F469546

General Info

Members Datasets Scaffolds Average Seq Length
616 263 616 169

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10350963|Ga0157380_103509632
Length 172
Sequence MKSELEKLYAAIESIETAMMTTRRADGHLRSRAMANQKQADGADLWFVCREGTAKLADLANDDHVNLTYYYRDSNREWVSVSGTAALSRDRAKIRELYAPDWKVWFANEGDPRHGTPDDPRMVLIGVTVHGAEFLEVNKPRPVILFELVKGWLTGNEPELGEMHELVEPRRP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
102 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
103 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
193 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
194 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
195 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
196 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
197 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
198 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
199 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
202 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
203 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 3.57
Rhizosphere 92.37
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10885647 2162886012 Bacteria 1147
2 2214914668 2209111006 Bacteria 1382
3 ARcpr5yngRDRAFT_c001452 3300000043 Bacteria 2612
4 ARSoilOldRDRAFT_c003721 3300000044 Unclassified 1307
5 ARCol0yngRDRAFT_1001318 3300000652 Bacteria 2061
6 Ga0065714_10108127 3300005288 Unclassified 1482
7 Ga0065712_10015439 3300005290 Bacteria 2144
8 Ga0065712_10071300 3300005290 Bacteria 5354
9 Ga0065715_10039893 3300005293 Bacteria 1190
10 Ga0065715_10168703 3300005293 Bacteria 1526
11 Ga0065715_10171781 3300005293 Bacteria 1541
12 Ga0070658_11383248 3300005327 Unclassified 611
13 Ga0070676_10001487 3300005328 Bacteria 11850
14 Ga0070676_10317341 3300005328 Bacteria 1061
15 Ga0070676_10339610 3300005328 Bacteria 1029
16 Ga0070676_10997446 3300005328 Bacteria 628
17 Ga0070683_100001000 3300005329 Bacteria 21167
18 Ga0070683_100065612 3300005329 Bacteria 3380
19 Ga0070683_101221949 3300005329 Bacteria 722
20 Ga0070690_100014476 3300005330 Bacteria 4680
21 Ga0070690_100046096 3300005330 Unclassified 2771
22 Ga0070690_100509954 3300005330 Bacteria 901
23 Ga0070690_101204028 3300005330 Unclassified 604
24 Ga0070670_100043521 3300005331 Bacteria 3859
25 Ga0070670_100109640 3300005331 Bacteria 2378
26 Ga0070670_100140026 3300005331 Bacteria 2092
27 Ga0070670_100240690 3300005331 Bacteria 1575
28 Ga0070670_101202757 3300005331 Bacteria 693
29 Ga0070670_101217352 3300005331 Bacteria 688
30 Ga0070670_101434682 3300005331 Unclassified 633
31 Ga0070677_10066440 3300005333 Bacteria 1504
32 Ga0068869_100015138 3300005334 Bacteria 5166
33 Ga0068869_100554294 3300005334 Unclassified 966
34 Ga0070666_10019278 3300005335 Bacteria 4401
35 Ga0070666_10020885 3300005335 Bacteria 4238
36 Ga0070666_10332195 3300005335 Bacteria 1085
37 Ga0070666_10430510 3300005335 Unclassified 951
38 Ga0070666_10460252 3300005335 Bacteria 919
39 Ga0070680_100030389 3300005336 Bacteria 4340
40 Ga0070680_100338788 3300005336 Bacteria 1278
41 Ga0070680_100373260 3300005336 Bacteria 1214
42 Ga0070680_101563442 3300005336 Unclassified 571
43 Ga0070682_100018353 3300005337 Bacteria 4088
44 Ga0070682_101382082 3300005337 Unclassified 601
45 Ga0068868_100055228 3300005338 Unclassified 3132
46 Ga0068868_100609508 3300005338 Unclassified 968
47 Ga0070660_100003048 3300005339 Bacteria 11529
48 Ga0070689_100035358 3300005340 Bacteria 3818
49 Ga0070691_10015617 3300005341 Bacteria 3488
50 Ga0070691_10300663 3300005341 Unclassified 877
51 Ga0070687_100038930 3300005343 Bacteria 2386
52 Ga0070687_100340490 3300005343 Bacteria 965
53 Ga0070661_100013334 3300005344 Bacteria 5770
54 Ga0070661_100058547 3300005344 Bacteria 2824
55 Ga0070692_10007733 3300005345 Bacteria 4757
56 Ga0070692_10502139 3300005345 Bacteria 786
57 Ga0070668_100063226 3300005347 Bacteria 2869
58 Ga0070668_100244092 3300005347 Bacteria 1489
59 Ga0070668_100262250 3300005347 Bacteria 1437
60 Ga0070668_100291494 3300005347 Bacteria 1366
61 Ga0070668_100585634 3300005347 Unclassified 974
62 Ga0070669_100004979 3300005353 Bacteria 9601
63 Ga0070669_100078935 3300005353 Unclassified 2447
64 Ga0070669_100083179 3300005353 Bacteria 2387
65 Ga0070669_100095343 3300005353 Unclassified 2237
66 Ga0070669_100095747 3300005353 Unclassified 2233
67 Ga0070669_100413054 3300005353 Unclassified 1106
68 Ga0070669_101112315 3300005353 Bacteria 681
69 Ga0070675_100000839 3300005354 Bacteria 21786
70 Ga0070675_100028143 3300005354 Bacteria 4523
71 Ga0070675_100030688 3300005354 Bacteria 4340
72 Ga0070675_100237936 3300005354 Unclassified 1590
73 Ga0070675_100387460 3300005354 Bacteria 1245
74 Ga0070671_100010564 3300005355 Bacteria 7414
75 Ga0070671_100119327 3300005355 Bacteria 2219
76 Ga0070671_100640755 3300005355 Bacteria 920
77 Ga0070671_101303718 3300005355 Bacteria 640
78 Ga0070674_100007020 3300005356 Bacteria 6617
79 Ga0070674_100054600 3300005356 Bacteria 2764
80 Ga0070674_100405551 3300005356 Bacteria 1115
81 Ga0070674_101242608 3300005356 Bacteria 662
82 Ga0070673_100004148 3300005364 Bacteria 9127
83 Ga0070673_100007827 3300005364 Bacteria 7078
84 Ga0070673_100153819 3300005364 Bacteria 1950
85 Ga0070673_100247227 3300005364 Bacteria 1553
86 Ga0070673_100252461 3300005364 Bacteria 1538
87 Ga0070673_100470318 3300005364 Bacteria 1133
88 Ga0070673_100500153 3300005364 Bacteria 1099
89 Ga0070673_101025961 3300005364 Bacteria 769
90 Ga0070673_101099553 3300005364 Bacteria 742
91 Ga0070688_100047455 3300005365 Bacteria 2664
92 Ga0070659_100000725 3300005366 Bacteria 23943
93 Ga0070659_100065634 3300005366 Bacteria 2875
94 Ga0070667_100011331 3300005367 Bacteria 7374
95 Ga0070667_100193162 3300005367 Bacteria 1804
96 Ga0070667_100382699 3300005367 Bacteria 1278
97 Ga0070667_100591504 3300005367 Bacteria 1022
98 Ga0070701_10648344 3300005438 Bacteria 705
99 Ga0070711_100417246 3300005439 Bacteria 1093
100 Ga0070700_100015909 3300005441 Bacteria 4274
101 Ga0070700_100056930 3300005441 Bacteria 2452
102 Ga0070700_100598304 3300005441 Bacteria 864
103 Ga0070700_100602759 3300005441 Bacteria 861
104 Ga0070700_100902370 3300005441 Bacteria 720
105 Ga0070694_100171006 3300005444 Bacteria 1601
106 Ga0070663_100028201 3300005455 Bacteria 3820
107 Ga0070663_100031144 3300005455 Bacteria 3664
108 Ga0070663_100058518 3300005455 Bacteria 2767
109 Ga0070663_100420451 3300005455 Bacteria 1096
110 Ga0070663_101521468 3300005455 Unclassified 595
111 Ga0070678_100147383 3300005456 Bacteria 1891
112 Ga0070678_100198527 3300005456 Unclassified 1654
113 Ga0070678_100276767 3300005456 Bacteria 1417
114 Ga0070678_100885733 3300005456 Bacteria 815
115 Ga0070662_100002254 3300005457 Bacteria 11828
116 Ga0070662_100026981 3300005457 Bacteria 3982
117 Ga0070662_100080277 3300005457 Unclassified 2428
118 Ga0070662_100089958 3300005457 Bacteria 2303
119 Ga0070681_10056134 3300005458 Bacteria 3920
120 Ga0070681_10075157 3300005458 Bacteria 3339
121 Ga0070681_10337799 3300005458 Unclassified 1416
122 Ga0068867_100002587 3300005459 Bacteria 12749
123 Ga0068867_100254943 3300005459 Bacteria 1428
124 Ga0068867_100518781 3300005459 Bacteria 1027
125 Ga0068867_100814593 3300005459 Unclassified 834
126 Ga0068867_101299806 3300005459 Bacteria 671
127 Ga0070685_10091484 3300005466 Bacteria 1842
128 Ga0070699_100568064 3300005518 Unclassified 1033
129 Ga0070679_100065393 3300005530 Bacteria 3625
130 Ga0070679_100287104 3300005530 Bacteria 1597
131 Ga0070684_100002014 3300005535 Bacteria 14950
132 Ga0070684_100011230 3300005535 Bacteria 7131
133 Ga0070684_100563507 3300005535 Unclassified 1058
134 Ga0068853_100015152 3300005539 Bacteria 6338
135 Ga0068853_100989011 3300005539 Bacteria 810
136 Ga0068853_101049058 3300005539 Unclassified 785
137 Ga0068853_101121678 3300005539 Bacteria 759
138 Ga0070672_100020589 3300005543 Bacteria 4814
139 Ga0070672_100057584 3300005543 Bacteria 3051
140 Ga0070672_100161157 3300005543 Bacteria 1861
141 Ga0070672_100246860 3300005543 Bacteria 1503
142 Ga0070672_100428747 3300005543 Bacteria 1137
143 Ga0070672_100718002 3300005543 Bacteria 876
144 Ga0070686_100000375 3300005544 Bacteria 28474
145 Ga0070686_100107038 3300005544 Bacteria 1898
146 Ga0070686_100283359 3300005544 Bacteria 1223
147 Ga0070695_100042162 3300005545 Bacteria 2896
148 Ga0070696_100120447 3300005546 Bacteria 1899
149 Ga0070696_100161749 3300005546 Bacteria 1650
150 Ga0070696_100721265 3300005546 Bacteria 814
151 Ga0070693_100078459 3300005547 Bacteria 1962
152 Ga0070665_100010852 3300005548 Bacteria 9213
153 Ga0070665_101764352 3300005548 Bacteria 626
154 Ga0068855_100022327 3300005563 Bacteria 7583
155 Ga0068855_101362343 3300005563 Unclassified 732
156 Ga0070664_100000114 3300005564 Bacteria 53137
157 Ga0070664_100001191 3300005564 Bacteria 20716
158 Ga0070664_100010322 3300005564 Bacteria 7579
159 Ga0070664_100152079 3300005564 Bacteria 2043
160 Ga0070664_100391171 3300005564 Bacteria 1270
161 Ga0070664_100446563 3300005564 Bacteria 1187
162 Ga0068857_100103226 3300005577 Bacteria 2560
163 Ga0068857_100118739 3300005577 Bacteria 2380
164 Ga0068854_100012913 3300005578 Bacteria 5469
165 Ga0068854_100231819 3300005578 Bacteria 1466
166 Ga0068854_100911735 3300005578 Bacteria 773
167 Ga0068856_100007822 3300005614 Bacteria 10437
168 Ga0068856_100557339 3300005614 Unclassified 1167
169 Ga0070702_100051333 3300005615 Bacteria 2360
170 Ga0070702_100181798 3300005615 Bacteria 1377
171 Ga0070702_100240139 3300005615 Bacteria 1222
172 Ga0068852_100152956 3300005616 Unclassified 2147
173 Ga0068859_100011781 3300005617 Bacteria 8786
174 Ga0068859_100299917 3300005617 Unclassified 1700
175 Ga0068864_100039795 3300005618 Bacteria 4018
176 Ga0068864_100044705 3300005618 Bacteria 3798
177 Ga0068864_100315555 3300005618 Bacteria 1467
178 Ga0068864_100386575 3300005618 Bacteria 1327
179 Ga0068864_100709016 3300005618 Bacteria 983
180 Ga0068866_10089598 3300005718 Unclassified 1672
181 Ga0068866_10293293 3300005718 Unclassified 1013
182 Ga0068866_10362316 3300005718 Bacteria 924
183 Ga0068866_10613316 3300005718 Bacteria 736
184 Ga0068861_100113855 3300005719 Unclassified 2171
185 Ga0068861_100253547 3300005719 Bacteria 1502
186 Ga0068861_100368083 3300005719 Bacteria 1266
187 Ga0068861_100979376 3300005719 Bacteria 806
188 Ga0068861_101220422 3300005719 Bacteria 728
189 Ga0068851_10147618 3300005834 Bacteria 1283
190 Ga0068851_10162938 3300005834 Bacteria 1226
191 Ga0068851_10586971 3300005834 Bacteria 677
192 Ga0068870_10502920 3300005840 Unclassified 808
193 Ga0068863_100032965 3300005841 Bacteria 4935
194 Ga0068863_100129465 3300005841 Bacteria 2409
195 Ga0068863_100377743 3300005841 Bacteria 1383
196 Ga0068863_100851760 3300005841 Bacteria 910
197 Ga0068858_100010864 3300005842 Bacteria 8605
198 Ga0068858_100518474 3300005842 Bacteria 1153
199 Ga0068858_100828281 3300005842 Bacteria 903
200 Ga0068860_100009059 3300005843 Bacteria 9906
201 Ga0068860_100158474 3300005843 Bacteria 2182
202 Ga0068860_100571045 3300005843 Unclassified 1134
203 Ga0068862_100025864 3300005844 Bacteria 4930
204 Ga0068862_100403507 3300005844 Bacteria 1279
205 Ga0068862_101027724 3300005844 Bacteria 816
206 Ga0075368_10008568 3300006042 Bacteria 3647
207 Ga0075364_10590998 3300006051 Unclassified 758
208 Ga0075432_10002038 3300006058 Bacteria 6723
209 Ga0075432_10116839 3300006058 Bacteria 999
210 Ga0075362_10233397 3300006177 Bacteria 901
211 Ga0075367_10003622 3300006178 Bacteria 7406
212 Ga0075367_10395618 3300006178 Unclassified 874
213 Ga0075367_10503649 3300006178 Unclassified 768
214 Ga0075366_10055335 3300006195 Bacteria 2357
215 Ga0097621_100226451 3300006237 Bacteria 1631
216 Ga0097621_100793336 3300006237 Unclassified 877
217 Ga0075370_10004713 3300006353 Bacteria 6662
218 Ga0068871_100001944 3300006358 Bacteria 13989
219 Ga0068871_100909368 3300006358 Bacteria 816
220 Ga0068871_101091478 3300006358 Bacteria 746
221 Ga0068871_101202694 3300006358 Unclassified 711
222 Ga0075428_100021566 3300006844 Bacteria 7132
223 Ga0075428_100204960 3300006844 Bacteria 2131
224 Ga0075428_101321257 3300006844 Bacteria 758
225 Ga0075430_100280578 3300006846 Bacteria 1378
226 Ga0075431_100220513 3300006847 Bacteria 1935
227 Ga0075433_10140646 3300006852 Bacteria 2145
228 Ga0075434_100976746 3300006871 Unclassified 861
229 Ga0075429_100044193 3300006880 Bacteria 3875
230 Ga0075429_100633856 3300006880 Bacteria 936
231 Ga0068865_100013065 3300006881 Bacteria 5237
232 Ga0068865_100065405 3300006881 Bacteria 2562
233 Ga0068865_100153580 3300006881 Bacteria 1749
234 Ga0068865_100297381 3300006881 Bacteria 1291
235 Ga0097620_100011782 3300006931 Bacteria 8786
236 Ga0097620_100299920 3300006931 Unclassified 1700
237 Ga0097620_100360045 3300006931 Bacteria 1550
238 Ga0075435_100006040 3300007076 Bacteria 8527
239 Ga0111539_10080502 3300009094 Bacteria 3831
240 Ga0111539_10098176 3300009094 Bacteria 3441
241 Ga0111539_10193964 3300009094 Bacteria 2369
242 Ga0111539_10484912 3300009094 Bacteria 1440
243 Ga0111539_10519644 3300009094 Unclassified 1387
244 Ga0105245_10015486 3300009098 Bacteria 6649
245 Ga0114129_10019183 3300009147 Bacteria 9742
246 Ga0114129_10033996 3300009147 Bacteria 7201
247 Ga0114129_10365854 3300009147 Bacteria 1907
248 Ga0114129_10579456 3300009147 Unclassified 1456
249 Ga0114129_10911284 3300009147 Bacteria 1113
250 Ga0105243_10029240 3300009148 Bacteria 4237
251 Ga0105243_10065131 3300009148 Bacteria 2926
252 Ga0105243_10124002 3300009148 Bacteria 2183
253 Ga0105241_10034415 3300009174 Bacteria 3806
254 Ga0105242_10012710 3300009176 Bacteria 6484
255 Ga0105242_10024384 3300009176 Bacteria 4777
256 Ga0105242_10235893 3300009176 Bacteria 1642
257 Ga0105242_11849556 3300009176 Bacteria 643
258 Ga0105248_10003724 3300009177 Bacteria 16906
259 Ga0105248_10062496 3300009177 Bacteria 4181
260 Ga0105248_10113195 3300009177 Unclassified 3060
261 Ga0105248_10227291 3300009177 Bacteria 2101
262 Ga0105248_10639756 3300009177 Bacteria 1200
263 Ga0105248_10684367 3300009177 Bacteria 1157
264 Ga0105248_10698889 3300009177 Unclassified 1144
265 Ga0105248_10738528 3300009177 Unclassified 1111
266 Ga0105238_10183773 3300009551 Bacteria 2067
267 Ga0105238_10271288 3300009551 Unclassified 1677
268 Ga0105249_10037113 3300009553 Bacteria 4422
269 Ga0105249_10124466 3300009553 Bacteria 2453
270 Ga0105249_10257340 3300009553 Bacteria 1733
271 Ga0105249_10346235 3300009553 Bacteria 1504
272 Ga0105239_10112907 3300010375 Bacteria 3013
273 Ga0105239_10289132 3300010375 Bacteria 1846
274 Ga0105239_11534316 3300010375 Bacteria 770
275 Ga0105246_10216157 3300011119 Bacteria 1499
276 Ga0105246_10648530 3300011119 Bacteria 919
277 Ga0157318_1000751 3300012482 Bacteria 1491
278 Ga0157319_1014951 3300012497 Bacteria 688
279 Ga0157315_1027216 3300012508 Unclassified 647
280 Ga0157373_10004088 3300013100 Bacteria 10991
281 Ga0157371_10006712 3300013102 Bacteria 9411
282 Ga0157371_10585129 3300013102 Unclassified 829
283 Ga0157374_10005208 3300013296 Bacteria 10902
284 Ga0157374_10024270 3300013296 Bacteria 5434
285 Ga0157374_10261131 3300013296 Unclassified 1706
286 Ga0157378_10169969 3300013297 Bacteria 2044
287 Ga0157378_10268321 3300013297 Bacteria 1640
288 Ga0163162_10022490 3300013306 Bacteria 6212
289 Ga0163162_10295303 3300013306 Bacteria 1752
290 Ga0163162_12148921 3300013306 Bacteria 641
291 Ga0157372_10008721 3300013307 Bacteria 10768
292 Ga0157372_10088937 3300013307 Unclassified 3508
293 Ga0157375_10141938 3300013308 Bacteria 2529
294 Ga0157375_10377729 3300013308 Bacteria 1584
295 Ga0157375_10885692 3300013308 Unclassified 1037
296 Ga0163163_10020594 3300014325 Bacteria 6215
297 Ga0163163_10021756 3300014325 Bacteria 6058
298 Ga0163163_10047937 3300014325 Bacteria 4200
299 Ga0163163_11478215 3300014325 Bacteria 741
300 Ga0157380_10006025 3300014326 Bacteria 8491
301 Ga0157380_10059059 3300014326 Bacteria 3059
302 Ga0157380_10071826 3300014326 Bacteria 2801
303 Ga0157380_10123070 3300014326 Unclassified 2200
304 Ga0157380_10130260 3300014326 Bacteria 2145
305 Ga0157380_10350963 3300014326 Bacteria 1380
306 Ga0157377_10121566 3300014745 Bacteria 1583
307 Ga0157377_10177787 3300014745 Bacteria 1336
308 Ga0157379_10004109 3300014968 Bacteria 12417
309 Ga0157379_11094418 3300014968 Bacteria 763
310 Ga0157376_10010996 3300014969 Bacteria 6650
311 Ga0157376_10173717 3300014969 Bacteria 1964
312 Ga0157376_10262986 3300014969 Bacteria 1617
313 Ga0157376_10430592 3300014969 Bacteria 1282
314 Ga0163161_10147057 3300017792 Unclassified 1788
315 Ga0163161_10471017 3300017792 Bacteria 1018
316 Ga0206351_10940915 3300020077 Unclassified 769
317 Ga0206350_11192982 3300020080 Unclassified 852
318 Ga0207673_1049399 3300025290 Bacteria 595
319 Ga0207697_10041412 3300025315 Unclassified 1892
320 Ga0207656_10148570 3300025321 Bacteria 1108
321 Ga0207682_10135441 3300025893 Bacteria 1102
322 Ga0207682_10222950 3300025893 Unclassified 872
323 Ga0207682_10288179 3300025893 Bacteria 768
324 Ga0207682_10375375 3300025893 Bacteria 671
325 Ga0207688_10019315 3300025901 Bacteria 3711
326 Ga0207680_10003033 3300025903 Bacteria 7875
327 Ga0207680_10021092 3300025903 Bacteria 3520
328 Ga0207680_10050528 3300025903 Bacteria 2481
329 Ga0207680_10519998 3300025903 Bacteria 848
330 Ga0207647_10161473 3300025904 Bacteria 1307
331 Ga0207645_10002100 3300025907 Bacteria 15942
332 Ga0207645_10113431 3300025907 Bacteria 1756
333 Ga0207645_10118507 3300025907 Bacteria 1717
334 Ga0207645_10717826 3300025907 Bacteria 679
335 Ga0207643_10407083 3300025908 Unclassified 861
336 Ga0207643_10450280 3300025908 Unclassified 819
337 Ga0207705_11003546 3300025909 Unclassified 645
338 Ga0207707_10060647 3300025912 Bacteria 3290
339 Ga0207707_10363187 3300025912 Bacteria 1246
340 Ga0207660_10054061 3300025917 Bacteria 2864
341 Ga0207660_10369486 3300025917 Unclassified 1152
342 Ga0207662_10010192 3300025918 Bacteria 5182
343 Ga0207662_10034269 3300025918 Bacteria 2963
344 Ga0207657_10000533 3300025919 Bacteria 40456
345 Ga0207657_10550610 3300025919 Unclassified 902
346 Ga0207649_10007195 3300025920 Bacteria 6050
347 Ga0207649_10434050 3300025920 Bacteria 988
348 Ga0207649_10709383 3300025920 Bacteria 781
349 Ga0207649_11312283 3300025920 Bacteria 572
350 Ga0207681_10003378 3300025923 Bacteria 9988
351 Ga0207681_10099286 3300025923 Bacteria 2096
352 Ga0207681_10151214 3300025923 Unclassified 1740
353 Ga0207681_10178947 3300025923 Bacteria 1614
354 Ga0207681_10640829 3300025923 Bacteria 880
355 Ga0207681_10818963 3300025923 Unclassified 778
356 Ga0207681_10929025 3300025923 Unclassified 729
357 Ga0207694_10457288 3300025924 Bacteria 1066
358 Ga0207694_10567075 3300025924 Bacteria 954
359 Ga0207650_10013311 3300025925 Bacteria 5694
360 Ga0207650_10030949 3300025925 Unclassified 3861
361 Ga0207650_10081359 3300025925 Bacteria 2457
362 Ga0207650_10093388 3300025925 Bacteria 2303
363 Ga0207650_10123652 3300025925 Bacteria 2017
364 Ga0207659_10001283 3300025926 Bacteria 15013
365 Ga0207659_10008656 3300025926 Bacteria 6330
366 Ga0207659_10029224 3300025926 Bacteria 3755
367 Ga0207659_10033382 3300025926 Bacteria 3542
368 Ga0207659_10338728 3300025926 Bacteria 1245
369 Ga0207687_10138613 3300025927 Bacteria 1843
370 Ga0207644_10016669 3300025931 Bacteria 4947
371 Ga0207644_10125946 3300025931 Bacteria 1955
372 Ga0207644_10606119 3300025931 Unclassified 909
373 Ga0207690_10004002 3300025932 Bacteria 8701
374 Ga0207690_10304407 3300025932 Bacteria 1248
375 Ga0207706_10000219 3300025933 Bacteria 62762
376 Ga0207706_10028982 3300025933 Bacteria 4943
377 Ga0207706_10096007 3300025933 Bacteria 2607
378 Ga0207706_10103939 3300025933 Bacteria 2499
379 Ga0207706_10317037 3300025933 Bacteria 1357
380 Ga0207686_10107010 3300025934 Unclassified 1879
381 Ga0207686_10452050 3300025934 Bacteria 988
382 Ga0207709_10049387 3300025935 Bacteria 2568
383 Ga0207709_10072574 3300025935 Unclassified 2190
384 Ga0207670_10099660 3300025936 Bacteria 2073
385 Ga0207670_10232005 3300025936 Bacteria 1418
386 Ga0207670_10895219 3300025936 Bacteria 743
387 Ga0207669_10002768 3300025937 Bacteria 7523
388 Ga0207669_10024022 3300025937 Bacteria 3269
389 Ga0207669_10417691 3300025937 Bacteria 1055
390 Ga0207669_10535457 3300025937 Bacteria 943
391 Ga0207704_10027688 3300025938 Bacteria 3132
392 Ga0207704_10056925 3300025938 Bacteria 2398
393 Ga0207704_10343905 3300025938 Bacteria 1159
394 Ga0207691_10001676 3300025940 Bacteria 21893
395 Ga0207691_10063829 3300025940 Bacteria 3339
396 Ga0207691_10086466 3300025940 Bacteria 2813
397 Ga0207691_10184364 3300025940 Bacteria 1822
398 Ga0207691_10222160 3300025940 Unclassified 1638
399 Ga0207691_10224439 3300025940 Bacteria 1628
400 Ga0207711_10050313 3300025941 Bacteria 3567
401 Ga0207711_10235943 3300025941 Bacteria 1676
402 Ga0207711_10370801 3300025941 Bacteria 1327
403 Ga0207711_10453998 3300025941 Unclassified 1193
404 Ga0207711_10517602 3300025941 Bacteria 1112
405 Ga0207711_10579413 3300025941 Unclassified 1047
406 Ga0207689_10005037 3300025942 Bacteria 11906
407 Ga0207689_10571856 3300025942 Bacteria 950
408 Ga0207661_10001718 3300025944 Bacteria 14980
409 Ga0207661_10110033 3300025944 Bacteria 2328
410 Ga0207661_10428618 3300025944 Bacteria 1202
411 Ga0207661_11050272 3300025944 Bacteria 750
412 Ga0207679_10048221 3300025945 Bacteria 3099
413 Ga0207679_10162611 3300025945 Bacteria 1829
414 Ga0207679_10165684 3300025945 Bacteria 1814
415 Ga0207679_10341994 3300025945 Unclassified 1301
416 Ga0207667_10009864 3300025949 Bacteria 11209
417 Ga0207667_10379941 3300025949 Bacteria 1439
418 Ga0207667_11083921 3300025949 Unclassified 785
419 Ga0207651_10006456 3300025960 Bacteria 6141
420 Ga0207651_10011031 3300025960 Bacteria 5036
421 Ga0207651_10125255 3300025960 Bacteria 1956
422 Ga0207651_10199966 3300025960 Bacteria 1601
423 Ga0207651_10270808 3300025960 Bacteria 1399
424 Ga0207651_11050040 3300025960 Bacteria 729
425 Ga0207651_11211288 3300025960 Bacteria 678
426 Ga0207712_10032506 3300025961 Unclassified 3523
427 Ga0207712_10442250 3300025961 Unclassified 1101
428 Ga0207712_11009979 3300025961 Unclassified 738
429 Ga0207668_10060085 3300025972 Unclassified 2666
430 Ga0207668_10260440 3300025972 Unclassified 1413
431 Ga0207640_10070040 3300025981 Unclassified 2357
432 Ga0207640_10249434 3300025981 Unclassified 1377
433 Ga0207640_10305864 3300025981 Bacteria 1260
434 Ga0207640_10318519 3300025981 Bacteria 1237
435 Ga0207640_10362995 3300025981 Bacteria 1168
436 Ga0207658_10018258 3300025986 Bacteria 4840
437 Ga0207658_10026505 3300025986 Bacteria 4063
438 Ga0207658_10342289 3300025986 Unclassified 1300
439 Ga0207677_10569688 3300026023 Unclassified 990
440 Ga0207703_10006392 3300026035 Bacteria 9420
441 Ga0207703_10167861 3300026035 Unclassified 1928
442 Ga0207703_11303603 3300026035 Bacteria 698
443 Ga0207639_10001625 3300026041 Bacteria 15122
444 Ga0207639_10594919 3300026041 Bacteria 1019
445 Ga0207639_10725371 3300026041 Bacteria 923
446 Ga0207678_10003817 3300026067 Bacteria 13555
447 Ga0207678_10042425 3300026067 Bacteria 3941
448 Ga0207678_10050844 3300026067 Bacteria 3580
449 Ga0207678_10140125 3300026067 Bacteria 2064
450 Ga0207678_10218462 3300026067 Bacteria 1631
451 Ga0207678_10287692 3300026067 Bacteria 1411
452 Ga0207678_10532406 3300026067 Unclassified 1026
453 Ga0207678_10867634 3300026067 Unclassified 798
454 Ga0207708_10057188 3300026075 Bacteria 2976
455 Ga0207708_10282979 3300026075 Unclassified 1344
456 Ga0207708_11347659 3300026075 Bacteria 626
457 Ga0207708_11601476 3300026075 Unclassified 572
458 Ga0207702_10010293 3300026078 Bacteria 7835
459 Ga0207641_10186133 3300026088 Bacteria 1905
460 Ga0207641_10449683 3300026088 Bacteria 1245
461 Ga0207641_10645128 3300026088 Unclassified 1039
462 Ga0207648_10003597 3300026089 Bacteria 16210
463 Ga0207648_10091008 3300026089 Unclassified 2667
464 Ga0207648_10160787 3300026089 Bacteria 1983
465 Ga0207648_10484456 3300026089 Bacteria 1130
466 Ga0207676_10062089 3300026095 Bacteria 2962
467 Ga0207676_10135373 3300026095 Bacteria 2101
468 Ga0207676_10153286 3300026095 Bacteria 1987
469 Ga0207674_10121473 3300026116 Bacteria 2580
470 Ga0207674_10181032 3300026116 Bacteria 2059
471 Ga0207675_100115533 3300026118 Bacteria 2536
472 Ga0207675_100448188 3300026118 Bacteria 1279
473 Ga0207675_100651884 3300026118 Bacteria 1059
474 Ga0207675_100684903 3300026118 Bacteria 1033
475 Ga0207683_10002113 3300026121 Bacteria 17472
476 Ga0207683_10002565 3300026121 Bacteria 15843
477 Ga0207683_10308607 3300026121 Unclassified 1448
478 Ga0207698_10126716 3300026142 Unclassified 2173
479 Ga0207428_10004183 3300027907 Bacteria 13832
480 Ga0207428_10047845 3300027907 Bacteria 3434
481 Ga0207428_10252871 3300027907 Bacteria 1314
482 Ga0268266_10008392 3300028379 Bacteria 9185
483 Ga0268265_11005841 3300028380 Unclassified 824
484 Ga0268265_11540510 3300028380 Unclassified 669
485 Ga0268264_10013683 3300028381 Bacteria 6679
486 Ga0268264_10175886 3300028381 Bacteria 1940
487 Ga0268264_10457716 3300028381 Bacteria 1237
488 Ga0307408_100070015 3300031548 Bacteria 2589
489 Ga0307405_10069483 3300031731 Bacteria 2258
490 Ga0307413_10057840 3300031824 Bacteria 2373
491 Ga0307413_10192783 3300031824 Unclassified 1464
492 Ga0307413_10469656 3300031824 Bacteria 1003
493 Ga0307413_10497766 3300031824 Bacteria 978
494 Ga0307413_10782743 3300031824 Unclassified 800
495 Ga0307410_10007757 3300031852 Bacteria 5899
496 Ga0307410_10024534 3300031852 Bacteria 3768
497 Ga0307406_10153838 3300031901 Unclassified 1644
498 Ga0307406_11022886 3300031901 Bacteria 710
499 Ga0307407_10349577 3300031903 Unclassified 1046
500 Ga0307412_10221980 3300031911 Bacteria 1449
501 Ga0307409_100024776 3300031995 Unclassified 4193
502 Ga0307409_100963559 3300031995 Unclassified 869
503 Ga0307416_100125936 3300032002 Bacteria 2294
504 Ga0307416_100276836 3300032002 Bacteria 1652
505 Ga0307416_100788725 3300032002 Unclassified 1045
506 Ga0307414_10055817 3300032004 Bacteria 2767
507 Ga0307414_10086248 3300032004 Unclassified 2316
508 Ga0307414_11162893 3300032004 Unclassified 714
509 Ga0307411_10022436 3300032005 Bacteria 3716
510 Ga0307415_100122865 3300032126 Bacteria 1950
511 Ga0307415_100526648 3300032126 Bacteria 1038
512 Ga0373949_0203189 3300035090 Bacteria 596
513 Ga0373941_0263286 3300035115 Bacteria 677
514 Ga0436365_1611331 3300039437 Bacteria 619
515 Ga0451835_0496515 3300041492 Bacteria 988
516 Ga0451853_0326133 3300041512 Bacteria 947
517 Ga0451853_1696582 3300041512 Bacteria 910
518 Ga0439441_031210 3300042001 Bacteria 1033
519 Ga0439452_086272 3300042010 Unclassified 681
520 Ga0439454_009635 3300042011 Bacteria 1258
521 Ga0439456_015881 3300042013 Bacteria 1574
522 Ga0439462_0073247 3300042015 Bacteria 931
523 Ga0450920_022472 3300042122 Bacteria 1222
524 Ga0450923_151877 3300042125 Bacteria 561
525 Ga0450896_001706 3300042133 Bacteria 2759
526 Ga0439434_0106924 3300042435 Bacteria 904
527 Ga0439444_0053144 3300042437 Bacteria 828
528 Ga0450916_044684 3300042530 Bacteria 683
529 Ga0439440_0085938 3300042993 Bacteria 838
530 Ga0451576_0246809 3300045051 Bacteria 1866
531 Ga0451576_0619941 3300045051 Bacteria 1137
532 Ga0496100_0519463 3300048903 Bacteria 919
533 Ga0496100_0842501 3300048903 Bacteria 719
534 Ga0496101_0894577 3300048904 Bacteria 699
535 Ga0496102_0122272 3300048905 Unclassified 2432
536 Ga0496102_0226040 3300048905 Unclassified 1765
537 Ga0496102_1334303 3300048905 Bacteria 636
538 Ga0496103_0017377 3300048906 Bacteria 4305
539 Ga0496103_0626475 3300048906 Bacteria 684
540 Ga0496104_0004172 3300048907 Bacteria 12542
541 Ga0496105_0003653 3300048908 Bacteria 11436
542 Ga0496106_0011772 3300048909 Bacteria 6457
543 Ga0496106_0915055 3300048909 Bacteria 692
544 Ga0496107_0020615 3300048910 Bacteria 4657
545 Ga0496108_0005527 3300048911 Bacteria 10225
546 Ga0496109_0004989 3300048912 Bacteria 11082
547 Ga0496109_0721017 3300048912 Bacteria 935
548 Ga0496110_0018192 3300048913 Bacteria 5888
549 Ga0496111_0018723 3300048914 Bacteria 4800
550 Ga0496112_0000128 3300048915 Bacteria 47314
551 Ga0496114_0222054 3300048917 Bacteria 1659
552 Ga0496114_0357039 3300048917 Bacteria 1293
553 Ga0496114_1240533 3300048917 Bacteria 632
554 Ga0501036_0182159 3300049572 Unclassified 1768
555 Ga0501037_0129549 3300049573 Unclassified 1810
556 Ga0501038_0130154 3300049574 Bacteria 2067
557 Ga0501039_0033391 3300049575 Bacteria 3968
558 Ga0501040_0015014 3300049576 Bacteria 5117
559 Ga0501041_0031027 3300049577 Bacteria 3227
560 Ga0501042_0842776 3300049578 Unclassified 667
561 Ga0501046_0097293 3300049580 Unclassified 2261
562 Ga0501068_0033386 3300049584 Unclassified 3065
563 Ga0501071_0017204 3300049587 Unclassified 4983
564 Ga0501072_0003433 3300049588 Bacteria 11934
565 Ga0501073_0042715 3300049589 Unclassified 3199
566 Ga0501074_0090580 3300049590 Unclassified 2190
567 Ga0501075_0023010 3300049591 Bacteria 4558
568 Ga0501076_0027124 3300049592 Bacteria 4443
569 Ga0501077_0008388 3300049593 Bacteria 6397
570 Ga0501249_064323 3300049679 Bacteria 852
571 Ga0501079_0018383 3300049741 Bacteria 5342
572 Ga0501080_0078907 3300049742 Bacteria 3061
573 Ga0501081_0004029 3300049743 Bacteria 9422
574 Ga0501083_0476327 3300049744 Unclassified 812
575 Ga0501044_0265258 3300049823 Unclassified 1655
576 Ga0501045_0024719 3300049824 Unclassified 4314
577 nmdc:mga03n38_84475_c1 3300050490 Bacteria 1499
578 nmdc:mga00v17_122369_c1 3300050491 Bacteria 1658
579 nmdc:mga00v17_256798_c1 3300050491 Bacteria 1133
580 nmdc:mga0k408_254918_c1 3300050493 Bacteria 1047
581 nmdc:mga0k408_30918_c1 3300050493 Bacteria 3055
582 nmdc:mga0k408_609101_c1 3300050493 Bacteria 644
583 nmdc:mga06z11_18396_c1 3300050494 Bacteria 3191
584 nmdc:mga06z11_23683_c1 3300050494 Bacteria 2888
585 nmdc:mga06z11_99892_c1 3300050494 Unclassified 1590
586 nmdc:mga04h51_5574_c1 3300050495 Bacteria 3215
587 nmdc:mga07m45_39922_c1 3300050496 Bacteria 2625
588 nmdc:mga07m45_542089_c1 3300050496 Bacteria 673
589 nmdc:mga05p37_103222_c1 3300050507 Bacteria 3510
590 nmdc:mga05p37_12916_c1 3300050507 Bacteria 9988
591 nmdc:mga05p37_61347_c1 3300050507 Bacteria 4629
592 nmdc:mga05p37_69299_c1 3300050507 Bacteria 4338
593 nmdc:mga05p37_728694_c1 3300050507 Bacteria 1097
594 nmdc:mga09592_174096_c1 3300050508 Unclassified 1861
595 nmdc:mga0qj67_269080_c1 3300050509 Bacteria 1382
596 nmdc:mga0qj67_456656_c1 3300050509 Bacteria 1029
597 nmdc:mga06r32_713718_c1 3300050510 Bacteria 968
598 nmdc:mga06r32_842078_c1 3300050510 Unclassified 876
599 nmdc:mga08y16_23043_c1 3300050511 Bacteria 6574
600 nmdc:mga08y16_518062_c1 3300050511 Bacteria 1210
601 nmdc:mga08y16_62039_c1 3300050511 Bacteria 3904
602 nmdc:mga08y16_634628_c1 3300050511 Bacteria 1074
603 nmdc:mga08y16_65605_c1 3300050511 Bacteria 3790
604 nmdc:mga08y16_7018_c1 3300050511 Bacteria 11816
605 nmdc:mga0n895_918166_c1 3300050512 Unclassified 860
606 nmdc:mga0rr50_32544_c1 3300050513 Bacteria 3716
607 nmdc:mga08x19_502107_c1 3300050514 Bacteria 856
608 nmdc:mga0a205_156672_c1 3300050515 Bacteria 2176
609 Ga0500568_0005753 3300053139 Bacteria 6348
610 Ga0501084_0041431 3300054114 Unclassified 3852
611 Ga0587073_0014554 3300059492 Bacteria 1402
612 Ga0587080_010817 3300059503 Bacteria 1352
613 Ga0587088_025243 3300059508 Unclassified 1024
614 Ga0501082_0020249 3300060353 Bacteria 5734
615 Ga0501082_1730408 3300060353 Bacteria 545
616 Ga0530510_0674378 3300061734 Unclassified 787

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_101121678 Ga0068853_1011216782 157
2 3300028380 Ga0268265_11005841 Ga0268265_110058411 157
3 3300026067 Ga0207678_10532406 Ga0207678_105324062 158
4 3300009176 Ga0105242_11849556 Ga0105242_118495561 159
5 3300014326 Ga0157380_10123070 Ga0157380_101230702 165
6 3300060353 Ga0501082_1730408 Ga0501082_1730408_18_518 166
7 2209111006 2214914668 2213973872 167
8 3300000043 ARcpr5yngRDRAFT_c001452 ARcpr5yngRDRAFT_0014523 167
9 3300000044 ARSoilOldRDRAFT_c003721 ARSoilOldRDRAFT_0037212 167
10 3300000652 ARCol0yngRDRAFT_1001318 ARCol0yngRDRAFT_10013183 167
11 3300005288 Ga0065714_10108127 Ga0065714_101081271 167
12 3300005290 Ga0065712_10015439 Ga0065712_100154392 167
13 3300005290 Ga0065712_10071300 Ga0065712_100713003 167
14 3300005293 Ga0065715_10039893 Ga0065715_100398932 167
15 3300005293 Ga0065715_10171781 Ga0065715_101717812 167
16 3300005328 Ga0070676_10317341 Ga0070676_103173412 167
17 3300005328 Ga0070676_10339610 Ga0070676_103396102 167
18 3300005329 Ga0070683_100001000 Ga0070683_10000100017 167
19 3300005329 Ga0070683_100065612 Ga0070683_1000656122 167
20 3300005329 Ga0070683_101221949 Ga0070683_1012219491 167
21 3300005330 Ga0070690_100014476 Ga0070690_1000144764 167
22 3300005331 Ga0070670_100109640 Ga0070670_1001096402 167
23 3300005331 Ga0070670_100140026 Ga0070670_1001400263 167
24 3300005334 Ga0068869_100554294 Ga0068869_1005542942 167
25 3300005335 Ga0070666_10332195 Ga0070666_103321952 167
26 3300005336 Ga0070680_100030389 Ga0070680_1000303895 167
27 3300005336 Ga0070680_100338788 Ga0070680_1003387881 167
28 3300005336 Ga0070680_100373260 Ga0070680_1003732601 167
29 3300005336 Ga0070680_101563442 Ga0070680_1015634421 167
30 3300005337 Ga0070682_100018353 Ga0070682_1000183534 167
31 3300005338 Ga0068868_100609508 Ga0068868_1006095082 167
32 3300005341 Ga0070691_10015617 Ga0070691_100156175 167
33 3300005341 Ga0070691_10300663 Ga0070691_103006631 167
34 3300005343 Ga0070687_100038930 Ga0070687_1000389303 167
35 3300005343 Ga0070687_100340490 Ga0070687_1003404902 167
36 3300005344 Ga0070661_100013334 Ga0070661_1000133345 167
37 3300005345 Ga0070692_10007733 Ga0070692_100077334 167
38 3300005347 Ga0070668_100063226 Ga0070668_1000632262 167
39 3300005347 Ga0070668_100244092 Ga0070668_1002440922 167
40 3300005347 Ga0070668_100291494 Ga0070668_1002914942 167
41 3300005353 Ga0070669_100083179 Ga0070669_1000831791 167
42 3300005353 Ga0070669_101112315 Ga0070669_1011123151 167
43 3300005354 Ga0070675_100387460 Ga0070675_1003874602 167
44 3300005355 Ga0070671_100119327 Ga0070671_1001193272 167
45 3300005355 Ga0070671_100640755 Ga0070671_1006407551 167
46 3300005364 Ga0070673_100153819 Ga0070673_1001538192 167
47 3300005364 Ga0070673_101025961 Ga0070673_1010259611 167
48 3300005366 Ga0070659_100065634 Ga0070659_1000656343 167
49 3300005367 Ga0070667_100193162 Ga0070667_1001931623 167
50 3300005367 Ga0070667_100591504 Ga0070667_1005915042 167
51 3300005438 Ga0070701_10648344 Ga0070701_106483441 167
52 3300005439 Ga0070711_100417246 Ga0070711_1004172461 167
53 3300005441 Ga0070700_100015909 Ga0070700_1000159094 167
54 3300005441 Ga0070700_100056930 Ga0070700_1000569303 167
55 3300005441 Ga0070700_100598304 Ga0070700_1005983041 167
56 3300005441 Ga0070700_100602759 Ga0070700_1006027591 167
57 3300005441 Ga0070700_100902370 Ga0070700_1009023701 167
58 3300005444 Ga0070694_100171006 Ga0070694_1001710062 167
59 3300005455 Ga0070663_100028201 Ga0070663_1000282013 167
60 3300005455 Ga0070663_101521468 Ga0070663_1015214681 167
61 3300005456 Ga0070678_100276767 Ga0070678_1002767671 167
62 3300005456 Ga0070678_100885733 Ga0070678_1008857331 167
63 3300005457 Ga0070662_100026981 Ga0070662_1000269812 167
64 3300005457 Ga0070662_100080277 Ga0070662_1000802772 167
65 3300005457 Ga0070662_100089958 Ga0070662_1000899582 167
66 3300005458 Ga0070681_10075157 Ga0070681_100751575 167
67 3300005458 Ga0070681_10337799 Ga0070681_103377991 167
68 3300005459 Ga0068867_100254943 Ga0068867_1002549432 167
69 3300005459 Ga0068867_100814593 Ga0068867_1008145932 167
70 3300005466 Ga0070685_10091484 Ga0070685_100914842 167
71 3300005518 Ga0070699_100568064 Ga0070699_1005680641 167
72 3300005530 Ga0070679_100065393 Ga0070679_1000653934 167
73 3300005535 Ga0070684_100002014 Ga0070684_1000020146 167
74 3300005535 Ga0070684_100563507 Ga0070684_1005635071 167
75 3300005539 Ga0068853_100989011 Ga0068853_1009890111 167
76 3300005539 Ga0068853_101049058 Ga0068853_1010490582 167
77 3300005543 Ga0070672_100020589 Ga0070672_1000205894 167
78 3300005543 Ga0070672_100718002 Ga0070672_1007180022 167
79 3300005544 Ga0070686_100107038 Ga0070686_1001070382 167
80 3300005544 Ga0070686_100283359 Ga0070686_1002833592 167
81 3300005545 Ga0070695_100042162 Ga0070695_1000421623 167
82 3300005546 Ga0070696_100161749 Ga0070696_1001617493 167
83 3300005547 Ga0070693_100078459 Ga0070693_1000784592 167
84 3300005548 Ga0070665_101764352 Ga0070665_1017643521 167
85 3300005563 Ga0068855_101362343 Ga0068855_1013623431 167
86 3300005564 Ga0070664_100001191 Ga0070664_10000119130 167
87 3300005564 Ga0070664_100010322 Ga0070664_1000103226 167
88 3300005564 Ga0070664_100152079 Ga0070664_1001520792 167
89 3300005564 Ga0070664_100446563 Ga0070664_1004465631 167
90 3300005577 Ga0068857_100103226 Ga0068857_1001032263 167
91 3300005577 Ga0068857_100118739 Ga0068857_1001187392 167
92 3300005578 Ga0068854_100911735 Ga0068854_1009117351 167
93 3300005614 Ga0068856_100557339 Ga0068856_1005573391 167
94 3300005615 Ga0070702_100051333 Ga0070702_1000513332 167
95 3300005617 Ga0068859_100299917 Ga0068859_1002999172 167
96 3300005618 Ga0068864_100039795 Ga0068864_1000397954 167
97 3300005618 Ga0068864_100044705 Ga0068864_1000447052 167
98 3300005618 Ga0068864_100386575 Ga0068864_1003865752 167
99 3300005718 Ga0068866_10293293 Ga0068866_102932932 167
100 3300005718 Ga0068866_10362316 Ga0068866_103623162 167
101 3300005718 Ga0068866_10613316 Ga0068866_106133161 167
102 3300005719 Ga0068861_100113855 Ga0068861_1001138553 167
103 3300005719 Ga0068861_100253547 Ga0068861_1002535472 167
104 3300005719 Ga0068861_100368083 Ga0068861_1003680833 167
105 3300005840 Ga0068870_10502920 Ga0068870_105029202 167
106 3300005841 Ga0068863_100851760 Ga0068863_1008517601 167
107 3300005842 Ga0068858_100518474 Ga0068858_1005184741 167
108 3300005842 Ga0068858_100828281 Ga0068858_1008282811 167
109 3300005843 Ga0068860_100158474 Ga0068860_1001584742 167
110 3300005844 Ga0068862_100025864 Ga0068862_1000258643 167
111 3300006058 Ga0075432_10002038 Ga0075432_100020385 167
112 3300006058 Ga0075432_10116839 Ga0075432_101168392 167
113 3300006844 Ga0075428_100021566 Ga0075428_1000215664 167
114 3300006844 Ga0075428_100204960 Ga0075428_1002049602 167
115 3300006852 Ga0075433_10140646 Ga0075433_101406463 167
116 3300006871 Ga0075434_100976746 Ga0075434_1009767461 167
117 3300006880 Ga0075429_100633856 Ga0075429_1006338562 167
118 3300006881 Ga0068865_100065405 Ga0068865_1000654052 167
119 3300006881 Ga0068865_100153580 Ga0068865_1001535802 167
120 3300006931 Ga0097620_100299920 Ga0097620_1002999202 167
121 3300007076 Ga0075435_100006040 Ga0075435_1000060407 167
122 3300009094 Ga0111539_10080502 Ga0111539_100805023 167
123 3300009094 Ga0111539_10193964 Ga0111539_101939642 167
124 3300009094 Ga0111539_10484912 Ga0111539_104849122 167
125 3300009098 Ga0105245_10015486 Ga0105245_100154865 167
126 3300009147 Ga0114129_10019183 Ga0114129_100191835 167
127 3300009147 Ga0114129_10365854 Ga0114129_103658542 167
128 3300009147 Ga0114129_10579456 Ga0114129_105794563 167
129 3300009148 Ga0105243_10029240 Ga0105243_100292403 167
130 3300009148 Ga0105243_10065131 Ga0105243_100651314 167
131 3300009148 Ga0105243_10124002 Ga0105243_101240022 167
132 3300009174 Ga0105241_10034415 Ga0105241_100344153 167
133 3300009176 Ga0105242_10012710 Ga0105242_100127104 167
134 3300009176 Ga0105242_10024384 Ga0105242_100243844 167
135 3300009177 Ga0105248_10003724 Ga0105248_100037243 167
136 3300009177 Ga0105248_10062496 Ga0105248_100624964 167
137 3300009177 Ga0105248_10684367 Ga0105248_106843671 167
138 3300009553 Ga0105249_10037113 Ga0105249_100371132 167
139 3300009553 Ga0105249_10257340 Ga0105249_102573403 167
140 3300009553 Ga0105249_10346235 Ga0105249_103462352 167
141 3300010375 Ga0105239_10112907 Ga0105239_101129073 167
142 3300010375 Ga0105239_10289132 Ga0105239_102891321 167
143 3300010375 Ga0105239_11534316 Ga0105239_115343161 167
144 3300011119 Ga0105246_10216157 Ga0105246_102161572 167
145 3300012482 Ga0157318_1000751 Ga0157318_10007512 167
146 3300012497 Ga0157319_1014951 Ga0157319_10149511 167
147 3300012508 Ga0157315_1027216 Ga0157315_10272161 167
148 3300013102 Ga0157371_10585129 Ga0157371_105851291 167
149 3300013296 Ga0157374_10024270 Ga0157374_100242705 167
150 3300013297 Ga0157378_10268321 Ga0157378_102683212 167
151 3300013306 Ga0163162_10295303 Ga0163162_102953031 167
152 3300013307 Ga0157372_10088937 Ga0157372_100889374 167
153 3300013308 Ga0157375_10377729 Ga0157375_103777292 167
154 3300013308 Ga0157375_10885692 Ga0157375_108856922 167
155 3300014325 Ga0163163_10020594 Ga0163163_100205944 167
156 3300014325 Ga0163163_10047937 Ga0163163_100479373 167
157 3300014326 Ga0157380_10006025 Ga0157380_100060259 167
158 3300014326 Ga0157380_10130260 Ga0157380_101302602 167
159 3300014745 Ga0157377_10121566 Ga0157377_101215663 167
160 3300014968 Ga0157379_11094418 Ga0157379_110944181 167
161 3300020077 Ga0206351_10940915 Ga0206351_109409151 167
162 3300020080 Ga0206350_11192982 Ga0206350_111929821 167
163 3300025893 Ga0207682_10135441 Ga0207682_101354412 167
164 3300025901 Ga0207688_10019315 Ga0207688_100193153 167
165 3300025903 Ga0207680_10021092 Ga0207680_100210923 167
166 3300025904 Ga0207647_10161473 Ga0207647_101614732 167
167 3300025907 Ga0207645_10113431 Ga0207645_101134313 167
168 3300025907 Ga0207645_10118507 Ga0207645_101185072 167
169 3300025908 Ga0207643_10450280 Ga0207643_104502801 167
170 3300025912 Ga0207707_10060647 Ga0207707_100606475 167
171 3300025917 Ga0207660_10054061 Ga0207660_100540612 167
172 3300025917 Ga0207660_10369486 Ga0207660_103694862 167
173 3300025918 Ga0207662_10034269 Ga0207662_100342692 167
174 3300025920 Ga0207649_10434050 Ga0207649_104340501 167
175 3300025920 Ga0207649_10709383 Ga0207649_107093832 167
176 3300025920 Ga0207649_11312283 Ga0207649_113122831 167
177 3300025923 Ga0207681_10178947 Ga0207681_101789472 167
178 3300025923 Ga0207681_10640829 Ga0207681_106408291 167
179 3300025923 Ga0207681_10818963 Ga0207681_108189632 167
180 3300025925 Ga0207650_10013311 Ga0207650_100133119 167
181 3300025925 Ga0207650_10030949 Ga0207650_100309492 167
182 3300025926 Ga0207659_10338728 Ga0207659_103387281 167
183 3300025927 Ga0207687_10138613 Ga0207687_101386132 167
184 3300025931 Ga0207644_10125946 Ga0207644_101259462 167
185 3300025932 Ga0207690_10304407 Ga0207690_103044071 167
186 3300025933 Ga0207706_10028982 Ga0207706_100289824 167
187 3300025933 Ga0207706_10096007 Ga0207706_100960072 167
188 3300025933 Ga0207706_10103939 Ga0207706_101039392 167
189 3300025934 Ga0207686_10107010 Ga0207686_101070102 167
190 3300025935 Ga0207709_10049387 Ga0207709_100493874 167
191 3300025935 Ga0207709_10072574 Ga0207709_100725742 167
192 3300025936 Ga0207670_10232005 Ga0207670_102320052 167
193 3300025936 Ga0207670_10895219 Ga0207670_108952191 167
194 3300025938 Ga0207704_10027688 Ga0207704_100276883 167
195 3300025940 Ga0207691_10086466 Ga0207691_100864662 167
196 3300025940 Ga0207691_10224439 Ga0207691_102244392 167
197 3300025941 Ga0207711_10050313 Ga0207711_100503134 167
198 3300025942 Ga0207689_10571856 Ga0207689_105718561 167
199 3300025944 Ga0207661_10001718 Ga0207661_1000171818 167
200 3300025944 Ga0207661_10110033 Ga0207661_101100333 167
201 3300025945 Ga0207679_10048221 Ga0207679_100482212 167
202 3300025945 Ga0207679_10162611 Ga0207679_101626112 167
203 3300025945 Ga0207679_10341994 Ga0207679_103419942 167
204 3300025949 Ga0207667_10379941 Ga0207667_103799413 167
205 3300025949 Ga0207667_11083921 Ga0207667_110839211 167
206 3300025960 Ga0207651_10125255 Ga0207651_101252554 167
207 3300025960 Ga0207651_10270808 Ga0207651_102708082 167
208 3300025961 Ga0207712_10032506 Ga0207712_100325063 167
209 3300025961 Ga0207712_10442250 Ga0207712_104422502 167
210 3300025972 Ga0207668_10260440 Ga0207668_102604402 167
211 3300025981 Ga0207640_10249434 Ga0207640_102494342 167
212 3300025981 Ga0207640_10318519 Ga0207640_103185192 167
213 3300025986 Ga0207658_10018258 Ga0207658_100182582 167
214 3300026023 Ga0207677_10569688 Ga0207677_105696882 167
215 3300026035 Ga0207703_10167861 Ga0207703_101678612 167
216 3300026035 Ga0207703_11303603 Ga0207703_113036031 167
217 3300026041 Ga0207639_10594919 Ga0207639_105949192 167
218 3300026067 Ga0207678_10042425 Ga0207678_100424251 167
219 3300026067 Ga0207678_10218462 Ga0207678_102184622 167
220 3300026075 Ga0207708_10057188 Ga0207708_100571882 167
221 3300026075 Ga0207708_10282979 Ga0207708_102829793 167
222 3300026075 Ga0207708_11601476 Ga0207708_116014761 167
223 3300026089 Ga0207648_10160787 Ga0207648_101607872 167
224 3300026089 Ga0207648_10484456 Ga0207648_104844562 167
225 3300026095 Ga0207676_10153286 Ga0207676_101532861 167
226 3300026116 Ga0207674_10121473 Ga0207674_101214732 167
227 3300026116 Ga0207674_10181032 Ga0207674_101810322 167
228 3300027907 Ga0207428_10004183 Ga0207428_100041839 167
229 3300027907 Ga0207428_10047845 Ga0207428_100478453 167
230 3300028380 Ga0268265_11540510 Ga0268265_115405101 167
231 3300028381 Ga0268264_10457716 Ga0268264_104577162 167
232 3300031731 Ga0307405_10069483 Ga0307405_100694832 167
233 3300031824 Ga0307413_10057840 Ga0307413_100578402 167
234 3300031824 Ga0307413_10497766 Ga0307413_104977662 167
235 3300031852 Ga0307410_10024534 Ga0307410_100245344 167
236 3300031901 Ga0307406_10153838 Ga0307406_101538381 167
237 3300031903 Ga0307407_10349577 Ga0307407_103495771 167
238 3300031911 Ga0307412_10221980 Ga0307412_102219802 167
239 3300031995 Ga0307409_100963559 Ga0307409_1009635591 167
240 3300032002 Ga0307416_100125936 Ga0307416_1001259361 167
241 3300032002 Ga0307416_100276836 Ga0307416_1002768361 167
242 3300032004 Ga0307414_10055817 Ga0307414_100558173 167
243 3300032004 Ga0307414_11162893 Ga0307414_111628931 167
244 3300032005 Ga0307411_10022436 Ga0307411_100224362 167
245 3300032126 Ga0307415_100122865 Ga0307415_1001228652 167
246 3300035090 Ga0373949_0203189 Ga0373949_0203189_57_560 167
247 3300035115 Ga0373941_0263286 Ga0373941_0263286_82_585 167
248 3300042001 Ga0439441_031210 Ga0439441_031210_223_726 167
249 3300042011 Ga0439454_009635 Ga0439454_009635_163_666 167
250 3300042015 Ga0439462_0073247 Ga0439462_0073247_381_884 167
251 3300042122 Ga0450920_022472 Ga0450920_022472_359_886 167
252 3300042125 Ga0450923_151877 Ga0450923_151877_21_524 167
253 3300042133 Ga0450896_001706 Ga0450896_001706_195_722 167
254 3300042435 Ga0439434_0106924 Ga0439434_0106924_232_735 167
255 3300042437 Ga0439444_0053144 Ga0439444_0053144_164_667 167
256 3300042993 Ga0439440_0085938 Ga0439440_0085938_12_515 167
257 3300045051 Ga0451576_0246809 Ga0451576_0246809_1343_1846 167
258 3300045051 Ga0451576_0619941 Ga0451576_0619941_211_714 167
259 3300048903 Ga0496100_0519463 Ga0496100_0519463_320_823 167
260 3300048905 Ga0496102_1334303 Ga0496102_1334303_81_584 167
261 3300048906 Ga0496103_0626475 Ga0496103_0626475_69_572 167
262 3300048907 Ga0496104_0004172 Ga0496104_0004172_11448_11951 167
263 3300048908 Ga0496105_0003653 Ga0496105_0003653_1725_2228 167
264 3300048909 Ga0496106_0915055 Ga0496106_0915055_83_586 167
265 3300048911 Ga0496108_0005527 Ga0496108_0005527_7912_8415 167
266 3300048912 Ga0496109_0004989 Ga0496109_0004989_88_591 167
267 3300048913 Ga0496110_0018192 Ga0496110_0018192_3733_4236 167
268 3300048914 Ga0496111_0018723 Ga0496111_0018723_652_1155 167
269 3300048915 Ga0496112_0000128 Ga0496112_0000128_21380_21883 167
270 3300048917 Ga0496114_0357039 Ga0496114_0357039_387_890 167
271 3300048917 Ga0496114_1240533 Ga0496114_1240533_53_556 167
272 3300049679 Ga0501249_064323 Ga0501249_064323_19_522 167
273 3300050507 nmdc:mga05p37_12916_c1 nmdc:mga05p37_12916_c1_7782_8285 167
274 3300050507 nmdc:mga05p37_61347_c1 nmdc:mga05p37_61347_c1_3099_3602 167
275 3300050507 nmdc:mga05p37_69299_c1 nmdc:mga05p37_69299_c1_328_831 167
276 3300050507 nmdc:mga05p37_728694_c1 nmdc:mga05p37_728694_c1_313_816 167
277 3300050509 nmdc:mga0qj67_269080_c1 nmdc:mga0qj67_269080_c1_84_587 167
278 3300050509 nmdc:mga0qj67_456656_c1 nmdc:mga0qj67_456656_c1_341_844 167
279 3300050510 nmdc:mga06r32_713718_c1 nmdc:mga06r32_713718_c1_28_531 167
280 3300050511 nmdc:mga08y16_23043_c1 nmdc:mga08y16_23043_c1_2309_2812 167
281 3300050511 nmdc:mga08y16_62039_c1 nmdc:mga08y16_62039_c1_1053_1556 167
282 3300050511 nmdc:mga08y16_65605_c1 nmdc:mga08y16_65605_c1_1293_1796 167
283 3300050511 nmdc:mga08y16_7018_c1 nmdc:mga08y16_7018_c1_9773_10276 167
284 3300050512 nmdc:mga0n895_918166_c1 nmdc:mga0n895_918166_c1_38_541 167
285 3300050513 nmdc:mga0rr50_32544_c1 nmdc:mga0rr50_32544_c1_344_847 167
286 3300050514 nmdc:mga08x19_502107_c1 nmdc:mga08x19_502107_c1_267_770 167
287 3300050515 nmdc:mga0a205_156672_c1 nmdc:mga0a205_156672_c1_779_1282 167
288 3300059492 Ga0587073_0014554 Ga0587073_0014554_494_997 167
289 3300059503 Ga0587080_010817 Ga0587080_010817_399_902 167
290 3300059508 Ga0587088_025243 Ga0587088_025243_114_617 167
291 3300005327 Ga0070658_11383248 Ga0070658_113832481 168
292 3300005328 Ga0070676_10001487 Ga0070676_100014873 168
293 3300005330 Ga0070690_100046096 Ga0070690_1000460963 168
294 3300005330 Ga0070690_100509954 Ga0070690_1005099542 168
295 3300005331 Ga0070670_100043521 Ga0070670_1000435213 168
296 3300005331 Ga0070670_101202757 Ga0070670_1012027571 168
297 3300005334 Ga0068869_100015138 Ga0068869_1000151381 168
298 3300005335 Ga0070666_10019278 Ga0070666_100192784 168
299 3300005335 Ga0070666_10020885 Ga0070666_100208853 168
300 3300005335 Ga0070666_10460252 Ga0070666_104602522 168
301 3300005338 Ga0068868_100055228 Ga0068868_1000552282 168
302 3300005339 Ga0070660_100003048 Ga0070660_1000030485 168
303 3300005340 Ga0070689_100035358 Ga0070689_1000353582 168
304 3300005345 Ga0070692_10502139 Ga0070692_105021392 168
305 3300005347 Ga0070668_100585634 Ga0070668_1005856341 168
306 3300005353 Ga0070669_100004979 Ga0070669_1000049796 168
307 3300005353 Ga0070669_100095343 Ga0070669_1000953432 168
308 3300005354 Ga0070675_100028143 Ga0070675_1000281433 168
309 3300005355 Ga0070671_100010564 Ga0070671_1000105646 168
310 3300005356 Ga0070674_100007020 Ga0070674_1000070205 168
311 3300005356 Ga0070674_100405551 Ga0070674_1004055512 168
312 3300005364 Ga0070673_100004148 Ga0070673_1000041487 168
313 3300005364 Ga0070673_100007827 Ga0070673_1000078274 168
314 3300005364 Ga0070673_100252461 Ga0070673_1002524612 168
315 3300005365 Ga0070688_100047455 Ga0070688_1000474553 168
316 3300005366 Ga0070659_100000725 Ga0070659_10000072517 168
317 3300005367 Ga0070667_100011331 Ga0070667_1000113313 168
318 3300005367 Ga0070667_100382699 Ga0070667_1003826992 168
319 3300005455 Ga0070663_100031144 Ga0070663_1000311443 168
320 3300005455 Ga0070663_100420451 Ga0070663_1004204511 168
321 3300005456 Ga0070678_100198527 Ga0070678_1001985271 168
322 3300005457 Ga0070662_100002254 Ga0070662_1000022549 168
323 3300005458 Ga0070681_10056134 Ga0070681_100561344 168
324 3300005459 Ga0068867_100002587 Ga0068867_1000025877 168
325 3300005530 Ga0070679_100287104 Ga0070679_1002871043 168
326 3300005535 Ga0070684_100011230 Ga0070684_1000112303 168
327 3300005539 Ga0068853_100015152 Ga0068853_1000151523 168
328 3300005543 Ga0070672_100057584 Ga0070672_1000575844 168
329 3300005544 Ga0070686_100000375 Ga0070686_10000037521 168
330 3300005548 Ga0070665_100010852 Ga0070665_1000108528 168
331 3300005563 Ga0068855_100022327 Ga0068855_1000223275 168
332 3300005564 Ga0070664_100000114 Ga0070664_10000011430 168
333 3300005578 Ga0068854_100012913 Ga0068854_1000129135 168
334 3300005578 Ga0068854_100231819 Ga0068854_1002318193 168
335 3300005614 Ga0068856_100007822 Ga0068856_10000782211 168
336 3300005615 Ga0070702_100240139 Ga0070702_1002401391 168
337 3300005616 Ga0068852_100152956 Ga0068852_1001529562 168
338 3300005617 Ga0068859_100011781 Ga0068859_1000117815 168
339 3300005618 Ga0068864_100315555 Ga0068864_1003155552 168
340 3300005718 Ga0068866_10089598 Ga0068866_100895981 168
341 3300005719 Ga0068861_100979376 Ga0068861_1009793761 168
342 3300005834 Ga0068851_10147618 Ga0068851_101476182 168
343 3300005834 Ga0068851_10586971 Ga0068851_105869711 168
344 3300005841 Ga0068863_100032965 Ga0068863_1000329653 168
345 3300005842 Ga0068858_100010864 Ga0068858_1000108643 168
346 3300005843 Ga0068860_100009059 Ga0068860_1000090597 168
347 3300005843 Ga0068860_100571045 Ga0068860_1005710452 168
348 3300006237 Ga0097621_100793336 Ga0097621_1007933362 168
349 3300006358 Ga0068871_100001944 Ga0068871_1000019447 168
350 3300006881 Ga0068865_100013065 Ga0068865_1000130655 168
351 3300006931 Ga0097620_100011782 Ga0097620_1000117826 168
352 3300009177 Ga0105248_10113195 Ga0105248_101131955 168
353 3300009177 Ga0105248_10698889 Ga0105248_106988892 168
354 3300009551 Ga0105238_10271288 Ga0105238_102712882 168
355 3300009553 Ga0105249_10124466 Ga0105249_101244663 168
356 3300013100 Ga0157373_10004088 Ga0157373_100040889 168
357 3300013102 Ga0157371_10006712 Ga0157371_100067127 168
358 3300013296 Ga0157374_10005208 Ga0157374_100052087 168
359 3300013297 Ga0157378_10169969 Ga0157378_101699693 168
360 3300013306 Ga0163162_10022490 Ga0163162_100224903 168
361 3300013307 Ga0157372_10008721 Ga0157372_100087219 168
362 3300014325 Ga0163163_11478215 Ga0163163_114782151 168
363 3300014968 Ga0157379_10004109 Ga0157379_100041095 168
364 3300014969 Ga0157376_10010996 Ga0157376_100109968 168
365 3300014969 Ga0157376_10430592 Ga0157376_104305922 168
366 3300017792 Ga0163161_10147057 Ga0163161_101470573 168
367 3300025290 Ga0207673_1049399 Ga0207673_10493991 168
368 3300025315 Ga0207697_10041412 Ga0207697_100414122 168
369 3300025903 Ga0207680_10003033 Ga0207680_100030333 168
370 3300025903 Ga0207680_10050528 Ga0207680_100505282 168
371 3300025903 Ga0207680_10519998 Ga0207680_105199982 168
372 3300025907 Ga0207645_10002100 Ga0207645_1000210015 168
373 3300025908 Ga0207643_10407083 Ga0207643_104070832 168
374 3300025909 Ga0207705_11003546 Ga0207705_110035461 168
375 3300025912 Ga0207707_10363187 Ga0207707_103631872 168
376 3300025918 Ga0207662_10010192 Ga0207662_100101923 168
377 3300025919 Ga0207657_10000533 Ga0207657_1000053319 168
378 3300025919 Ga0207657_10550610 Ga0207657_105506102 168
379 3300025920 Ga0207649_10007195 Ga0207649_100071957 168
380 3300025923 Ga0207681_10003378 Ga0207681_100033787 168
381 3300025923 Ga0207681_10151214 Ga0207681_101512142 168
382 3300025924 Ga0207694_10457288 Ga0207694_104572882 168
383 3300025924 Ga0207694_10567075 Ga0207694_105670752 168
384 3300025925 Ga0207650_10081359 Ga0207650_100813592 168
385 3300025926 Ga0207659_10008656 Ga0207659_100086565 168
386 3300025926 Ga0207659_10029224 Ga0207659_100292242 168
387 3300025931 Ga0207644_10016669 Ga0207644_100166696 168
388 3300025931 Ga0207644_10606119 Ga0207644_106061191 168
389 3300025932 Ga0207690_10004002 Ga0207690_100040028 168
390 3300025933 Ga0207706_10000219 Ga0207706_1000021930 168
391 3300025936 Ga0207670_10099660 Ga0207670_100996602 168
392 3300025937 Ga0207669_10002768 Ga0207669_100027687 168
393 3300025937 Ga0207669_10417691 Ga0207669_104176912 168
394 3300025938 Ga0207704_10056925 Ga0207704_100569251 168
395 3300025940 Ga0207691_10001676 Ga0207691_100016768 168
396 3300025941 Ga0207711_10235943 Ga0207711_102359433 168
397 3300025941 Ga0207711_10453998 Ga0207711_104539982 168
398 3300025942 Ga0207689_10005037 Ga0207689_100050376 168
399 3300025949 Ga0207667_10009864 Ga0207667_100098648 168
400 3300025960 Ga0207651_10006456 Ga0207651_100064563 168
401 3300025960 Ga0207651_10011031 Ga0207651_100110312 168
402 3300025972 Ga0207668_10060085 Ga0207668_100600853 168
403 3300025981 Ga0207640_10070040 Ga0207640_100700402 168
404 3300025981 Ga0207640_10305864 Ga0207640_103058642 168
405 3300025986 Ga0207658_10026505 Ga0207658_100265054 168
406 3300025986 Ga0207658_10342289 Ga0207658_103422892 168
407 3300026035 Ga0207703_10006392 Ga0207703_100063925 168
408 3300026041 Ga0207639_10001625 Ga0207639_1000162512 168
409 3300026067 Ga0207678_10003817 Ga0207678_100038178 168
410 3300026067 Ga0207678_10287692 Ga0207678_102876922 168
411 3300026078 Ga0207702_10010293 Ga0207702_100102933 168
412 3300026088 Ga0207641_10645128 Ga0207641_106451281 168
413 3300026089 Ga0207648_10003597 Ga0207648_1000359711 168
414 3300026095 Ga0207676_10062089 Ga0207676_100620893 168
415 3300026118 Ga0207675_100115533 Ga0207675_1001155332 168
416 3300026121 Ga0207683_10002113 Ga0207683_1000211311 168
417 3300026121 Ga0207683_10308607 Ga0207683_103086072 168
418 3300026142 Ga0207698_10126716 Ga0207698_101267162 168
419 3300028379 Ga0268266_10008392 Ga0268266_100083922 168
420 3300028381 Ga0268264_10013683 Ga0268264_100136837 168
421 3300041492 Ga0451835_0496515 Ga0451835_0496515_139_645 168
422 3300048903 Ga0496100_0842501 Ga0496100_0842501_106_612 168
423 3300048904 Ga0496101_0894577 Ga0496101_0894577_101_607 168
424 3300048905 Ga0496102_0122272 Ga0496102_0122272_1307_1825 168
425 3300048905 Ga0496102_0226040 Ga0496102_0226040_759_1265 168
426 3300048906 Ga0496103_0017377 Ga0496103_0017377_838_1344 168
427 3300048909 Ga0496106_0011772 Ga0496106_0011772_2687_3193 168
428 3300048910 Ga0496107_0020615 Ga0496107_0020615_3036_3542 168
429 3300048917 Ga0496114_0222054 Ga0496114_0222054_723_1229 168
430 3300049572 Ga0501036_0182159 Ga0501036_0182159_45_578 168
431 3300049573 Ga0501037_0129549 Ga0501037_0129549_229_762 168
432 3300049574 Ga0501038_0130154 Ga0501038_0130154_358_891 168
433 3300049575 Ga0501039_0033391 Ga0501039_0033391_324_857 168
434 3300049576 Ga0501040_0015014 Ga0501040_0015014_3821_4354 168
435 3300049577 Ga0501041_0031027 Ga0501041_0031027_606_1139 168
436 3300049578 Ga0501042_0842776 Ga0501042_0842776_15_548 168
437 3300049580 Ga0501046_0097293 Ga0501046_0097293_868_1401 168
438 3300049584 Ga0501068_0033386 Ga0501068_0033386_151_684 168
439 3300049587 Ga0501071_0017204 Ga0501071_0017204_3423_3956 168
440 3300049588 Ga0501072_0003433 Ga0501072_0003433_1701_2234 168
441 3300049589 Ga0501073_0042715 Ga0501073_0042715_705_1238 168
442 3300049590 Ga0501074_0090580 Ga0501074_0090580_638_1171 168
443 3300049591 Ga0501075_0023010 Ga0501075_0023010_1997_2530 168
444 3300049592 Ga0501076_0027124 Ga0501076_0027124_3121_3654 168
445 3300049593 Ga0501077_0008388 Ga0501077_0008388_4094_4627 168
446 3300049741 Ga0501079_0018383 Ga0501079_0018383_1310_1843 168
447 3300049742 Ga0501080_0078907 Ga0501080_0078907_1214_1747 168
448 3300049743 Ga0501081_0004029 Ga0501081_0004029_5449_5982 168
449 3300049744 Ga0501083_0476327 Ga0501083_0476327_12_545 168
450 3300049823 Ga0501044_0265258 Ga0501044_0265258_790_1323 168
451 3300049824 Ga0501045_0024719 Ga0501045_0024719_2964_3497 168
452 3300054114 Ga0501084_0041431 Ga0501084_0041431_2565_3098 168
453 3300060353 Ga0501082_0020249 Ga0501082_0020249_3556_4089 168
454 3300061734 Ga0530510_0674378 Ga0530510_0674378_124_657 168
455 3300005546 Ga0070696_100120447 Ga0070696_1001204471 169
456 3300006042 Ga0075368_10008568 Ga0075368_100085682 169
457 3300006051 Ga0075364_10590998 Ga0075364_105909982 169
458 3300006178 Ga0075367_10003622 Ga0075367_1000362211 169
459 3300006195 Ga0075366_10055335 Ga0075366_100553354 169
460 3300006353 Ga0075370_10004713 Ga0075370_100047133 169
461 3300006358 Ga0068871_101202694 Ga0068871_1012026942 169
462 3300006931 Ga0097620_100360045 Ga0097620_1003600452 169
463 3300011119 Ga0105246_10648530 Ga0105246_106485301 169
464 3300026041 Ga0207639_10725371 Ga0207639_107253711 169
465 3300026118 Ga0207675_100684903 Ga0207675_1006849032 169
466 3300028381 Ga0268264_10175886 Ga0268264_101758862 169
467 3300050490 nmdc:mga03n38_84475_c1 nmdc:mga03n38_84475_c1_783_1298 169
468 3300050491 nmdc:mga00v17_122369_c1 nmdc:mga00v17_122369_c1_643_1158 169
469 3300050493 nmdc:mga0k408_30918_c1 nmdc:mga0k408_30918_c1_805_1320 169
470 3300050494 nmdc:mga06z11_18396_c1 nmdc:mga06z11_18396_c1_90_605 169
471 3300050494 nmdc:mga06z11_23683_c1 nmdc:mga06z11_23683_c1_53_568 169
472 3300050495 nmdc:mga04h51_5574_c1 nmdc:mga04h51_5574_c1_2461_2976 169
473 3300050496 nmdc:mga07m45_39922_c1 nmdc:mga07m45_39922_c1_1672_2187 169
474 3300050496 nmdc:mga07m45_542089_c1 nmdc:mga07m45_542089_c1_145_660 169
475 3300006178 Ga0075367_10503649 Ga0075367_105036492 170
476 3300025940 Ga0207691_10222160 Ga0207691_102221602 170
477 2162886012 MBSR1b_contig_10885647 MBSR1b_0333.00003700 171
478 3300005293 Ga0065715_10168703 Ga0065715_101687032 171
479 3300005328 Ga0070676_10997446 Ga0070676_109974461 171
480 3300005330 Ga0070690_101204028 Ga0070690_1012040281 171
481 3300005331 Ga0070670_100240690 Ga0070670_1002406901 171
482 3300005331 Ga0070670_101217352 Ga0070670_1012173521 171
483 3300005331 Ga0070670_101434682 Ga0070670_1014346821 171
484 3300005333 Ga0070677_10066440 Ga0070677_100664402 171
485 3300005335 Ga0070666_10430510 Ga0070666_104305101 171
486 3300005337 Ga0070682_101382082 Ga0070682_1013820821 171
487 3300005344 Ga0070661_100058547 Ga0070661_1000585471 171
488 3300005347 Ga0070668_100262250 Ga0070668_1002622502 171
489 3300005353 Ga0070669_100078935 Ga0070669_1000789353 171
490 3300005353 Ga0070669_100095747 Ga0070669_1000957472 171
491 3300005353 Ga0070669_100413054 Ga0070669_1004130543 171
492 3300005354 Ga0070675_100000839 Ga0070675_10000083916 171
493 3300005354 Ga0070675_100030688 Ga0070675_1000306882 171
494 3300005354 Ga0070675_100237936 Ga0070675_1002379363 171
495 3300005355 Ga0070671_101303718 Ga0070671_1013037181 171
496 3300005356 Ga0070674_100054600 Ga0070674_1000546003 171
497 3300005356 Ga0070674_101242608 Ga0070674_1012426081 171
498 3300005364 Ga0070673_100247227 Ga0070673_1002472272 171
499 3300005364 Ga0070673_100470318 Ga0070673_1004703181 171
500 3300005364 Ga0070673_100500153 Ga0070673_1005001532 171
501 3300005364 Ga0070673_101099553 Ga0070673_1010995532 171
502 3300005455 Ga0070663_100058518 Ga0070663_1000585182 171
503 3300005456 Ga0070678_100147383 Ga0070678_1001473833 171
504 3300005459 Ga0068867_100518781 Ga0068867_1005187812 171
505 3300005459 Ga0068867_101299806 Ga0068867_1012998062 171
506 3300005543 Ga0070672_100161157 Ga0070672_1001611573 171
507 3300005543 Ga0070672_100246860 Ga0070672_1002468602 171
508 3300005543 Ga0070672_100428747 Ga0070672_1004287471 171
509 3300005546 Ga0070696_100721265 Ga0070696_1007212651 171
510 3300005564 Ga0070664_100391171 Ga0070664_1003911713 171
511 3300005615 Ga0070702_100181798 Ga0070702_1001817982 171
512 3300005618 Ga0068864_100709016 Ga0068864_1007090162 171
513 3300005719 Ga0068861_101220422 Ga0068861_1012204221 171
514 3300005834 Ga0068851_10162938 Ga0068851_101629381 171
515 3300005841 Ga0068863_100129465 Ga0068863_1001294653 171
516 3300005841 Ga0068863_100377743 Ga0068863_1003777432 171
517 3300005844 Ga0068862_100403507 Ga0068862_1004035072 171
518 3300005844 Ga0068862_101027724 Ga0068862_1010277241 171
519 3300006177 Ga0075362_10233397 Ga0075362_102333972 171
520 3300006178 Ga0075367_10395618 Ga0075367_103956182 171
521 3300006237 Ga0097621_100226451 Ga0097621_1002264512 171
522 3300006358 Ga0068871_100909368 Ga0068871_1009093681 171
523 3300006358 Ga0068871_101091478 Ga0068871_1010914781 171
524 3300006844 Ga0075428_101321257 Ga0075428_1013212571 171
525 3300006846 Ga0075430_100280578 Ga0075430_1002805783 171
526 3300006847 Ga0075431_100220513 Ga0075431_1002205133 171
527 3300006880 Ga0075429_100044193 Ga0075429_1000441935 171
528 3300006881 Ga0068865_100297381 Ga0068865_1002973812 171
529 3300009094 Ga0111539_10098176 Ga0111539_100981762 171
530 3300009094 Ga0111539_10519644 Ga0111539_105196442 171
531 3300009147 Ga0114129_10033996 Ga0114129_100339967 171
532 3300009147 Ga0114129_10911284 Ga0114129_109112842 171
533 3300009176 Ga0105242_10235893 Ga0105242_102358931 171
534 3300009177 Ga0105248_10227291 Ga0105248_102272914 171
535 3300009177 Ga0105248_10639756 Ga0105248_106397562 171
536 3300009177 Ga0105248_10738528 Ga0105248_107385282 171
537 3300009551 Ga0105238_10183773 Ga0105238_101837732 171
538 3300013296 Ga0157374_10261131 Ga0157374_102611312 171
539 3300013306 Ga0163162_12148921 Ga0163162_121489211 171
540 3300013308 Ga0157375_10141938 Ga0157375_101419384 171
541 3300014325 Ga0163163_10021756 Ga0163163_100217562 171
542 3300014326 Ga0157380_10059059 Ga0157380_100590591 171
543 3300014326 Ga0157380_10071826 Ga0157380_100718264 171
544 3300014326 Ga0157380_10350963 Ga0157380_103509632 171
545 3300014745 Ga0157377_10177787 Ga0157377_101777871 171
546 3300014969 Ga0157376_10173717 Ga0157376_101737172 171
547 3300014969 Ga0157376_10262986 Ga0157376_102629862 171
548 3300017792 Ga0163161_10471017 Ga0163161_104710172 171
549 3300025321 Ga0207656_10148570 Ga0207656_101485701 171
550 3300025893 Ga0207682_10222950 Ga0207682_102229501 171
551 3300025893 Ga0207682_10288179 Ga0207682_102881791 171
552 3300025893 Ga0207682_10375375 Ga0207682_103753751 171
553 3300025907 Ga0207645_10717826 Ga0207645_107178261 171
554 3300025923 Ga0207681_10099286 Ga0207681_100992862 171
555 3300025923 Ga0207681_10929025 Ga0207681_109290252 171
556 3300025925 Ga0207650_10093388 Ga0207650_100933884 171
557 3300025925 Ga0207650_10123652 Ga0207650_101236522 171
558 3300025926 Ga0207659_10001283 Ga0207659_100012835 171
559 3300025926 Ga0207659_10033382 Ga0207659_100333823 171
560 3300025933 Ga0207706_10317037 Ga0207706_103170372 171
561 3300025934 Ga0207686_10452050 Ga0207686_104520501 171
562 3300025937 Ga0207669_10024022 Ga0207669_100240223 171
563 3300025937 Ga0207669_10535457 Ga0207669_105354572 171
564 3300025938 Ga0207704_10343905 Ga0207704_103439052 171
565 3300025940 Ga0207691_10063829 Ga0207691_100638294 171
566 3300025940 Ga0207691_10184364 Ga0207691_101843642 171
567 3300025941 Ga0207711_10370801 Ga0207711_103708011 171
568 3300025941 Ga0207711_10517602 Ga0207711_105176022 171
569 3300025941 Ga0207711_10579413 Ga0207711_105794131 171
570 3300025944 Ga0207661_10428618 Ga0207661_104286182 171
571 3300025944 Ga0207661_11050272 Ga0207661_110502721 171
572 3300025945 Ga0207679_10165684 Ga0207679_101656842 171
573 3300025960 Ga0207651_10199966 Ga0207651_101999663 171
574 3300025960 Ga0207651_11050040 Ga0207651_110500401 171
575 3300025960 Ga0207651_11211288 Ga0207651_112112881 171
576 3300025961 Ga0207712_11009979 Ga0207712_110099791 171
577 3300025981 Ga0207640_10362995 Ga0207640_103629951 171
578 3300026067 Ga0207678_10050844 Ga0207678_100508443 171
579 3300026067 Ga0207678_10140125 Ga0207678_101401253 171
580 3300026067 Ga0207678_10867634 Ga0207678_108676342 171
581 3300026075 Ga0207708_11347659 Ga0207708_113476591 171
582 3300026088 Ga0207641_10186133 Ga0207641_101861333 171
583 3300026088 Ga0207641_10449683 Ga0207641_104496832 171
584 3300026089 Ga0207648_10091008 Ga0207648_100910082 171
585 3300026095 Ga0207676_10135373 Ga0207676_101353731 171
586 3300026118 Ga0207675_100448188 Ga0207675_1004481881 171
587 3300026118 Ga0207675_100651884 Ga0207675_1006518842 171
588 3300026121 Ga0207683_10002565 Ga0207683_100025658 171
589 3300027907 Ga0207428_10252871 Ga0207428_102528712 171
590 3300031548 Ga0307408_100070015 Ga0307408_1000700152 171
591 3300031824 Ga0307413_10192783 Ga0307413_101927832 171
592 3300031824 Ga0307413_10469656 Ga0307413_104696561 171
593 3300031824 Ga0307413_10782743 Ga0307413_107827431 171
594 3300031852 Ga0307410_10007757 Ga0307410_100077577 171
595 3300031901 Ga0307406_11022886 Ga0307406_110228862 171
596 3300031995 Ga0307409_100024776 Ga0307409_1000247763 171
597 3300032002 Ga0307416_100788725 Ga0307416_1007887252 171
598 3300032004 Ga0307414_10086248 Ga0307414_100862484 171
599 3300032126 Ga0307415_100526648 Ga0307415_1005266482 171
600 3300039437 Ga0436365_1611331 Ga0436365_1611331_33_554 171
601 3300041512 Ga0451853_0326133 Ga0451853_0326133_161_682 171
602 3300041512 Ga0451853_1696582 Ga0451853_1696582_117_641 171
603 3300042010 Ga0439452_086272 Ga0439452_086272_82_600 171
604 3300042013 Ga0439456_015881 Ga0439456_015881_135_656 171
605 3300042530 Ga0450916_044684 Ga0450916_044684_18_533 171
606 3300048912 Ga0496109_0721017 Ga0496109_0721017_77_592 171
607 3300050491 nmdc:mga00v17_256798_c1 nmdc:mga00v17_256798_c1_498_1016 171
608 3300050493 nmdc:mga0k408_254918_c1 nmdc:mga0k408_254918_c1_355_888 171
609 3300050493 nmdc:mga0k408_609101_c1 nmdc:mga0k408_609101_c1_105_620 171
610 3300050494 nmdc:mga06z11_99892_c1 nmdc:mga06z11_99892_c1_369_902 171
611 3300050507 nmdc:mga05p37_103222_c1 nmdc:mga05p37_103222_c1_2217_2732 171
612 3300050508 nmdc:mga09592_174096_c1 nmdc:mga09592_174096_c1_639_1154 171
613 3300050510 nmdc:mga06r32_842078_c1 nmdc:mga06r32_842078_c1_75_596 171
614 3300050511 nmdc:mga08y16_518062_c1 nmdc:mga08y16_518062_c1_166_681 171
615 3300050511 nmdc:mga08y16_634628_c1 nmdc:mga08y16_634628_c1_23_541 171
616 3300053139 Ga0500568_0005753 Ga0500568_0005753_4577_5110 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

5

92

0.94

PF16242

Pyrid_ox_like

Pyridoxamine 5'-phosphate oxidase like

3

159

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2re7-assembly1.cif.gz_A-2 crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution 0.8561 2 133
2i02-assembly1.cif.gz_A crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.8531 5 166
2fhq-assembly1.cif.gz_B crystal structure of general stress protein from bacteroides thetaiotaomicron 0.8462 2 133
2i02-assembly1.cif.gz_B crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.8461 5 140
3dmb-assembly1.cif.gz_C-2 crystal structure of a putative general stress family protein (xcc2264) from xanthomonas campestris pv. campestris at 2.30 a resolution 0.8239 7 139
ID Description Score Start End Superfamily
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8529 2 133 2.30.110.10
2i02B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8414 5 140 2.30.110.10
2fhqB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8412 3 133 2.30.110.10
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8115 2 133 2.30.110.10
3ec6A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8039 6 133 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7W1EMM7-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9141 1 87
AF-A0A2T0SW39-F1-model_v4 General stress protein 26 0.8912 4 133
AF-A0A098LJ80-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.8839 7 133
AF-A0A7W2A0N9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.8836 6 131
AF-A0A4S4B4P5-F1-model_v4 General stress protein 0.8769 7 140

Feature Viewer

pLDDT pTM Quality
87.33 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map