 167 |
| 246 | 3300035090 | Ga0373949_0203189 | Ga0373949_0203189_57_560 | 167 |
| 247 | 3300035115 | Ga0373941_0263286 | Ga0373941_0263286_82_585 | 167 |
| 248 | 3300042001 | Ga0439441_031210 | Ga0439441_031210_223_726 | 167 |
| 249 | 3300042011 | Ga0439454_009635 | Ga0439454_009635_163_666 | 167 |
| 250 | 3300042015 | Ga0439462_0073247 | Ga0439462_0073247_381_884 | 167 |
| 251 | 3300042122 | Ga0450920_022472 | Ga0450920_022472_359_886 | 167 |
| 252 | 3300042125 | Ga0450923_151877 | Ga0450923_151877_21_524 | 167 |
| 253 | 3300042133 | Ga0450896_001706 | Ga0450896_001706_195_722 | 167 |
| 254 | 3300042435 | Ga0439434_0106924 | Ga0439434_0106924_232_735 | 167 |
| 255 | 3300042437 | Ga0439444_0053144 | Ga0439444_0053144_164_667 | 167 |
| 256 | 3300042993 | Ga0439440_0085938 | Ga0439440_0085938_12_515 | 167 |
| 257 | 3300045051 | Ga0451576_0246809 | Ga0451576_0246809_1343_1846 | 167 |
| 258 | 3300045051 | Ga0451576_0619941 | Ga0451576_0619941_211_714 | 167 |
| 259 | 3300048903 | Ga0496100_0519463 | Ga0496100_0519463_320_823 | 167 |
| 260 | 3300048905 | Ga0496102_1334303 | Ga0496102_1334303_81_584 | 167 |
| 261 | 3300048906 | Ga0496103_0626475 | Ga0496103_0626475_69_572 | 167 |
| 262 | 3300048907 | Ga0496104_0004172 | Ga0496104_0004172_11448_11951 | 167 |
| 263 | 3300048908 | Ga0496105_0003653 | Ga0496105_0003653_1725_2228 | 167 |
| 264 | 3300048909 | Ga0496106_0915055 | Ga0496106_0915055_83_586 | 167 |
| 265 | 3300048911 | Ga0496108_0005527 | Ga0496108_0005527_7912_8415 | 167 |
| 266 | 3300048912 | Ga0496109_0004989 | Ga0496109_0004989_88_591 | 167 |
| 267 | 3300048913 | Ga0496110_0018192 | Ga0496110_0018192_3733_4236 | 167 |
| 268 | 3300048914 | Ga0496111_0018723 | Ga0496111_0018723_652_1155 | 167 |
| 269 | 3300048915 | Ga0496112_0000128 | Ga0496112_0000128_21380_21883 | 167 |
| 270 | 3300048917 | Ga0496114_0357039 | Ga0496114_0357039_387_890 | 167 |
| 271 | 3300048917 | Ga0496114_1240533 | Ga0496114_1240533_53_556 | 167 |
| 272 | 3300049679 | Ga0501249_064323 | Ga0501249_064323_19_522 | 167 |
| 273 | 3300050507 | nmdc:mga05p37_12916_c1 | nmdc:mga05p37_12916_c1_7782_8285 | 167 |
| 274 | 3300050507 | nmdc:mga05p37_61347_c1 | nmdc:mga05p37_61347_c1_3099_3602 | 167 |
| 275 | 3300050507 | nmdc:mga05p37_69299_c1 | nmdc:mga05p37_69299_c1_328_831 | 167 |
| 276 | 3300050507 | nmdc:mga05p37_728694_c1 | nmdc:mga05p37_728694_c1_313_816 | 167 |
| 277 | 3300050509 | nmdc:mga0qj67_269080_c1 | nmdc:mga0qj67_269080_c1_84_587 | 167 |
| 278 | 3300050509 | nmdc:mga0qj67_456656_c1 | nmdc:mga0qj67_456656_c1_341_844 | 167 |
| 279 | 3300050510 | nmdc:mga06r32_713718_c1 | nmdc:mga06r32_713718_c1_28_531 | 167 |
| 280 | 3300050511 | nmdc:mga08y16_23043_c1 | nmdc:mga08y16_23043_c1_2309_2812 | 167 |
| 281 | 3300050511 | nmdc:mga08y16_62039_c1 | nmdc:mga08y16_62039_c1_1053_1556 | 167 |
| 282 | 3300050511 | nmdc:mga08y16_65605_c1 | nmdc:mga08y16_65605_c1_1293_1796 | 167 |
| 283 | 3300050511 | nmdc:mga08y16_7018_c1 | nmdc:mga08y16_7018_c1_9773_10276 | 167 |
| 284 | 3300050512 | nmdc:mga0n895_918166_c1 | nmdc:mga0n895_918166_c1_38_541 | 167 |
| 285 | 3300050513 | nmdc:mga0rr50_32544_c1 | nmdc:mga0rr50_32544_c1_344_847 | 167 |
| 286 | 3300050514 | nmdc:mga08x19_502107_c1 | nmdc:mga08x19_502107_c1_267_770 | 167 |
| 287 | 3300050515 | nmdc:mga0a205_156672_c1 | nmdc:mga0a205_156672_c1_779_1282 | 167 |
| 288 | 3300059492 | Ga0587073_0014554 | Ga0587073_0014554_494_997 | 167 |
| 289 | 3300059503 | Ga0587080_010817 | Ga0587080_010817_399_902 | 167 |
| 290 | 3300059508 | Ga0587088_025243 | Ga0587088_025243_114_617 | 167 |
| 291 | 3300005327 | Ga0070658_11383248 | Ga0070658_113832481 | 168 |
| 292 | 3300005328 | Ga0070676_10001487 | Ga0070676_100014873 | 168 |
| 293 | 3300005330 | Ga0070690_100046096 | Ga0070690_1000460963 | 168 |
| 294 | 3300005330 | Ga0070690_100509954 | Ga0070690_1005099542 | 168 |
| 295 | 3300005331 | Ga0070670_100043521 | Ga0070670_1000435213 | 168 |
| 296 | 3300005331 | Ga0070670_101202757 | Ga0070670_1012027571 | 168 |
| 297 | 3300005334 | Ga0068869_100015138 | Ga0068869_1000151381 | 168 |
| 298 | 3300005335 | Ga0070666_10019278 | Ga0070666_100192784 | 168 |
| 299 | 3300005335 | Ga0070666_10020885 | Ga0070666_100208853 | 168 |
| 300 | 3300005335 | Ga0070666_10460252 | Ga0070666_104602522 | 168 |
| 301 | 3300005338 | Ga0068868_100055228 | Ga0068868_1000552282 | 168 |
| 302 | 3300005339 | Ga0070660_100003048 | Ga0070660_1000030485 | 168 |
| 303 | 3300005340 | Ga0070689_100035358 | Ga0070689_1000353582 | 168 |
| 304 | 3300005345 | Ga0070692_10502139 | Ga0070692_105021392 | 168 |
| 305 | 3300005347 | Ga0070668_100585634 | Ga0070668_1005856341 | 168 |
| 306 | 3300005353 | Ga0070669_100004979 | Ga0070669_1000049796 | 168 |
| 307 | 3300005353 | Ga0070669_100095343 | Ga0070669_1000953432 | 168 |
| 308 | 3300005354 | Ga0070675_100028143 | Ga0070675_1000281433 | 168 |
| 309 | 3300005355 | Ga0070671_100010564 | Ga0070671_1000105646 | 168 |
| 310 | 3300005356 | Ga0070674_100007020 | Ga0070674_1000070205 | 168 |
| 311 | 3300005356 | Ga0070674_100405551 | Ga0070674_1004055512 | 168 |
| 312 | 3300005364 | Ga0070673_100004148 | Ga0070673_1000041487 | 168 |
| 313 | 3300005364 | Ga0070673_100007827 | Ga0070673_1000078274 | 168 |
| 314 | 3300005364 | Ga0070673_100252461 | Ga0070673_1002524612 | 168 |
| 315 | 3300005365 | Ga0070688_100047455 | Ga0070688_1000474553 | 168 |
| 316 | 3300005366 | Ga0070659_100000725 | Ga0070659_10000072517 | 168 |
| 317 | 3300005367 | Ga0070667_100011331 | Ga0070667_1000113313 | 168 |
| 318 | 3300005367 | Ga0070667_100382699 | Ga0070667_1003826992 | 168 |
| 319 | 3300005455 | Ga0070663_100031144 | Ga0070663_1000311443 | 168 |
| 320 | 3300005455 | Ga0070663_100420451 | Ga0070663_1004204511 | 168 |
| 321 | 3300005456 | Ga0070678_100198527 | Ga0070678_1001985271 | 168 |
| 322 | 3300005457 | Ga0070662_100002254 | Ga0070662_1000022549 | 168 |
| 323 | 3300005458 | Ga0070681_10056134 | Ga0070681_100561344 | 168 |
| 324 | 3300005459 | Ga0068867_100002587 | Ga0068867_1000025877 | 168 |
| 325 | 3300005530 | Ga0070679_100287104 | Ga0070679_1002871043 | 168 |
| 326 | 3300005535 | Ga0070684_100011230 | Ga0070684_1000112303 | 168 |
| 327 | 3300005539 | Ga0068853_100015152 | Ga0068853_1000151523 | 168 |
| 328 | 3300005543 | Ga0070672_100057584 | Ga0070672_1000575844 | 168 |
| 329 | 3300005544 | Ga0070686_100000375 | Ga0070686_10000037521 | 168 |
| 330 | 3300005548 | Ga0070665_100010852 | Ga0070665_1000108528 | 168 |
| 331 | 3300005563 | Ga0068855_100022327 | Ga0068855_1000223275 | 168 |
| 332 | 3300005564 | Ga0070664_100000114 | Ga0070664_10000011430 | 168 |
| 333 | 3300005578 | Ga0068854_100012913 | Ga0068854_1000129135 | 168 |
| 334 | 3300005578 | Ga0068854_100231819 | Ga0068854_1002318193 | 168 |
| 335 | 3300005614 | Ga0068856_100007822 | Ga0068856_10000782211 | 168 |
| 336 | 3300005615 | Ga0070702_100240139 | Ga0070702_1002401391 | 168 |
| 337 | 3300005616 | Ga0068852_100152956 | Ga0068852_1001529562 | 168 |
| 338 | 3300005617 | Ga0068859_100011781 | Ga0068859_1000117815 | 168 |
| 339 | 3300005618 | Ga0068864_100315555 | Ga0068864_1003155552 | 168 |
| 340 | 3300005718 | Ga0068866_10089598 | Ga0068866_100895981 | 168 |
| 341 | 3300005719 | Ga0068861_100979376 | Ga0068861_1009793761 | 168 |
| 342 | 3300005834 | Ga0068851_10147618 | Ga0068851_101476182 | 168 |
| 343 | 3300005834 | Ga0068851_10586971 | Ga0068851_105869711 | 168 |
| 344 | 3300005841 | Ga0068863_100032965 | Ga0068863_1000329653 | 168 |
| 345 | 3300005842 | Ga0068858_100010864 | Ga0068858_1000108643 | 168 |
| 346 | 3300005843 | Ga0068860_100009059 | Ga0068860_1000090597 | 168 |
| 347 | 3300005843 | Ga0068860_100571045 | Ga0068860_1005710452 | 168 |
| 348 | 3300006237 | Ga0097621_100793336 | Ga0097621_1007933362 | 168 |
| 349 | 3300006358 | Ga0068871_100001944 | Ga0068871_1000019447 | 168 |
| 350 | 3300006881 | Ga0068865_100013065 | Ga0068865_1000130655 | 168 |
| 351 | 3300006931 | Ga0097620_100011782 | Ga0097620_1000117826 | 168 |
| 352 | 3300009177 | Ga0105248_10113195 | Ga0105248_101131955 | 168 |
| 353 | 3300009177 | Ga0105248_10698889 | Ga0105248_106988892 | 168 |
| 354 | 3300009551 | Ga0105238_10271288 | Ga0105238_102712882 | 168 |
| 355 | 3300009553 | Ga0105249_10124466 | Ga0105249_101244663 | 168 |
| 356 | 3300013100 | Ga0157373_10004088 | Ga0157373_100040889 | 168 |
| 357 | 3300013102 | Ga0157371_10006712 | Ga0157371_100067127 | 168 |
| 358 | 3300013296 | Ga0157374_10005208 | Ga0157374_100052087 | 168 |
| 359 | 3300013297 | Ga0157378_10169969 | Ga0157378_101699693 | 168 |
| 360 | 3300013306 | Ga0163162_10022490 | Ga0163162_100224903 | 168 |
| 361 | 3300013307 | Ga0157372_10008721 | Ga0157372_100087219 | 168 |
| 362 | 3300014325 | Ga0163163_11478215 | Ga0163163_114782151 | 168 |
| 363 | 3300014968 | Ga0157379_10004109 | Ga0157379_100041095 | 168 |
| 364 | 3300014969 | Ga0157376_10010996 | Ga0157376_100109968 | 168 |
| 365 | 3300014969 | Ga0157376_10430592 | Ga0157376_104305922 | 168 |
| 366 | 3300017792 | Ga0163161_10147057 | Ga0163161_101470573 | 168 |
| 367 | 3300025290 | Ga0207673_1049399 | Ga0207673_10493991 | 168 |
| 368 | 3300025315 | Ga0207697_10041412 | Ga0207697_100414122 | 168 |
| 369 | 3300025903 | Ga0207680_10003033 | Ga0207680_100030333 | 168 |
| 370 | 3300025903 | Ga0207680_10050528 | Ga0207680_100505282 | 168 |
| 371 | 3300025903 | Ga0207680_10519998 | Ga0207680_105199982 | 168 |
| 372 | 3300025907 | Ga0207645_10002100 | Ga0207645_1000210015 | 168 |
| 373 | 3300025908 | Ga0207643_10407083 | Ga0207643_104070832 | 168 |
| 374 | 3300025909 | Ga0207705_11003546 | Ga0207705_110035461 | 168 |
| 375 | 3300025912 | Ga0207707_10363187 | Ga0207707_103631872 | 168 |
| 376 | 3300025918 | Ga0207662_10010192 | Ga0207662_100101923 | 168 |
| 377 | 3300025919 | Ga0207657_10000533 | Ga0207657_1000053319 | 168 |
| 378 | 3300025919 | Ga0207657_10550610 | Ga0207657_105506102 | 168 |
| 379 | 3300025920 | Ga0207649_10007195 | Ga0207649_100071957 | 168 |
| 380 | 3300025923 | Ga0207681_10003378 | Ga0207681_100033787 | 168 |
| 381 | 3300025923 | Ga0207681_10151214 | Ga0207681_101512142 | 168 |
| 382 | 3300025924 | Ga0207694_10457288 | Ga0207694_104572882 | 168 |
| 383 | 3300025924 | Ga0207694_10567075 | Ga0207694_105670752 | 168 |
| 384 | 3300025925 | Ga0207650_10081359 | Ga0207650_100813592 | 168 |
| 385 | 3300025926 | Ga0207659_10008656 | Ga0207659_100086565 | 168 |
| 386 | 3300025926 | Ga0207659_10029224 | Ga0207659_100292242 | 168 |
| 387 | 3300025931 | Ga0207644_10016669 | Ga0207644_100166696 | 168 |
| 388 | 3300025931 | Ga0207644_10606119 | Ga0207644_106061191 | 168 |
| 389 | 3300025932 | Ga0207690_10004002 | Ga0207690_100040028 | 168 |
| 390 | 3300025933 | Ga0207706_10000219 | Ga0207706_1000021930 | 168 |
| 391 | 3300025936 | Ga0207670_10099660 | Ga0207670_100996602 | 168 |
| 392 | 3300025937 | Ga0207669_10002768 | Ga0207669_100027687 | 168 |
| 393 | 3300025937 | Ga0207669_10417691 | Ga0207669_104176912 | 168 |
| 394 | 3300025938 | Ga0207704_10056925 | Ga0207704_100569251 | 168 |
| 395 | 3300025940 | Ga0207691_10001676 | Ga0207691_100016768 | 168 |
| 396 | 3300025941 | Ga0207711_10235943 | Ga0207711_102359433 | 168 |
| 397 | 3300025941 | Ga0207711_10453998 | Ga0207711_104539982 | 168 |
| 398 | 3300025942 | Ga0207689_10005037 | Ga0207689_100050376 | 168 |
| 399 | 3300025949 | Ga0207667_10009864 | Ga0207667_100098648 | 168 |
| 400 | 3300025960 | Ga0207651_10006456 | Ga0207651_100064563 | 168 |
| 401 | 3300025960 | Ga0207651_10011031 | Ga0207651_100110312 | 168 |
| 402 | 3300025972 | Ga0207668_10060085 | Ga0207668_100600853 | 168 |
| 403 | 3300025981 | Ga0207640_10070040 | Ga0207640_100700402 | 168 |
| 404 | 3300025981 | Ga0207640_10305864 | Ga0207640_103058642 | 168 |
| 405 | 3300025986 | Ga0207658_10026505 | Ga0207658_100265054 | 168 |
| 406 | 3300025986 | Ga0207658_10342289 | Ga0207658_103422892 | 168 |
| 407 | 3300026035 | Ga0207703_10006392 | Ga0207703_100063925 | 168 |
| 408 | 3300026041 | Ga0207639_10001625 | Ga0207639_1000162512 | 168 |
| 409 | 3300026067 | Ga0207678_10003817 | Ga0207678_100038178 | 168 |
| 410 | 3300026067 | Ga0207678_10287692 | Ga0207678_102876922 | 168 |
| 411 | 3300026078 | Ga0207702_10010293 | Ga0207702_100102933 | 168 |
| 412 | 3300026088 | Ga0207641_10645128 | Ga0207641_106451281 | 168 |
| 413 | 3300026089 | Ga0207648_10003597 | Ga0207648_1000359711 | 168 |
| 414 | 3300026095 | Ga0207676_10062089 | Ga0207676_100620893 | 168 |
| 415 | 3300026118 | Ga0207675_100115533 | Ga0207675_1001155332 | 168 |
| 416 | 3300026121 | Ga0207683_10002113 | Ga0207683_1000211311 | 168 |
| 417 | 3300026121 | Ga0207683_10308607 | Ga0207683_103086072 | 168 |
| 418 | 3300026142 | Ga0207698_10126716 | Ga0207698_101267162 | 168 |
| 419 | 3300028379 | Ga0268266_10008392 | Ga0268266_100083922 | 168 |
| 420 | 3300028381 | Ga0268264_10013683 | Ga0268264_100136837 | 168 |
| 421 | 3300041492 | Ga0451835_0496515 | Ga0451835_0496515_139_645 | 168 |
| 422 | 3300048903 | Ga0496100_0842501 | Ga0496100_0842501_106_612 | 168 |
| 423 | 3300048904 | Ga0496101_0894577 | Ga0496101_0894577_101_607 | 168 |
| 424 | 3300048905 | Ga0496102_0122272 | Ga0496102_0122272_1307_1825 | 168 |
| 425 | 3300048905 | Ga0496102_0226040 | Ga0496102_0226040_759_1265 | 168 |
| 426 | 3300048906 | Ga0496103_0017377 | Ga0496103_0017377_838_1344 | 168 |
| 427 | 3300048909 | Ga0496106_0011772 | Ga0496106_0011772_2687_3193 | 168 |
| 428 | 3300048910 | Ga0496107_0020615 | Ga0496107_0020615_3036_3542 | 168 |
| 429 | 3300048917 | Ga0496114_0222054 | Ga0496114_0222054_723_1229 | 168 |
| 430 | 3300049572 | Ga0501036_0182159 | Ga0501036_0182159_45_578 | 168 |
| 431 | 3300049573 | Ga0501037_0129549 | Ga0501037_0129549_229_762 | 168 |
| 432 | 3300049574 | Ga0501038_0130154 | Ga0501038_0130154_358_891 | 168 |
| 433 | 3300049575 | Ga0501039_0033391 | Ga0501039_0033391_324_857 | 168 |
| 434 | 3300049576 | Ga0501040_0015014 | Ga0501040_0015014_3821_4354 | 168 |
| 435 | 3300049577 | Ga0501041_0031027 | Ga0501041_0031027_606_1139 | 168 |
| 436 | 3300049578 | Ga0501042_0842776 | Ga0501042_0842776_15_548 | 168 |
| 437 | 3300049580 | Ga0501046_0097293 | Ga0501046_0097293_868_1401 | 168 |
| 438 | 3300049584 | Ga0501068_0033386 | Ga0501068_0033386_151_684 | 168 |
| 439 | 3300049587 | Ga0501071_0017204 | Ga0501071_0017204_3423_3956 | 168 |
| 440 | 3300049588 | Ga0501072_0003433 | Ga0501072_0003433_1701_2234 | 168 |
| 441 | 3300049589 | Ga0501073_0042715 | Ga0501073_0042715_705_1238 | 168 |
| 442 | 3300049590 | Ga0501074_0090580 | Ga0501074_0090580_638_1171 | 168 |
| 443 | 3300049591 | Ga0501075_0023010 | Ga0501075_0023010_1997_2530 | 168 |
| 444 | 3300049592 | Ga0501076_0027124 | Ga0501076_0027124_3121_3654 | 168 |
| 445 | 3300049593 | Ga0501077_0008388 | Ga0501077_0008388_4094_4627 | 168 |
| 446 | 3300049741 | Ga0501079_0018383 | Ga0501079_0018383_1310_1843 | 168 |
| 447 | 3300049742 | Ga0501080_0078907 | Ga0501080_0078907_1214_1747 | 168 |
| 448 | 3300049743 | Ga0501081_0004029 | Ga0501081_0004029_5449_5982 | 168 |
| 449 | 3300049744 | Ga0501083_0476327 | Ga0501083_0476327_12_545 | 168 |
| 450 | 3300049823 | Ga0501044_0265258 | Ga0501044_0265258_790_1323 | 168 |
| 451 | 3300049824 | Ga0501045_0024719 | Ga0501045_0024719_2964_3497 | 168 |
| 452 | 3300054114 | Ga0501084_0041431 | Ga0501084_0041431_2565_3098 | 168 |
| 453 | 3300060353 | Ga0501082_0020249 | Ga0501082_0020249_3556_4089 | 168 |
| 454 | 3300061734 | Ga0530510_0674378 | Ga0530510_0674378_124_657 | 168 |
| 455 | 3300005546 | Ga0070696_100120447 | Ga0070696_1001204471 | 169 |
| 456 | 3300006042 | Ga0075368_10008568 | Ga0075368_100085682 | 169 |
| 457 | 3300006051 | Ga0075364_10590998 | Ga0075364_105909982 | 169 |
| 458 | 3300006178 | Ga0075367_10003622 | Ga0075367_1000362211 | 169 |
| 459 | 3300006195 | Ga0075366_10055335 | Ga0075366_100553354 | 169 |
| 460 | 3300006353 | Ga0075370_10004713 | Ga0075370_100047133 | 169 |
| 461 | 3300006358 | Ga0068871_101202694 | Ga0068871_1012026942 | 169 |
| 462 | 3300006931 | Ga0097620_100360045 | Ga0097620_1003600452 | 169 |
| 463 | 3300011119 | Ga0105246_10648530 | Ga0105246_106485301 | 169 |
| 464 | 3300026041 | Ga0207639_10725371 | Ga0207639_107253711 | 169 |
| 465 | 3300026118 | Ga0207675_100684903 | Ga0207675_1006849032 | 169 |
| 466 | 3300028381 | Ga0268264_10175886 | Ga0268264_101758862 | 169 |
| 467 | 3300050490 | nmdc:mga03n38_84475_c1 | nmdc:mga03n38_84475_c1_783_1298 | 169 |
| 468 | 3300050491 | nmdc:mga00v17_122369_c1 | nmdc:mga00v17_122369_c1_643_1158 | 169 |
| 469 | 3300050493 | nmdc:mga0k408_30918_c1 | nmdc:mga0k408_30918_c1_805_1320 | 169 |
| 470 | 3300050494 | nmdc:mga06z11_18396_c1 | nmdc:mga06z11_18396_c1_90_605 | 169 |
| 471 | 3300050494 | nmdc:mga06z11_23683_c1 | nmdc:mga06z11_23683_c1_53_568 | 169 |
| 472 | 3300050495 | nmdc:mga04h51_5574_c1 | nmdc:mga04h51_5574_c1_2461_2976 | 169 |
| 473 | 3300050496 | nmdc:mga07m45_39922_c1 | nmdc:mga07m45_39922_c1_1672_2187 | 169 |
| 474 | 3300050496 | nmdc:mga07m45_542089_c1 | nmdc:mga07m45_542089_c1_145_660 | 169 |
| 475 | 3300006178 | Ga0075367_10503649 | Ga0075367_105036492 | 170 |
| 476 | 3300025940 | Ga0207691_10222160 | Ga0207691_102221602 | 170 |
| 477 | 2162886012 | MBSR1b_contig_10885647 | MBSR1b_0333.00003700 | 171 |
| 478 | 3300005293 | Ga0065715_10168703 | Ga0065715_101687032 | 171 |
| 479 | 3300005328 | Ga0070676_10997446 | Ga0070676_109974461 | 171 |
| 480 | 3300005330 | Ga0070690_101204028 | Ga0070690_1012040281 | 171 |
| 481 | 3300005331 | Ga0070670_100240690 | Ga0070670_1002406901 | 171 |
| 482 | 3300005331 | Ga0070670_101217352 | Ga0070670_1012173521 | 171 |
| 483 | 3300005331 | Ga0070670_101434682 | Ga0070670_1014346821 | 171 |
| 484 | 3300005333 | Ga0070677_10066440 | Ga0070677_100664402 | 171 |
| 485 | 3300005335 | Ga0070666_10430510 | Ga0070666_104305101 | 171 |
| 486 | 3300005337 | Ga0070682_101382082 | Ga0070682_1013820821 | 171 |
| 487 | 3300005344 | Ga0070661_100058547 | Ga0070661_1000585471 | 171 |
| 488 | 3300005347 | Ga0070668_100262250 | Ga0070668_1002622502 | 171 |
| 489 | 3300005353 | Ga0070669_100078935 | Ga0070669_1000789353 | 171 |
| 490 | 3300005353 | Ga0070669_100095747 | Ga0070669_1000957472 | 171 |
| 491 | 3300005353 | Ga0070669_100413054 | Ga0070669_1004130543 | 171 |
| 492 | 3300005354 | Ga0070675_100000839 | Ga0070675_10000083916 | 171 |
| 493 | 3300005354 | Ga0070675_100030688 | Ga0070675_1000306882 | 171 |
| 494 | 3300005354 | Ga0070675_100237936 | Ga0070675_1002379363 | 171 |
| 495 | 3300005355 | Ga0070671_101303718 | Ga0070671_1013037181 | 171 |
| 496 | 3300005356 | Ga0070674_100054600 | Ga0070674_1000546003 | 171 |
| 497 | 3300005356 | Ga0070674_101242608 | Ga0070674_1012426081 | 171 |
| 498 | 3300005364 | Ga0070673_100247227 | Ga0070673_1002472272 | 171 |
| 499 | 3300005364 | Ga0070673_100470318 | Ga0070673_1004703181 | 171 |
| 500 | 3300005364 | Ga0070673_100500153 | Ga0070673_1005001532 | 171 |
| 501 | 3300005364 | Ga0070673_101099553 | Ga0070673_1010995532 | 171 |
| 502 | 3300005455 | Ga0070663_100058518 | Ga0070663_1000585182 | 171 |
| 503 | 3300005456 | Ga0070678_100147383 | Ga0070678_1001473833 | 171 |
| 504 | 3300005459 | Ga0068867_100518781 | Ga0068867_1005187812 | 171 |
| 505 | 3300005459 | Ga0068867_101299806 | Ga0068867_1012998062 | 171 |
| 506 | 3300005543 | Ga0070672_100161157 | Ga0070672_1001611573 | 171 |
| 507 | 3300005543 | Ga0070672_100246860 | Ga0070672_1002468602 | 171 |
| 508 | 3300005543 | Ga0070672_100428747 | Ga0070672_1004287471 | 171 |
| 509 | 3300005546 | Ga0070696_100721265 | Ga0070696_1007212651 | 171 |
| 510 | 3300005564 | Ga0070664_100391171 | Ga0070664_1003911713 | 171 |
| 511 | 3300005615 | Ga0070702_100181798 | Ga0070702_1001817982 | 171 |
| 512 | 3300005618 | Ga0068864_100709016 | Ga0068864_1007090162 | 171 |
| 513 | 3300005719 | Ga0068861_101220422 | Ga0068861_1012204221 | 171 |
| 514 | 3300005834 | Ga0068851_10162938 | Ga0068851_101629381 | 171 |
| 515 | 3300005841 | Ga0068863_100129465 | Ga0068863_1001294653 | 171 |
| 516 | 3300005841 | Ga0068863_100377743 | Ga0068863_1003777432 | 171 |
| 517 | 3300005844 | Ga0068862_100403507 | Ga0068862_1004035072 | 171 |
| 518 | 3300005844 | Ga0068862_101027724 | Ga0068862_1010277241 | 171 |
| 519 | 3300006177 | Ga0075362_10233397 | Ga0075362_102333972 | 171 |
| 520 | 3300006178 | Ga0075367_10395618 | Ga0075367_103956182 | 171 |
| 521 | 3300006237 | Ga0097621_100226451 | Ga0097621_1002264512 | 171 |
| 522 | 3300006358 | Ga0068871_100909368 | Ga0068871_1009093681 | 171 |
| 523 | 3300006358 | Ga0068871_101091478 | Ga0068871_1010914781 | 171 |
| 524 | 3300006844 | Ga0075428_101321257 | Ga0075428_1013212571 | 171 |
| 525 | 3300006846 | Ga0075430_100280578 | Ga0075430_1002805783 | 171 |
| 526 | 3300006847 | Ga0075431_100220513 | Ga0075431_1002205133 | 171 |
| 527 | 3300006880 | Ga0075429_100044193 | Ga0075429_1000441935 | 171 |
| 528 | 3300006881 | Ga0068865_100297381 | Ga0068865_1002973812 | 171 |
| 529 | 3300009094 | Ga0111539_10098176 | Ga0111539_100981762 | 171 |
| 530 | 3300009094 | Ga0111539_10519644 | Ga0111539_105196442 | 171 |
| 531 | 3300009147 | Ga0114129_10033996 | Ga0114129_100339967 | 171 |
| 532 | 3300009147 | Ga0114129_10911284 | Ga0114129_109112842 | 171 |
| 533 | 3300009176 | Ga0105242_10235893 | Ga0105242_102358931 | 171 |
| 534 | 3300009177 | Ga0105248_10227291 | Ga0105248_102272914 | 171 |
| 535 | 3300009177 | Ga0105248_10639756 | Ga0105248_106397562 | 171 |
| 536 | 3300009177 | Ga0105248_10738528 | Ga0105248_107385282 | 171 |
| 537 | 3300009551 | Ga0105238_10183773 | Ga0105238_101837732 | 171 |
| 538 | 3300013296 | Ga0157374_10261131 | Ga0157374_102611312 | 171 |
| 539 | 3300013306 | Ga0163162_12148921 | Ga0163162_121489211 | 171 |
| 540 | 3300013308 | Ga0157375_10141938 | Ga0157375_101419384 | 171 |
| 541 | 3300014325 | Ga0163163_10021756 | Ga0163163_100217562 | 171 |
| 542 | 3300014326 | Ga0157380_10059059 | Ga0157380_100590591 | 171 |
| 543 | 3300014326 | Ga0157380_10071826 | Ga0157380_100718264 | 171 |
| 544 | 3300014326 | Ga0157380_10350963 | Ga0157380_103509632 | 171 |
| 545 | 3300014745 | Ga0157377_10177787 | Ga0157377_101777871 | 171 |
| 546 | 3300014969 | Ga0157376_10173717 | Ga0157376_101737172 | 171 |
| 547 | 3300014969 | Ga0157376_10262986 | Ga0157376_102629862 | 171 |
| 548 | 3300017792 | Ga0163161_10471017 | Ga0163161_104710172 | 171 |
| 549 | 3300025321 | Ga0207656_10148570 | Ga0207656_101485701 | 171 |
| 550 | 3300025893 | Ga0207682_10222950 | Ga0207682_102229501 | 171 |
| 551 | 3300025893 | Ga0207682_10288179 | Ga0207682_102881791 | 171 |
| 552 | 3300025893 | Ga0207682_10375375 | Ga0207682_103753751 | 171 |
| 553 | 3300025907 | Ga0207645_10717826 | Ga0207645_107178261 | 171 |
| 554 | 3300025923 | Ga0207681_10099286 | Ga0207681_100992862 | 171 |
| 555 | 3300025923 | Ga0207681_10929025 | Ga0207681_109290252 | 171 |
| 556 | 3300025925 | Ga0207650_10093388 | Ga0207650_100933884 | 171 |
| 557 | 3300025925 | Ga0207650_10123652 | Ga0207650_101236522 | 171 |
| 558 | 3300025926 | Ga0207659_10001283 | Ga0207659_100012835 | 171 |
| 559 | 3300025926 | Ga0207659_10033382 | Ga0207659_100333823 | 171 |
| 560 | 3300025933 | Ga0207706_10317037 | Ga0207706_103170372 | 171 |
| 561 | 3300025934 | Ga0207686_10452050 | Ga0207686_104520501 | 171 |
| 562 | 3300025937 | Ga0207669_10024022 | Ga0207669_100240223 | 171 |
| 563 | 3300025937 | Ga0207669_10535457 | Ga0207669_105354572 | 171 |
| 564 | 3300025938 | Ga0207704_10343905 | Ga0207704_103439052 | 171 |
| 565 | 3300025940 | Ga0207691_10063829 | Ga0207691_100638294 | 171 |
| 566 | 3300025940 | Ga0207691_10184364 | Ga0207691_101843642 | 171 |
| 567 | 3300025941 | Ga0207711_10370801 | Ga0207711_103708011 | 171 |
| 568 | 3300025941 | Ga0207711_10517602 | Ga0207711_105176022 | 171 |
| 569 | 3300025941 | Ga0207711_10579413 | Ga0207711_105794131 | 171 |
| 570 | 3300025944 | Ga0207661_10428618 | Ga0207661_104286182 | 171 |
| 571 | 3300025944 | Ga0207661_11050272 | Ga0207661_110502721 | 171 |
| 572 | 3300025945 | Ga0207679_10165684 | Ga0207679_101656842 | 171 |
| 573 | 3300025960 | Ga0207651_10199966 | Ga0207651_101999663 | 171 |
| 574 | 3300025960 | Ga0207651_11050040 | Ga0207651_110500401 | 171 |
| 575 | 3300025960 | Ga0207651_11211288 | Ga0207651_112112881 | 171 |
| 576 | 3300025961 | Ga0207712_11009979 | Ga0207712_110099791 | 171 |
| 577 | 3300025981 | Ga0207640_10362995 | Ga0207640_103629951 | 171 |
| 578 | 3300026067 | Ga0207678_10050844 | Ga0207678_100508443 | 171 |
| 579 | 3300026067 | Ga0207678_10140125 | Ga0207678_101401253 | 171 |
| 580 | 3300026067 | Ga0207678_10867634 | Ga0207678_108676342 | 171 |
| 581 | 3300026075 | Ga0207708_11347659 | Ga0207708_113476591 | 171 |
| 582 | 3300026088 | Ga0207641_10186133 | Ga0207641_101861333 | 171 |
| 583 | 3300026088 | Ga0207641_10449683 | Ga0207641_104496832 | 171 |
| 584 | 3300026089 | Ga0207648_10091008 | Ga0207648_100910082 | 171 |
| 585 | 3300026095 | Ga0207676_10135373 | Ga0207676_101353731 | 171 |
| 586 | 3300026118 | Ga0207675_100448188 | Ga0207675_1004481881 | 171 |
| 587 | 3300026118 | Ga0207675_100651884 | Ga0207675_1006518842 | 171 |
| 588 | 3300026121 | Ga0207683_10002565 | Ga0207683_100025658 | 171 |
| 589 | 3300027907 | Ga0207428_10252871 | Ga0207428_102528712 | 171 |
| 590 | 3300031548 | Ga0307408_100070015 | Ga0307408_1000700152 | 171 |
| 591 | 3300031824 | Ga0307413_10192783 | Ga0307413_101927832 | 171 |
| 592 | 3300031824 | Ga0307413_10469656 | Ga0307413_104696561 | 171 |
| 593 | 3300031824 | Ga0307413_10782743 | Ga0307413_107827431 | 171 |
| 594 | 3300031852 | Ga0307410_10007757 | Ga0307410_100077577 | 171 |
| 595 | 3300031901 | Ga0307406_11022886 | Ga0307406_110228862 | 171 |
| 596 | 3300031995 | Ga0307409_100024776 | Ga0307409_1000247763 | 171 |
| 597 | 3300032002 | Ga0307416_100788725 | Ga0307416_1007887252 | 171 |
| 598 | 3300032004 | Ga0307414_10086248 | Ga0307414_100862484 | 171 |
| 599 | 3300032126 | Ga0307415_100526648 | Ga0307415_1005266482 | 171 |
| 600 | 3300039437 | Ga0436365_1611331 | Ga0436365_1611331_33_554 | 171 |
| 601 | 3300041512 | Ga0451853_0326133 | Ga0451853_0326133_161_682 | 171 |
| 602 | 3300041512 | Ga0451853_1696582 | Ga0451853_1696582_117_641 | 171 |
| 603 | 3300042010 | Ga0439452_086272 | Ga0439452_086272_82_600 | 171 |
| 604 | 3300042013 | Ga0439456_015881 | Ga0439456_015881_135_656 | 171 |
| 605 | 3300042530 | Ga0450916_044684 | Ga0450916_044684_18_533 | 171 |
| 606 | 3300048912 | Ga0496109_0721017 | Ga0496109_0721017_77_592 | 171 |
| 607 | 3300050491 | nmdc:mga00v17_256798_c1 | nmdc:mga00v17_256798_c1_498_1016 | 171 |
| 608 | 3300050493 | nmdc:mga0k408_254918_c1 | nmdc:mga0k408_254918_c1_355_888 | 171 |
| 609 | 3300050493 | nmdc:mga0k408_609101_c1 | nmdc:mga0k408_609101_c1_105_620 | 171 |
| 610 | 3300050494 | nmdc:mga06z11_99892_c1 | nmdc:mga06z11_99892_c1_369_902 | 171 |
| 611 | 3300050507 | nmdc:mga05p37_103222_c1 | nmdc:mga05p37_103222_c1_2217_2732 | 171 |
| 612 | 3300050508 | nmdc:mga09592_174096_c1 | nmdc:mga09592_174096_c1_639_1154 | 171 |
| 613 | 3300050510 | nmdc:mga06r32_842078_c1 | nmdc:mga06r32_842078_c1_75_596 | 171 |
| 614 | 3300050511 | nmdc:mga08y16_518062_c1 | nmdc:mga08y16_518062_c1_166_681 | 171 |
| 615 | 3300050511 | nmdc:mga08y16_634628_c1 | nmdc:mga08y16_634628_c1_23_541 | 171 |
| 616 | 3300053139 | Ga0500568_0005753 | Ga0500568_0005753_4577_5110 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2re7-assembly1.cif.gz_A-2 | crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution | 0.8561 | 2 | 133 |
| 2i02-assembly1.cif.gz_A | crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution | 0.8531 | 5 | 166 |
| 2fhq-assembly1.cif.gz_B | crystal structure of general stress protein from bacteroides thetaiotaomicron | 0.8462 | 2 | 133 |
| 2i02-assembly1.cif.gz_B | crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution | 0.8461 | 5 | 140 |
| 3dmb-assembly1.cif.gz_C-2 | crystal structure of a putative general stress family protein (xcc2264) from xanthomonas campestris pv. campestris at 2.30 a resolution | 0.8239 | 7 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2re7A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8529 | 2 | 133 | 2.30.110.10 |
| 2i02B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8414 | 5 | 140 | 2.30.110.10 |
| 2fhqB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8412 | 3 | 133 | 2.30.110.10 |
| 2re7A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8115 | 2 | 133 | 2.30.110.10 |
| 3ec6A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8039 | 6 | 133 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1EMM7-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9141 | 1 | 87 |
|
| AF-A0A2T0SW39-F1-model_v4 | General stress protein 26 | 0.8912 | 4 | 133 |
|
| AF-A0A098LJ80-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.8839 | 7 | 133 |
|
| AF-A0A7W2A0N9-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.8836 | 6 | 131 |
|
| AF-A0A4S4B4P5-F1-model_v4 | General stress protein | 0.8769 | 7 | 140 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar