F469538

General Info

Members Datasets Scaffolds Average Seq Length
616 343 1232 100

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10272827|Ga0114129_102728274
Length 110
Sequence VRNSEKKPMHYVLAALTFAAALHVNVSAQAEKRTFIIASYADGYGIDRCLATGAACGAAAATAYCRSRDFDQAASYRRVDRGDVTGVVPVSGSACRGSGCNEFVAIECTR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
220 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
225 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
236 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
319 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
336 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
340 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.98
Nodule 0
Rhizoplane 12.66
Rhizosphere 79.38
Stem 0
Stem Tuber 0
Unclassified 17.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10272827 3300009147 Bacteria 2262
2 JGI24739J22299_10098750 3300001989 Unclassified 883
3 JGI24750J21931_1011284 3300002070 Bacteria 1173
4 JGI24749J21850_1022779 3300002076 Bacteria 888
5 JGI24034J26672_10000653 3300002239 Bacteria 4445
6 JGI24742J22300_10004862 3300002244 Bacteria 2204
7 JGI25405J52794_10074215 3300003911 Bacteria 744
8 JGI25405J52794_10134428 3300003911 Bacteria 561
9 Ga0070676_10093995 3300005328 Bacteria 1842
10 Ga0070683_100033109 3300005329 Bacteria 4711
11 Ga0070690_100169259 3300005330 Bacteria 1503
12 Ga0070670_100034629 3300005331 Bacteria 4346
13 Ga0070670_100658701 3300005331 Unclassified 940
14 Ga0070677_10383917 3300005333 Unclassified 736
15 Ga0070680_101839075 3300005336 Bacteria 525
16 Ga0070682_100160152 3300005337 Bacteria 1553
17 Ga0068868_100080441 3300005338 Bacteria 2611
18 Ga0070689_100035697 3300005340 Bacteria 3799
19 Ga0070689_101619447 3300005340 Bacteria 588
20 Ga0070691_10116370 3300005341 Bacteria 1342
21 Ga0070687_100046093 3300005343 Bacteria 2230
22 Ga0070661_100286685 3300005344 Bacteria 1279
23 Ga0070692_10277993 3300005345 Bacteria 1013
24 Ga0070668_100299411 3300005347 Bacteria 1348
25 Ga0070669_100329021 3300005353 Bacteria 1236
26 Ga0070669_101066921 3300005353 Unclassified 695
27 Ga0070675_100074186 3300005354 Bacteria 2825
28 Ga0070671_100238409 3300005355 Bacteria 1544
29 Ga0070671_100389373 3300005355 Bacteria 1192
30 Ga0070674_100221654 3300005356 Bacteria 1471
31 Ga0070674_100279035 3300005356 Bacteria 1323
32 Ga0070674_101021946 3300005356 Bacteria 726
33 Ga0070673_100482095 3300005364 Bacteria 1120
34 Ga0070688_100025890 3300005365 Bacteria 3478
35 Ga0070688_100843951 3300005365 Bacteria 719
36 Ga0070659_100105839 3300005366 Bacteria 2267
37 Ga0070667_100689845 3300005367 Bacteria 944
38 Ga0070667_101028539 3300005367 Unclassified 769
39 Ga0070714_100266748 3300005435 Bacteria 1587
40 Ga0070714_100383709 3300005435 Bacteria 1325
41 Ga0070714_100631432 3300005435 Bacteria 1030
42 Ga0070713_100079553 3300005436 Bacteria 2792
43 Ga0070713_100239820 3300005436 Bacteria 1651
44 Ga0070713_100641441 3300005436 Unclassified 1011
45 Ga0070710_10116874 3300005437 Bacteria 1609
46 Ga0070710_10242725 3300005437 Bacteria 1155
47 Ga0070701_10215001 3300005438 Bacteria 1144
48 Ga0070711_100206951 3300005439 Bacteria 1517
49 Ga0070711_101756637 3300005439 Unclassified 544
50 Ga0070705_100180706 3300005440 Bacteria 1429
51 Ga0070700_100029227 3300005441 Bacteria 3285
52 Ga0070700_101911601 3300005441 Bacteria 513
53 Ga0070694_100515776 3300005444 Unclassified 953
54 Ga0070708_100070560 3300005445 Bacteria 3143
55 Ga0070663_100183547 3300005455 Bacteria 1624
56 Ga0070663_100592060 3300005455 Archaea 932
57 Ga0070678_100162632 3300005456 Bacteria 1810
58 Ga0070662_100218810 3300005457 Bacteria 1518
59 Ga0068867_100222281 3300005459 Bacteria 1522
60 Ga0070685_10233127 3300005466 Bacteria 1212
61 Ga0070706_100735244 3300005467 Bacteria 914
62 Ga0070707_100021684 3300005468 Bacteria 6072
63 Ga0070707_100704109 3300005468 Unclassified 973
64 Ga0070698_100219892 3300005471 Bacteria 1833
65 Ga0070698_101151489 3300005471 Unclassified 724
66 Ga0070698_101443757 3300005471 Bacteria 639
67 Ga0070699_100009473 3300005518 Bacteria 8435
68 Ga0070699_100111846 3300005518 Bacteria 2398
69 Ga0070684_100526526 3300005535 Bacteria 1096
70 Ga0070672_100028488 3300005543 Bacteria 4178
71 Ga0070686_100005064 3300005544 Bacteria 7277
72 Ga0070695_100123791 3300005545 Bacteria 1773
73 Ga0070693_100437518 3300005547 Unclassified 915
74 Ga0070665_100070564 3300005548 Bacteria 3500
75 Ga0070665_102223352 3300005548 Bacteria 552
76 Ga0070664_100204079 3300005564 Bacteria 1765
77 Ga0070664_100862071 3300005564 Unclassified 848
78 Ga0068857_100630333 3300005577 Bacteria 1015
79 Ga0068854_100083656 3300005578 Bacteria 2360
80 Ga0068854_102061364 3300005578 Unclassified 526
81 Ga0068856_100038688 3300005614 Bacteria 4683
82 Ga0068856_101053878 3300005614 Bacteria 831
83 Ga0070702_100003381 3300005615 Bacteria 7127
84 Ga0070702_100111265 3300005615 Bacteria 1698
85 Ga0068852_100010801 3300005616 Bacteria 6841
86 Ga0068864_100006392 3300005618 Bacteria 9654
87 Ga0068864_100744546 3300005618 Bacteria 960
88 Ga0068864_100946063 3300005618 Bacteria 852
89 Ga0068864_101579116 3300005618 Unclassified 660
90 Ga0068861_100244984 3300005719 Bacteria 1526
91 Ga0068851_10224887 3300005834 Bacteria 1056
92 Ga0068863_100065315 3300005841 Bacteria 3443
93 Ga0068863_100766943 3300005841 Unclassified 961
94 Ga0068863_101530154 3300005841 Unclassified 676
95 Ga0068858_100182925 3300005842 Bacteria 1979
96 Ga0068860_100156651 3300005843 Bacteria 2195
97 Ga0068862_100045088 3300005844 Bacteria 3762
98 Ga0081455_10008077 3300005937 Bacteria 10989
99 Ga0081455_10009432 3300005937 Bacteria 10042
100 Ga0081455_10022588 3300005937 Bacteria 5875
101 Ga0081455_10121749 3300005937 Bacteria 2055
102 Ga0081538_10066308 3300005981 Bacteria 2025
103 Ga0081540_1000011 3300005983 Bacteria 191880
104 Ga0081540_1016541 3300005983 Bacteria 4608
105 Ga0081540_1094457 3300005983 Bacteria 1306
106 Ga0070717_10219905 3300006028 Bacteria 1669
107 Ga0070717_10315976 3300006028 Bacteria 1391
108 Ga0070717_10855184 3300006028 Unclassified 828
109 Ga0070717_11005506 3300006028 Bacteria 759
110 Ga0075365_10047512 3300006038 Bacteria 2822
111 Ga0075365_10116459 3300006038 Bacteria 1840
112 Ga0075365_10275164 3300006038 Bacteria 1184
113 Ga0075365_10417120 3300006038 Bacteria 948
114 Ga0075365_10507344 3300006038 Bacteria 853
115 Ga0075368_10008621 3300006042 Bacteria 3639
116 Ga0075368_10230916 3300006042 Unclassified 788
117 Ga0075363_100042522 3300006048 Bacteria 2401
118 Ga0075364_10049721 3300006051 Bacteria 2735
119 Ga0075364_10081507 3300006051 Bacteria 2140
120 Ga0075364_10706491 3300006051 Bacteria 688
121 Ga0070716_101073268 3300006173 Bacteria 641
122 Ga0070712_100000679 3300006175 Bacteria 20108
123 Ga0070712_100163329 3300006175 Bacteria 1722
124 Ga0070712_100559027 3300006175 Bacteria 965
125 Ga0070712_101792839 3300006175 Unclassified 537
126 Ga0075362_10102301 3300006177 Bacteria 1341
127 Ga0075362_10144571 3300006177 Bacteria 1138
128 Ga0075362_10213076 3300006177 Bacteria 942
129 Ga0075362_10251879 3300006177 Bacteria 868
130 Ga0075367_10010156 3300006178 Bacteria 4938
131 Ga0075367_10079117 3300006178 Bacteria 1986
132 Ga0075369_10042317 3300006186 Bacteria 1953
133 Ga0075366_10049750 3300006195 Bacteria 2487
134 Ga0075366_10417705 3300006195 Bacteria 826
135 Ga0097621_100215413 3300006237 Bacteria 1672
136 Ga0075370_10064659 3300006353 Bacteria 2086
137 Ga0068871_100073099 3300006358 Bacteria 2826
138 Ga0075428_100046146 3300006844 Bacteria 4787
139 Ga0075428_100065049 3300006844 Bacteria 3994
140 Ga0075428_100169192 3300006844 Bacteria 2370
141 Ga0075428_100287880 3300006844 Bacteria 1767
142 Ga0075428_100390184 3300006844 Bacteria 1492
143 Ga0075428_101021941 3300006844 Bacteria 875
144 Ga0075430_100031110 3300006846 Bacteria 4531
145 Ga0075430_100258272 3300006846 Unclassified 1443
146 Ga0075430_100408142 3300006846 Bacteria 1121
147 Ga0075430_100514562 3300006846 Bacteria 988
148 Ga0075430_100525998 3300006846 Bacteria 976
149 Ga0075430_101080585 3300006846 Unclassified 661
150 Ga0075430_101550657 3300006846 Unclassified 544
151 Ga0075431_100022167 3300006847 Bacteria 6495
152 Ga0075431_100024877 3300006847 Bacteria 6140
153 Ga0075431_100036419 3300006847 Bacteria 5068
154 Ga0075431_100335503 3300006847 Bacteria 1522
155 Ga0075431_100900081 3300006847 Bacteria 854
156 Ga0075431_102099468 3300006847 Bacteria 520
157 Ga0075433_11009467 3300006852 Unclassified 725
158 Ga0075429_100009867 3300006880 Bacteria 8279
159 Ga0075429_101397149 3300006880 Unclassified 610
160 Ga0068865_100002598 3300006881 Bacteria 10727
161 Ga0075436_101002065 3300006914 Bacteria 627
162 Ga0075435_100127741 3300007076 Bacteria 2126
163 Ga0075435_101140284 3300007076 Unclassified 682
164 Ga0099794_10042911 3300007265 Bacteria 2158
165 Ga0099795_10000539 3300007788 Bacteria 7133
166 Ga0105250_10198061 3300009092 Unclassified 847
167 Ga0111539_10022499 3300009094 Bacteria 7744
168 Ga0111539_10177152 3300009094 Bacteria 2491
169 Ga0111539_10750898 3300009094 Bacteria 1135
170 Ga0111539_10797224 3300009094 Unclassified 1099
171 Ga0111539_10947250 3300009094 Bacteria 1001
172 Ga0111539_13131456 3300009094 Bacteria 534
173 Ga0111539_13134346 3300009094 Bacteria 533
174 Ga0105245_10005647 3300009098 Bacteria 10992
175 Ga0105245_12177324 3300009098 Unclassified 608
176 Ga0105247_10036140 3300009101 Bacteria 3012
177 Ga0105247_10159204 3300009101 Bacteria 1494
178 Ga0114129_10002017 3300009147 Bacteria 27842
179 Ga0114129_10058246 3300009147 Bacteria 5404
180 Ga0114129_10362011 3300009147 Bacteria 1919
181 Ga0114129_11093624 3300009147 Bacteria 998
182 Ga0114129_11532434 3300009147 Bacteria 818
183 Ga0114129_11566582 3300009147 Bacteria 808
184 Ga0114129_12354287 3300009147 Bacteria 638
185 Ga0105243_10144826 3300009148 Bacteria 2032
186 Ga0105248_10389828 3300009177 Bacteria 1568
187 Ga0105238_10465377 3300009551 Bacteria 1262
188 Ga0105249_10241337 3300009553 Bacteria 1787
189 Ga0099796_10001397 3300010159 Bacteria 4831
190 Ga0105239_10965895 3300010375 Archaea 979
191 Ga0105239_11446835 3300010375 Bacteria 794
192 Ga0157369_11383557 3300013105 Unclassified 716
193 Ga0157374_10054993 3300013296 Bacteria 3714
194 Ga0157374_10517060 3300013296 Bacteria 1199
195 Ga0157378_10202550 3300013297 Bacteria 1878
196 Ga0163162_10211525 3300013306 Bacteria 2069
197 Ga0163162_10240703 3300013306 Bacteria 1940
198 Ga0163162_10675430 3300013306 Bacteria 1156
199 Ga0157372_10588958 3300013307 Bacteria 1296
200 Ga0157375_10870586 3300013308 Bacteria 1046
201 Ga0163163_10062628 3300014325 Bacteria 3686
202 Ga0163163_11334442 3300014325 Unclassified 779
203 Ga0163163_11857898 3300014325 Unclassified 662
204 Ga0157380_10024890 3300014326 Bacteria 4535
205 Ga0157380_10688658 3300014326 Bacteria 1025
206 Ga0157380_11260344 3300014326 Unclassified 785
207 Ga0157377_10041164 3300014745 Bacteria 2562
208 Ga0157379_10182454 3300014968 Bacteria 1896
209 Ga0157379_11067738 3300014968 Bacteria 772
210 Ga0157376_10481197 3300014969 Bacteria 1217
211 Ga0163161_11108039 3300017792 Unclassified 681
212 Ga0213875_10323492 3300021388 Bacteria 731
213 Ga0207697_10036195 3300025315 Bacteria 2021
214 Ga0207656_10114348 3300025321 Bacteria 1250
215 Ga0207692_10100492 3300025898 Bacteria 1586
216 Ga0207692_10531489 3300025898 Unclassified 749
217 Ga0207642_10012456 3300025899 Bacteria 3070
218 Ga0207710_10001712 3300025900 Bacteria 10612
219 Ga0207688_10009692 3300025901 Bacteria 5241
220 Ga0207647_10073025 3300025904 Bacteria 2068
221 Ga0207685_10176583 3300025905 Bacteria 987
222 Ga0207645_10042902 3300025907 Bacteria 2894
223 Ga0207643_10013533 3300025908 Bacteria 4420
224 Ga0207684_10867380 3300025910 Bacteria 760
225 Ga0207671_10183791 3300025914 Bacteria 1628
226 Ga0207693_10003351 3300025915 Bacteria 13694
227 Ga0207693_10046438 3300025915 Bacteria 3411
228 Ga0207663_10242135 3300025916 Bacteria 1323
229 Ga0207663_11315353 3300025916 Unclassified 582
230 Ga0207662_10077417 3300025918 Bacteria 2023
231 Ga0207657_10055234 3300025919 Bacteria 3431
232 Ga0207649_10171828 3300025920 Bacteria 1510
233 Ga0207652_11357422 3300025921 Unclassified 614
234 Ga0207646_10954790 3300025922 Unclassified 759
235 Ga0207681_10168065 3300025923 Bacteria 1660
236 Ga0207681_11287176 3300025923 Archaea 614
237 Ga0207694_11584331 3300025924 Unclassified 552
238 Ga0207650_10110598 3300025925 Bacteria 2126
239 Ga0207659_10025923 3300025926 Bacteria 3948
240 Ga0207687_10017208 3300025927 Bacteria 4755
241 Ga0207687_10943114 3300025927 Bacteria 739
242 Ga0207700_10067021 3300025928 Bacteria 2746
243 Ga0207700_10163640 3300025928 Bacteria 1850
244 Ga0207700_10633047 3300025928 Unclassified 953
245 Ga0207700_10739272 3300025928 Bacteria 879
246 Ga0207664_10649734 3300025929 Bacteria 948
247 Ga0207644_10044102 3300025931 Bacteria 3167
248 Ga0207644_11073089 3300025931 Unclassified 677
249 Ga0207706_10009812 3300025933 Bacteria 8784
250 Ga0207670_10404946 3300025936 Bacteria 1091
251 Ga0207669_10070018 3300025937 Bacteria 2197
252 Ga0207704_10003071 3300025938 Bacteria 7547
253 Ga0207665_10225898 3300025939 Bacteria 1374
254 Ga0207665_10480188 3300025939 Unclassified 957
255 Ga0207665_11334644 3300025939 Bacteria 572
256 Ga0207691_10004982 3300025940 Bacteria 12810
257 Ga0207689_10378572 3300025942 Bacteria 1178
258 Ga0207661_10969001 3300025944 Archaea 783
259 Ga0207661_11555477 3300025944 Unclassified 606
260 Ga0207679_10216240 3300025945 Bacteria 1610
261 Ga0207679_11727069 3300025945 Unclassified 572
262 Ga0207651_10064379 3300025960 Bacteria 2566
263 Ga0207651_10569345 3300025960 Bacteria 987
264 Ga0207712_10078197 3300025961 Bacteria 2400
265 Ga0207668_10910774 3300025972 Bacteria 783
266 Ga0207640_10051000 3300025981 Bacteria 2688
267 Ga0207658_10935076 3300025986 Unclassified 790
268 Ga0207677_10483594 3300026023 Bacteria 1067
269 Ga0207703_10057131 3300026035 Bacteria 3181
270 Ga0207639_10209422 3300026041 Bacteria 1677
271 Ga0207639_12000701 3300026041 Unclassified 540
272 Ga0207678_10061506 3300026067 Bacteria 3230
273 Ga0207678_10447185 3300026067 Unclassified 1123
274 Ga0207708_10216738 3300026075 Bacteria 1532
275 Ga0207708_10658312 3300026075 Bacteria 892
276 Ga0207702_10070618 3300026078 Bacteria 3004
277 Ga0207702_10763514 3300026078 Bacteria 955
278 Ga0207641_10010161 3300026088 Bacteria 7741
279 Ga0207648_10010527 3300026089 Bacteria 8759
280 Ga0207676_10366526 3300026095 Bacteria 1337
281 Ga0207676_10860448 3300026095 Bacteria 887
282 Ga0207675_100001927 3300026118 Bacteria 20699
283 Ga0207675_101076692 3300026118 Bacteria 823
284 Ga0207675_101601169 3300026118 Bacteria 672
285 Ga0207683_10012723 3300026121 Bacteria 7180
286 Ga0207698_10028700 3300026142 Bacteria 3972
287 Ga0209179_1041297 3300027512 Bacteria 972
288 Ga0209588_1120578 3300027671 Bacteria 839
289 Ga0209813_10003761 3300027866 Bacteria 3578
290 Ga0209813_10299803 3300027866 Bacteria 624
291 Ga0207428_10046959 3300027907 Bacteria 3470
292 Ga0207428_10506550 3300027907 Unclassified 876
293 Ga0268266_10836798 3300028379 Bacteria 889
294 Ga0268265_10009174 3300028380 Bacteria 6686
295 Ga0265338_10359319 3300028800 Bacteria 1045
296 Ga0265324_10122417 3300029957 Bacteria 884
297 Ga0265762_1049835 3300030760 Bacteria 838
298 Ga0265760_10121501 3300031090 Bacteria 839
299 Ga0265330_10146975 3300031235 Bacteria 1002
300 Ga0265328_10279139 3300031239 Unclassified 643
301 Ga0265320_10071505 3300031240 Bacteria 1634
302 Ga0265325_10270446 3300031241 Bacteria 764
303 Ga0265340_10028959 3300031247 Bacteria 2783
304 Ga0265340_10553479 3300031247 Bacteria 506
305 Ga0265331_10123597 3300031250 Bacteria 1183
306 Ga0265331_10245786 3300031250 Bacteria 803
307 Ga0265316_10276938 3300031344 Bacteria 1227
308 Ga0265316_10507986 3300031344 Bacteria 860
309 Ga0265313_10223804 3300031595 Bacteria 775
310 Ga0265314_10008515 3300031711 Bacteria 8769
311 Ga0373926_0024368 3300035083 Bacteria 2107
312 Ga0373944_0007971 3300035089 Bacteria 2855
313 Ga0373923_0405592 3300035111 Unclassified 657
314 Ga0373936_0053002 3300035113 Bacteria 1644
315 Ga0373936_0615407 3300035113 Bacteria 510
316 Ga0373936_0632937 3300035113 Bacteria 504
317 Ga0373939_0115448 3300035114 Bacteria 941
318 Ga0373945_0115241 3300035116 Bacteria 1064
319 Ga0373953_0012249 3300035117 Bacteria 3032
320 Ga0373954_0126127 3300035118 Bacteria 1244
321 Ga0373956_0061727 3300035119 Bacteria 1698
322 Ga0373943_0036799 3300035170 Bacteria 2345
323 Ga0373946_0105932 3300035171 Bacteria 1266
324 Ga0373955_0035773 3300035172 Bacteria 2632
325 Ga0373955_0495805 3300035172 Unclassified 746
326 Ga0373961_0192069 3300035241 Bacteria 716
327 Ga0373931_0174735 3300035691 Bacteria 1268
328 Ga0373935_1283359 3300035692 Bacteria 546
329 Ga0373927_0267827 3300035695 Bacteria 1123
330 Ga0373927_0592204 3300035695 Bacteria 733
331 Ga0373927_0909595 3300035695 Bacteria 581
332 Ga0373933_0364095 3300035724 Bacteria 940
333 Ga0373947_0109095 3300035725 Bacteria 1747
334 Ga0373937_0001283 3300036401 Bacteria 21045
335 Ga0373937_1020712 3300036401 Unclassified 776
336 Ga0373925_0125556 3300037068 Bacteria 1996
337 Ga0373925_0468489 3300037068 Bacteria 1033
338 Ga0373925_0849208 3300037068 Unclassified 752
339 Ga0395900_0162842 3300037418 Bacteria 2275
340 Ga0395898_0091901 3300037466 Bacteria 2919
341 Ga0395905_0139640 3300037471 Bacteria 2280
342 Ga0436364_0947481 3300037853 Bacteria 3044
343 Ga0395901_0700569 3300038443 Unclassified 1010
344 Ga0436360_0197820 3300039438 Unclassified 564
345 Ga0436360_0978008 3300039438 Unclassified 552
346 Ga0436361_0433570 3300039447 Bacteria 4339
347 Ga0436361_0750883 3300039447 Bacteria 923
348 Ga0436363_0991462 3300039450 Unclassified 554
349 Ga0436362_0872844 3300039453 Bacteria 775
350 Ga0439465_0257955 3300041413 Bacteria 646
351 Ga0451837_1546431 3300041494 Unclassified 549
352 Ga0451845_0357486 3300041501 Unclassified 730
353 Ga0451853_2877422 3300041512 Bacteria 1695
354 Ga0451576_1340382 3300045051 Unclassified 746
355 Ga0495603_0008852 3300046455 Bacteria 6084
356 Ga0495590_0141006 3300046457 Bacteria 870
357 Ga0495591_124031 3300046458 Unclassified 629
358 Ga0495629_0157673 3300046459 Bacteria 1577
359 Ga0495629_0295232 3300046459 Bacteria 1110
360 Ga0495638_0025742 3300046460 Bacteria 3820
361 Ga0495641_0068971 3300046461 Bacteria 1589
362 Ga0495641_0252044 3300046461 Unclassified 794
363 Ga0495582_0134480 3300046473 Bacteria 1398
364 Ga0495605_0155968 3300046474 Unclassified 1016
365 Ga0495639_0028987 3300046475 Bacteria 2455
366 Ga0495639_0429215 3300046475 Unclassified 670
367 Ga0495662_0108721 3300046476 Bacteria 1358
368 Ga0495662_0675823 3300046476 Unclassified 504
369 Ga0495584_0008242 3300046491 Bacteria 5402
370 Ga0495584_0133887 3300046491 Bacteria 1258
371 Ga0495584_0172654 3300046491 Bacteria 1099
372 Ga0495585_0032927 3300046492 Bacteria 2936
373 Ga0495585_0218111 3300046492 Bacteria 964
374 Ga0495596_0195848 3300046500 Bacteria 785
375 Ga0495596_0392440 3300046500 Unclassified 541
376 Ga0495607_0236745 3300046501 Bacteria 885
377 Ga0495618_0267205 3300046514 Bacteria 1070
378 Ga0495630_0136236 3300046517 Bacteria 1866
379 Ga0495630_0886479 3300046517 Unclassified 680
380 Ga0495631_0243984 3300046518 Unclassified 766
381 Ga0495632_0201302 3300046519 Bacteria 907
382 Ga0495637_0085442 3300046520 Bacteria 1252
383 Ga0495643_0030352 3300046522 Bacteria 3019
384 Ga0495643_0442840 3300046522 Unclassified 567
385 Ga0495644_0031039 3300046523 Bacteria 2018
386 Ga0495644_0213808 3300046523 Bacteria 745
387 Ga0495666_0127238 3300046526 Bacteria 1191
388 Ga0495642_0326947 3300046528 Unclassified 673
389 Ga0495640_0060129 3300046533 Bacteria 2585
390 Ga0495640_0475596 3300046533 Bacteria 761
391 Ga0495598_0163128 3300046537 Bacteria 785
392 Ga0495609_0313112 3300046538 Unclassified 638
393 Ga0495656_0155294 3300046615 Unclassified 1108
394 Ga0495656_0157061 3300046615 Bacteria 1103
395 Ga0495668_0706239 3300046616 Bacteria 558
396 Ga0495634_0172156 3300046642 Bacteria 1360
397 Ga0495634_0597254 3300046642 Bacteria 641
398 Ga0495611_0062855 3300046648 Bacteria 1689
399 Ga0495611_0154232 3300046648 Bacteria 1072
400 Ga0495635_0221030 3300046663 Bacteria 1281
401 Ga0495659_0107575 3300046664 Bacteria 1086
402 Ga0495659_0272296 3300046664 Unclassified 710
403 Ga0495588_0078700 3300046674 Bacteria 1720
404 Ga0495647_0037816 3300046681 Bacteria 1823
405 Ga0495658_0033067 3300046683 Bacteria 2829
406 Ga0495669_0065256 3300046684 Bacteria 1653
407 Ga0495613_0379273 3300046689 Bacteria 967
408 Ga0495624_0355763 3300046690 Bacteria 880
409 Ga0495670_0079535 3300046691 Bacteria 1669
410 Ga0495671_0303276 3300046692 Bacteria 768
411 Ga0495581_0061335 3300047315 Bacteria 2173
412 Ga0495581_0201292 3300047315 Bacteria 1165
413 Ga0495636_0426208 3300047318 Bacteria 635
414 Ga0495674_0386325 3300047319 Bacteria 1132
415 Ga0495674_0846908 3300047319 Bacteria 709
416 Ga0495674_0993240 3300047319 Unclassified 644
417 Ga0495672_0535410 3300047320 Unclassified 516
418 Ga0495676_0523801 3300047321 Bacteria 776
419 Ga0495680_0540159 3300047322 Unclassified 787
420 Ga0495673_0253832 3300047469 Bacteria 641
421 Ga0495684_0242527 3300047471 Bacteria 1314
422 Ga0495602_0815604 3300048088 Unclassified 626
423 Ga0495614_0191041 3300048089 Bacteria 924
424 Ga0495614_0234824 3300048089 Bacteria 836
425 Ga0495626_0068524 3300048091 Bacteria 1600
426 Ga0495626_0232108 3300048091 Unclassified 746
427 Ga0496100_0002562 3300048903 Bacteria 9260
428 Ga0496100_0044813 3300048903 Bacteria 2835
429 Ga0496100_0059377 3300048903 Bacteria 2513
430 Ga0496100_0146844 3300048903 Bacteria 1678
431 Ga0496101_0061916 3300048904 Bacteria 2719
432 Ga0496101_1413634 3300048904 Bacteria 543
433 Ga0496101_1433300 3300048904 Unclassified 538
434 Ga0496102_0003286 3300048905 Bacteria 13705
435 Ga0496102_0031951 3300048905 Bacteria 4726
436 Ga0496102_0602217 3300048905 Bacteria 1022
437 Ga0496103_0000865 3300048906 Bacteria 22013
438 Ga0496103_0017439 3300048906 Bacteria 4297
439 Ga0496104_0001467 3300048907 Bacteria 20349
440 Ga0496104_0002041 3300048907 Bacteria 17532
441 Ga0496104_0002377 3300048907 Bacteria 16218
442 Ga0496104_0025257 3300048907 Bacteria 5476
443 Ga0496104_0054685 3300048907 Bacteria 3773
444 Ga0496104_0204907 3300048907 Bacteria 1884
445 Ga0496104_1301846 3300048907 Unclassified 630
446 Ga0496105_0002893 3300048908 Bacteria 12593
447 Ga0496105_0059529 3300048908 Bacteria 3151
448 Ga0496105_0098575 3300048908 Bacteria 2413
449 Ga0496105_0193015 3300048908 Bacteria 1664
450 Ga0496105_0209801 3300048908 Bacteria 1588
451 Ga0496106_0008084 3300048909 Bacteria 7770
452 Ga0496106_0028967 3300048909 Bacteria 4126
453 Ga0496106_0125553 3300048909 Bacteria 2009
454 Ga0496106_0199575 3300048909 Bacteria 1592
455 Ga0496106_0220624 3300048909 Bacteria 1512
456 Ga0496106_0759748 3300048909 Bacteria 770
457 Ga0496107_0007913 3300048910 Bacteria 7336
458 Ga0496107_0013230 3300048910 Bacteria 5766
459 Ga0496107_0125496 3300048910 Bacteria 1893
460 Ga0496108_0003037 3300048911 Bacteria 13494
461 Ga0496108_0018688 3300048911 Bacteria 5679
462 Ga0496108_0039811 3300048911 Bacteria 3917
463 Ga0496108_0810894 3300048911 Bacteria 807
464 Ga0496108_1159716 3300048911 Unclassified 655
465 Ga0496109_0001996 3300048912 Bacteria 16921
466 Ga0496109_0003996 3300048912 Bacteria 12318
467 Ga0496109_0009353 3300048912 Bacteria 8349
468 Ga0496109_0256694 3300048912 Bacteria 1646
469 Ga0496109_0591648 3300048912 Bacteria 1045
470 Ga0496109_1074069 3300048912 Unclassified 742
471 Ga0496110_0098726 3300048913 Bacteria 2617
472 Ga0496110_0124660 3300048913 Bacteria 2323
473 Ga0496110_0127822 3300048913 Bacteria 2293
474 Ga0496110_0551602 3300048913 Bacteria 1047
475 Ga0496110_1546094 3300048913 Unclassified 573
476 Ga0496111_0001258 3300048914 Bacteria 14177
477 Ga0496111_0004266 3300048914 Bacteria 9011
478 Ga0496111_0043985 3300048914 Bacteria 3210
479 Ga0496111_0120903 3300048914 Bacteria 1934
480 Ga0496111_0481267 3300048914 Bacteria 915
481 Ga0496111_1095894 3300048914 Bacteria 568
482 Ga0496112_0018559 3300048915 Bacteria 6552
483 Ga0496112_0019516 3300048915 Bacteria 6399
484 Ga0496112_0094263 3300048915 Bacteria 2964
485 Ga0496112_0277364 3300048915 Bacteria 1624
486 Ga0496112_0713822 3300048915 Bacteria 930
487 Ga0496112_0936457 3300048915 Unclassified 787
488 Ga0496113_0002285 3300048916 Bacteria 11061
489 Ga0496113_0077862 3300048916 Bacteria 2536
490 Ga0496113_0079675 3300048916 Bacteria 2508
491 Ga0496113_0129449 3300048916 Bacteria 1979
492 Ga0496113_0184273 3300048916 Bacteria 1655
493 Ga0496113_0717293 3300048916 Bacteria 797
494 Ga0496114_0009175 3300048917 Bacteria 7841
495 Ga0496114_0138418 3300048917 Bacteria 2106
496 Ga0496114_0361204 3300048917 Bacteria 1285
497 Ga0496114_1090040 3300048917 Unclassified 683
498 Ga0496115_0001303 3300048918 Bacteria 17770
499 Ga0496115_0086346 3300048918 Bacteria 2560
500 Ga0496115_0114140 3300048918 Bacteria 2220
501 Ga0496115_0234361 3300048918 Bacteria 1513
502 Ga0496115_0401114 3300048918 Bacteria 1113
503 Ga0496115_0835692 3300048918 Unclassified 714
504 Ga0496115_1140188 3300048918 Unclassified 589
505 Ga0501031_0743611 3300049568 Bacteria 629
506 Ga0501032_0061823 3300049569 Bacteria 2510
507 Ga0501032_0164181 3300049569 Bacteria 1458
508 Ga0501034_0047512 3300049571 Bacteria 4333
509 Ga0501034_0266713 3300049571 Unclassified 1654
510 Ga0501034_1174495 3300049571 Unclassified 647
511 Ga0501034_1282571 3300049571 Bacteria 610
512 Ga0501036_0024833 3300049572 Bacteria 5053
513 Ga0501036_0201531 3300049572 Bacteria 1674
514 Ga0501036_0662412 3300049572 Unclassified 864
515 Ga0501037_0043666 3300049573 Bacteria 3293
516 Ga0501038_0028357 3300049574 Bacteria 4974
517 Ga0501040_1179790 3300049576 Unclassified 556
518 Ga0501041_0888890 3300049577 Unclassified 572
519 Ga0501042_0182242 3300049578 Bacteria 1515
520 Ga0501042_0598049 3300049578 Bacteria 802
521 Ga0501043_0020227 3300049579 Bacteria 5226
522 Ga0501046_0007934 3300049580 Bacteria 9293
523 Ga0501047_0012515 3300049581 Bacteria 8036
524 Ga0501048_0244707 3300049582 Bacteria 1273
525 Ga0501048_0422946 3300049582 Bacteria 953
526 Ga0501067_0112934 3300049583 Bacteria 1511
527 Ga0501068_0073676 3300049584 Bacteria 2086
528 Ga0501068_0789141 3300049584 Unclassified 623
529 Ga0501070_0087046 3300049586 Bacteria 2586
530 Ga0501072_0640043 3300049588 Unclassified 837
531 Ga0501072_0730948 3300049588 Bacteria 777
532 Ga0501073_0056275 3300049589 Bacteria 2751
533 Ga0501075_0968020 3300049591 Unclassified 647
534 Ga0501075_1350677 3300049591 Unclassified 540
535 Ga0501076_0781229 3300049592 Unclassified 788
536 Ga0501077_0302635 3300049593 Bacteria 1019
537 Ga0501077_0789144 3300049593 Bacteria 611
538 Ga0501079_0513015 3300049741 Unclassified 943
539 Ga0501079_0865888 3300049741 Bacteria 711
540 Ga0501080_0021834 3300049742 Bacteria 5930
541 Ga0501081_0672432 3300049743 Bacteria 777
542 Ga0501083_0017492 3300049744 Bacteria 4997
543 Ga0501035_0062283 3300049822 Bacteria 3319
544 Ga0501035_1324495 3300049822 Bacteria 554
545 Ga0501044_0050972 3300049823 Bacteria 4269
546 Ga0501045_0331837 3300049824 Bacteria 1132
547 Ga0501045_0486105 3300049824 Bacteria 917
548 nmdc:mga03683_108140_c1 3300050489 Bacteria 1227
549 nmdc:mga03683_347293_c1 3300050489 Bacteria 702
550 nmdc:mga03n38_348091_c1 3300050490 Bacteria 806
551 nmdc:mga00v17_129209_c1 3300050491 Bacteria 1613
552 nmdc:mga00v17_642760_c1 3300050491 Unclassified 682
553 nmdc:mga0yw44_317773_c1 3300050492 Unclassified 1045
554 nmdc:mga0yw44_411789_c1 3300050492 Bacteria 915
555 nmdc:mga0yw44_57992_c1 3300050492 Bacteria 2364
556 nmdc:mga0yw44_58036_c1 3300050492 Bacteria 2363
557 nmdc:mga0yw44_58691_c1 3300050492 Bacteria 2351
558 nmdc:mga0yw44_68548_c1 3300050492 Bacteria 2195
559 nmdc:mga0yw44_849081_c1 3300050492 Unclassified 620
560 nmdc:mga0k408_57443_c1 3300050493 Bacteria 2259
561 nmdc:mga06z11_29021_c1 3300050494 Bacteria 2661
562 nmdc:mga06z11_960828_c1 3300050494 Bacteria 521
563 nmdc:mga04h51_137964_c1 3300050495 Bacteria 923
564 nmdc:mga04h51_340013_c1 3300050495 Bacteria 619
565 nmdc:mga07m45_130017_c1 3300050496 Bacteria 1457
566 nmdc:mga05p37_1075438_c1 3300050507 Bacteria 845
567 nmdc:mga05p37_1480807_c1 3300050507 Bacteria 677
568 nmdc:mga05p37_1488431_c1 3300050507 Bacteria 675
569 nmdc:mga05p37_15988_c1 3300050507 Bacteria 9029
570 nmdc:mga05p37_2112540_c1 3300050507 Unclassified 527
571 nmdc:mga05p37_227428_c1 3300050507 Bacteria 2249
572 nmdc:mga05p37_232284_c1 3300050507 Bacteria 2221
573 nmdc:mga05p37_55809_c1 3300050507 Bacteria 4863
574 nmdc:mga05p37_873726_c1 3300050507 Bacteria 973
575 nmdc:mga09592_31572_c1 3300050508 Bacteria 4414
576 nmdc:mga0qj67_1521983_c1 3300050509 Bacteria 514
577 nmdc:mga0qj67_202892_c1 3300050509 Bacteria 1611
578 nmdc:mga0qj67_588_c1 3300050509 Bacteria 24756
579 nmdc:mga0qj67_931734_c1 3300050509 Unclassified 683
580 nmdc:mga06r32_139134_c1 3300050510 Bacteria 2403
581 nmdc:mga06r32_292722_c1 3300050510 Bacteria 1615
582 nmdc:mga06r32_314558_c1 3300050510 Bacteria 1551
583 nmdc:mga06r32_34599_c1 3300050510 Bacteria 4765
584 nmdc:mga06r32_559401_c1 3300050510 Bacteria 1117
585 nmdc:mga06r32_608193_c1 3300050510 Bacteria 1063
586 nmdc:mga08y16_43865_c1 3300050511 Bacteria 4686
587 nmdc:mga08y16_636848_c1 3300050511 Bacteria 1072
588 nmdc:mga08y16_670982_c1 3300050511 Bacteria 1039
589 nmdc:mga0n895_127986_c1 3300050512 Bacteria 2563
590 nmdc:mga0n895_346319_c1 3300050512 Bacteria 1505
591 nmdc:mga0n895_55293_c1 3300050512 Bacteria 3906
592 nmdc:mga0rr50_48924_c1 3300050513 Bacteria 3127
593 nmdc:mga0rr50_910945_c1 3300050513 Archaea 750
594 nmdc:mga0a205_907266_c1 3300050515 Unclassified 728
595 Ga0495601_0465305 3300053077 Bacteria 817
596 Ga0495601_0598318 3300053077 Unclassified 708
597 Ga0495612_0031675 3300053078 Bacteria 2133
598 Ga0495655_0021583 3300053083 Bacteria 1459
599 Ga0495655_0064201 3300053083 Bacteria 1010
600 Ga0495655_0121517 3300053083 Unclassified 795
601 Ga0495595_0684185 3300053084 Unclassified 525
602 Ga0495619_0027495 3300053085 Bacteria 3664
603 Ga0495619_0036789 3300053085 Bacteria 3189
604 Ga0495619_0091223 3300053085 Bacteria 2063
605 Ga0495619_0288748 3300053085 Unclassified 1136
606 Ga0500627_0080443 3300053158 Bacteria 1452
607 Ga0500645_021955 3300053730 Bacteria 1967
608 Ga0501084_0209827 3300054114 Bacteria 1643
609 Ga0501084_0266232 3300054114 Bacteria 1447
610 Ga0501084_0560986 3300054114 Bacteria 965
611 Ga0501084_1799435 3300054114 Bacteria 511
612 Ga0501082_0500347 3300060353 Bacteria 1062
613 Ga0530510_0055092 3300061734 Bacteria 2873
614 Ga0530510_0073613 3300061734 Bacteria 2480
615 Ga0530510_0278173 3300061734 Unclassified 1250
616 Ga0530510_0462340 3300061734 Bacteria 960
617 Ga0114129_10272827
618 JGI24739J22299_10098750
619 JGI24750J21931_1011284
620 JGI24749J21850_1022779
621 JGI24034J26672_10000653
622 JGI24742J22300_10004862
623 JGI25405J52794_10074215
624 JGI25405J52794_10134428
625 Ga0070676_10093995
626 Ga0070683_100033109
627 Ga0070690_100169259
628 Ga0070670_100034629
629 Ga0070670_100658701
630 Ga0070677_10383917
631 Ga0070680_101839075
632 Ga0070682_100160152
633 Ga0068868_100080441
634 Ga0070689_100035697
635 Ga0070689_101619447
636 Ga0070691_10116370
637 Ga0070687_100046093
638 Ga0070661_100286685
639 Ga0070692_10277993
640 Ga0070668_100299411
641 Ga0070669_100329021
642 Ga0070669_101066921
643 Ga0070675_100074186
644 Ga0070671_100238409
645 Ga0070671_100389373
646 Ga0070674_100221654
647 Ga0070674_100279035
648 Ga0070674_101021946
649 Ga0070673_100482095
650 Ga0070688_100025890
651 Ga0070688_100843951
652 Ga0070659_100105839
653 Ga0070667_100689845
654 Ga0070667_101028539
655 Ga0070714_100266748
656 Ga0070714_100383709
657 Ga0070714_100631432
658 Ga0070713_100079553
659 Ga0070713_100239820
660 Ga0070713_100641441
661 Ga0070710_10116874
662 Ga0070710_10242725
663 Ga0070701_10215001
664 Ga0070711_100206951
665 Ga0070711_101756637
666 Ga0070705_100180706
667 Ga0070700_100029227
668 Ga0070700_101911601
669 Ga0070694_100515776
670 Ga0070708_100070560
671 Ga0070663_100183547
672 Ga0070663_100592060
673 Ga0070678_100162632
674 Ga0070662_100218810
675 Ga0068867_100222281
676 Ga0070685_10233127
677 Ga0070706_100735244
678 Ga0070707_100021684
679 Ga0070707_100704109
680 Ga0070698_100219892
681 Ga0070698_101151489
682 Ga0070698_101443757
683 Ga0070699_100009473
684 Ga0070699_100111846
685 Ga0070684_100526526
686 Ga0070672_100028488
687 Ga0070686_100005064
688 Ga0070695_100123791
689 Ga0070693_100437518
690 Ga0070665_100070564
691 Ga0070665_102223352
692 Ga0070664_100204079
693 Ga0070664_100862071
694 Ga0068857_100630333
695 Ga0068854_100083656
696 Ga0068854_102061364
697 Ga0068856_100038688
698 Ga0068856_101053878
699 Ga0070702_100003381
700 Ga0070702_100111265
701 Ga0068852_100010801
702 Ga0068864_100006392
703 Ga0068864_100744546
704 Ga0068864_100946063
705 Ga0068864_101579116
706 Ga0068861_100244984
707 Ga0068851_10224887
708 Ga0068863_100065315
709 Ga0068863_100766943
710 Ga0068863_101530154
711 Ga0068858_100182925
712 Ga0068860_100156651
713 Ga0068862_100045088
714 Ga0081455_10008077
715 Ga0081455_10009432
716 Ga0081455_10022588
717 Ga0081455_10121749
718 Ga0081538_10066308
719 Ga0081540_1000011
720 Ga0081540_1016541
721 Ga0081540_1094457
722 Ga0070717_10219905
723 Ga0070717_10315976
724 Ga0070717_10855184
725 Ga0070717_11005506
726 Ga0075365_10047512
727 Ga0075365_10116459
728 Ga0075365_10275164
729 Ga0075365_10417120
730 Ga0075365_10507344
731 Ga0075368_10008621
732 Ga0075368_10230916
733 Ga0075363_100042522
734 Ga0075364_10049721
735 Ga0075364_10081507
736 Ga0075364_10706491
737 Ga0070716_101073268
738 Ga0070712_100000679
739 Ga0070712_100163329
740 Ga0070712_100559027
741 Ga0070712_101792839
742 Ga0075362_10102301
743 Ga0075362_10144571
744 Ga0075362_10213076
745 Ga0075362_10251879
746 Ga0075367_10010156
747 Ga0075367_10079117
748 Ga0075369_10042317
749 Ga0075366_10049750
750 Ga0075366_10417705
751 Ga0097621_100215413
752 Ga0075370_10064659
753 Ga0068871_100073099
754 Ga0075428_100046146
755 Ga0075428_100065049
756 Ga0075428_100169192
757 Ga0075428_100287880
758 Ga0075428_100390184
759 Ga0075428_101021941
760 Ga0075430_100031110
761 Ga0075430_100258272
762 Ga0075430_100408142
763 Ga0075430_100514562
764 Ga0075430_100525998
765 Ga0075430_101080585
766 Ga0075430_101550657
767 Ga0075431_100022167
768 Ga0075431_100024877
769 Ga0075431_100036419
770 Ga0075431_100335503
771 Ga0075431_100900081
772 Ga0075431_102099468
773 Ga0075433_11009467
774 Ga0075429_100009867
775 Ga0075429_101397149
776 Ga0068865_100002598
777 Ga0075436_101002065
778 Ga0075435_100127741
779 Ga0075435_101140284
780 Ga0099794_10042911
781 Ga0099795_10000539
782 Ga0105250_10198061
783 Ga0111539_10022499
784 Ga0111539_10177152
785 Ga0111539_10750898
786 Ga0111539_10797224
787 Ga0111539_10947250
788 Ga0111539_13131456
789 Ga0111539_13134346
790 Ga0105245_10005647
791 Ga0105245_12177324
792 Ga0105247_10036140
793 Ga0105247_10159204
794 Ga0114129_10002017
795 Ga0114129_10058246
796 Ga0114129_10362011
797 Ga0114129_11093624
798 Ga0114129_11532434
799 Ga0114129_11566582
800 Ga0114129_12354287
801 Ga0105243_10144826
802 Ga0105248_10389828
803 Ga0105238_10465377
804 Ga0105249_10241337
805 Ga0099796_10001397
806 Ga0105239_10965895
807 Ga0105239_11446835
808 Ga0157369_11383557
809 Ga0157374_10054993
810 Ga0157374_10517060
811 Ga0157378_10202550
812 Ga0163162_10211525
813 Ga0163162_10240703
814 Ga0163162_10675430
815 Ga0157372_10588958
816 Ga0157375_10870586
817 Ga0163163_10062628
818 Ga0163163_11334442
819 Ga0163163_11857898
820 Ga0157380_10024890
821 Ga0157380_10688658
822 Ga0157380_11260344
823 Ga0157377_10041164
824 Ga0157379_10182454
825 Ga0157379_11067738
826 Ga0157376_10481197
827 Ga0163161_11108039
828 Ga0213875_10323492
829 Ga0207697_10036195
830 Ga0207656_10114348
831 Ga0207692_10100492
832 Ga0207692_10531489
833 Ga0207642_10012456
834 Ga0207710_10001712
835 Ga0207688_10009692
836 Ga0207647_10073025
837 Ga0207685_10176583
838 Ga0207645_10042902
839 Ga0207643_10013533
840 Ga0207684_10867380
841 Ga0207671_10183791
842 Ga0207693_10003351
843 Ga0207693_10046438
844 Ga0207663_10242135
845 Ga0207663_11315353
846 Ga0207662_10077417
847 Ga0207657_10055234
848 Ga0207649_10171828
849 Ga0207652_11357422
850 Ga0207646_10954790
851 Ga0207681_10168065
852 Ga0207681_11287176
853 Ga0207694_11584331
854 Ga0207650_10110598
855 Ga0207659_10025923
856 Ga0207687_10017208
857 Ga0207687_10943114
858 Ga0207700_10067021
859 Ga0207700_10163640
860 Ga0207700_10633047
861 Ga0207700_10739272
862 Ga0207664_10649734
863 Ga0207644_10044102
864 Ga0207644_11073089
865 Ga0207706_10009812
866 Ga0207670_10404946
867 Ga0207669_10070018
868 Ga0207704_10003071
869 Ga0207665_10225898
870 Ga0207665_10480188
871 Ga0207665_11334644
872 Ga0207691_10004982
873 Ga0207689_10378572
874 Ga0207661_10969001
875 Ga0207661_11555477
876 Ga0207679_10216240
877 Ga0207679_11727069
878 Ga0207651_10064379
879 Ga0207651_10569345
880 Ga0207712_10078197
881 Ga0207668_10910774
882 Ga0207640_10051000
883 Ga0207658_10935076
884 Ga0207677_10483594
885 Ga0207703_10057131
886 Ga0207639_10209422
887 Ga0207639_12000701
888 Ga0207678_10061506
889 Ga0207678_10447185
890 Ga0207708_10216738
891 Ga0207708_10658312
892 Ga0207702_10070618
893 Ga0207702_10763514
894 Ga0207641_10010161
895 Ga0207648_10010527
896 Ga0207676_10366526
897 Ga0207676_10860448
898 Ga0207675_100001927
899 Ga0207675_101076692
900 Ga0207675_101601169
901 Ga0207683_10012723
902 Ga0207698_10028700
903 Ga0209179_1041297
904 Ga0209588_1120578
905 Ga0209813_10003761
906 Ga0209813_10299803
907 Ga0207428_10046959
908 Ga0207428_10506550
909 Ga0268266_10836798
910 Ga0268265_10009174
911 Ga0265338_10359319
912 Ga0265324_10122417
913 Ga0265762_1049835
914 Ga0265760_10121501
915 Ga0265330_10146975
916 Ga0265328_10279139
917 Ga0265320_10071505
918 Ga0265325_10270446
919 Ga0265340_10028959
920 Ga0265340_10553479
921 Ga0265331_10123597
922 Ga0265331_10245786
923 Ga0265316_10276938
924 Ga0265316_10507986
925 Ga0265313_10223804
926 Ga0265314_10008515
927 Ga0373926_0024368
928 Ga0373944_0007971
929 Ga0373923_0405592
930 Ga0373936_0053002
931 Ga0373936_0615407
932 Ga0373936_0632937
933 Ga0373939_0115448
934 Ga0373945_0115241
935 Ga0373953_0012249
936 Ga0373954_0126127
937 Ga0373956_0061727
938 Ga0373943_0036799
939 Ga0373946_0105932
940 Ga0373955_0035773
941 Ga0373955_0495805
942 Ga0373961_0192069
943 Ga0373931_0174735
944 Ga0373935_1283359
945 Ga0373927_0267827
946 Ga0373927_0592204
947 Ga0373927_0909595
948 Ga0373933_0364095
949 Ga0373947_0109095
950 Ga0373937_0001283
951 Ga0373937_1020712
952 Ga0373925_0125556
953 Ga0373925_0468489
954 Ga0373925_0849208
955 Ga0395900_0162842
956 Ga0395898_0091901
957 Ga0395905_0139640
958 Ga0436364_0947481
959 Ga0395901_0700569
960 Ga0436360_0197820
961 Ga0436360_0978008
962 Ga0436361_0433570
963 Ga0436361_0750883
964 Ga0436363_0991462
965 Ga0436362_0872844
966 Ga0439465_0257955
967 Ga0451837_1546431
968 Ga0451845_0357486
969 Ga0451853_2877422
970 Ga0451576_1340382
971 Ga0495603_0008852
972 Ga0495590_0141006
973 Ga0495591_124031
974 Ga0495629_0157673
975 Ga0495629_0295232
976 Ga0495638_0025742
977 Ga0495641_0068971
978 Ga0495641_0252044
979 Ga0495582_0134480
980 Ga0495605_0155968
981 Ga0495639_0028987
982 Ga0495639_0429215
983 Ga0495662_0108721
984 Ga0495662_0675823
985 Ga0495584_0008242
986 Ga0495584_0133887
987 Ga0495584_0172654
988 Ga0495585_0032927
989 Ga0495585_0218111
990 Ga0495596_0195848
991 Ga0495596_0392440
992 Ga0495607_0236745
993 Ga0495618_0267205
994 Ga0495630_0136236
995 Ga0495630_0886479
996 Ga0495631_0243984
997 Ga0495632_0201302
998 Ga0495637_0085442
999 Ga0495643_0030352
1000 Ga0495643_0442840
1001 Ga0495644_0031039
1002 Ga0495644_0213808
1003 Ga0495666_0127238
1004 Ga0495642_0326947
1005 Ga0495640_0060129
1006 Ga0495640_0475596
1007 Ga0495598_0163128
1008 Ga0495609_0313112
1009 Ga0495656_0155294
1010 Ga0495656_0157061
1011 Ga0495668_0706239
1012 Ga0495634_0172156
1013 Ga0495634_0597254
1014 Ga0495611_0062855
1015 Ga0495611_0154232
1016 Ga0495635_0221030
1017 Ga0495659_0107575
1018 Ga0495659_0272296
1019 Ga0495588_0078700
1020 Ga0495647_0037816
1021 Ga0495658_0033067
1022 Ga0495669_0065256
1023 Ga0495613_0379273
1024 Ga0495624_0355763
1025 Ga0495670_0079535
1026 Ga0495671_0303276
1027 Ga0495581_0061335
1028 Ga0495581_0201292
1029 Ga0495636_0426208
1030 Ga0495674_0386325
1031 Ga0495674_0846908
1032 Ga0495674_0993240
1033 Ga0495672_0535410
1034 Ga0495676_0523801
1035 Ga0495680_0540159
1036 Ga0495673_0253832
1037 Ga0495684_0242527
1038 Ga0495602_0815604
1039 Ga0495614_0191041
1040 Ga0495614_0234824
1041 Ga0495626_0068524
1042 Ga0495626_0232108
1043 Ga0496100_0002562
1044 Ga0496100_0044813
1045 Ga0496100_0059377
1046 Ga0496100_0146844
1047 Ga0496101_0061916
1048 Ga0496101_1413634
1049 Ga0496101_1433300
1050 Ga0496102_0003286
1051 Ga0496102_0031951
1052 Ga0496102_0602217
1053 Ga0496103_0000865
1054 Ga0496103_0017439
1055 Ga0496104_0001467
1056 Ga0496104_0002041
1057 Ga0496104_0002377
1058 Ga0496104_0025257
1059 Ga0496104_0054685
1060 Ga0496104_0204907
1061 Ga0496104_1301846
1062 Ga0496105_0002893
1063 Ga0496105_0059529
1064 Ga0496105_0098575
1065 Ga0496105_0193015
1066 Ga0496105_0209801
1067 Ga0496106_0008084
1068 Ga0496106_0028967
1069 Ga0496106_0125553
1070 Ga0496106_0199575
1071 Ga0496106_0220624
1072 Ga0496106_0759748
1073 Ga0496107_0007913
1074 Ga0496107_0013230
1075 Ga0496107_0125496
1076 Ga0496108_0003037
1077 Ga0496108_0018688
1078 Ga0496108_0039811
1079 Ga0496108_0810894
1080 Ga0496108_1159716
1081 Ga0496109_0001996
1082 Ga0496109_0003996
1083 Ga0496109_0009353
1084 Ga0496109_0256694
1085 Ga0496109_0591648
1086 Ga0496109_1074069
1087 Ga0496110_0098726
1088 Ga0496110_0124660
1089 Ga0496110_0127822
1090 Ga0496110_0551602
1091 Ga0496110_1546094
1092 Ga0496111_0001258
1093 Ga0496111_0004266
1094 Ga0496111_0043985
1095 Ga0496111_0120903
1096 Ga0496111_0481267
1097 Ga0496111_1095894
1098 Ga0496112_0018559
1099 Ga0496112_0019516
1100 Ga0496112_0094263
1101 Ga0496112_0277364
1102 Ga0496112_0713822
1103 Ga0496112_0936457
1104 Ga0496113_0002285
1105 Ga0496113_0077862
1106 Ga0496113_0079675
1107 Ga0496113_0129449
1108 Ga0496113_0184273
1109 Ga0496113_0717293
1110 Ga0496114_0009175
1111 Ga0496114_0138418
1112 Ga0496114_0361204
1113 Ga0496114_1090040
1114 Ga0496115_0001303
1115 Ga0496115_0086346
1116 Ga0496115_0114140
1117 Ga0496115_0234361
1118 Ga0496115_0401114
1119 Ga0496115_0835692
1120 Ga0496115_1140188
1121 Ga0501031_0743611
1122 Ga0501032_0061823
1123 Ga0501032_0164181
1124 Ga0501034_0047512
1125 Ga0501034_0266713
1126 Ga0501034_1174495
1127 Ga0501034_1282571
1128 Ga0501036_0024833
1129 Ga0501036_0201531
1130 Ga0501036_0662412
1131 Ga0501037_0043666
1132 Ga0501038_0028357
1133 Ga0501040_1179790
1134 Ga0501041_0888890
1135 Ga0501042_0182242
1136 Ga0501042_0598049
1137 Ga0501043_0020227
1138 Ga0501046_0007934
1139 Ga0501047_0012515
1140 Ga0501048_0244707
1141 Ga0501048_0422946
1142 Ga0501067_0112934
1143 Ga0501068_0073676
1144 Ga0501068_0789141
1145 Ga0501070_0087046
1146 Ga0501072_0640043
1147 Ga0501072_0730948
1148 Ga0501073_0056275
1149 Ga0501075_0968020
1150 Ga0501075_1350677
1151 Ga0501076_0781229
1152 Ga0501077_0302635
1153 Ga0501077_0789144
1154 Ga0501079_0513015
1155 Ga0501079_0865888
1156 Ga0501080_0021834
1157 Ga0501081_0672432
1158 Ga0501083_0017492
1159 Ga0501035_0062283
1160 Ga0501035_1324495
1161 Ga0501044_0050972
1162 Ga0501045_0331837
1163 Ga0501045_0486105
1164 nmdc:mga03683_108140_c1
1165 nmdc:mga03683_347293_c1
1166 nmdc:mga03n38_348091_c1
1167 nmdc:mga00v17_129209_c1
1168 nmdc:mga00v17_642760_c1
1169 nmdc:mga0yw44_317773_c1
1170 nmdc:mga0yw44_411789_c1
1171 nmdc:mga0yw44_57992_c1
1172 nmdc:mga0yw44_58036_c1
1173 nmdc:mga0yw44_58691_c1
1174 nmdc:mga0yw44_68548_c1
1175 nmdc:mga0yw44_849081_c1
1176 nmdc:mga0k408_57443_c1
1177 nmdc:mga06z11_29021_c1
1178 nmdc:mga06z11_960828_c1
1179 nmdc:mga04h51_137964_c1
1180 nmdc:mga04h51_340013_c1
1181 nmdc:mga07m45_130017_c1
1182 nmdc:mga05p37_1075438_c1
1183 nmdc:mga05p37_1480807_c1
1184 nmdc:mga05p37_1488431_c1
1185 nmdc:mga05p37_15988_c1
1186 nmdc:mga05p37_2112540_c1
1187 nmdc:mga05p37_227428_c1
1188 nmdc:mga05p37_232284_c1
1189 nmdc:mga05p37_55809_c1
1190 nmdc:mga05p37_873726_c1
1191 nmdc:mga09592_31572_c1
1192 nmdc:mga0qj67_1521983_c1
1193 nmdc:mga0qj67_202892_c1
1194 nmdc:mga0qj67_588_c1
1195 nmdc:mga0qj67_931734_c1
1196 nmdc:mga06r32_139134_c1
1197 nmdc:mga06r32_292722_c1
1198 nmdc:mga06r32_314558_c1
1199 nmdc:mga06r32_34599_c1
1200 nmdc:mga06r32_559401_c1
1201 nmdc:mga06r32_608193_c1
1202 nmdc:mga08y16_43865_c1
1203 nmdc:mga08y16_636848_c1
1204 nmdc:mga08y16_670982_c1
1205 nmdc:mga0n895_127986_c1
1206 nmdc:mga0n895_346319_c1
1207 nmdc:mga0n895_55293_c1
1208 nmdc:mga0rr50_48924_c1
1209 nmdc:mga0rr50_910945_c1
1210 nmdc:mga0a205_907266_c1
1211 Ga0495601_0465305
1212 Ga0495601_0598318
1213 Ga0495612_0031675
1214 Ga0495655_0021583
1215 Ga0495655_0064201
1216 Ga0495655_0121517
1217 Ga0495595_0684185
1218 Ga0495619_0027495
1219 Ga0495619_0036789
1220 Ga0495619_0091223
1221 Ga0495619_0288748
1222 Ga0500627_0080443
1223 Ga0500645_021955
1224 Ga0501084_0209827
1225 Ga0501084_0266232
1226 Ga0501084_0560986
1227 Ga0501084_1799435
1228 Ga0501082_0500347
1229 Ga0530510_0055092
1230 Ga0530510_0073613
1231 Ga0530510_0278173
1232 Ga0530510_0462340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t2n-assembly1.cif.gz_A human hepsin protease in complex with the fab fragment of an inhibitory antibody 0.6469 50 101
1z8g-assembly1.cif.gz_A crystal structure of the extracellular region of the transmembrane serine protease hepsin with covalently bound preferred substrate. 0.64 50 101
5ce1-assembly1.cif.gz_A crystal structure of serine protease hepsin in complex with inhibitor 0.6268 50 101
7wr7-assembly1.cif.gz_A structure of inhibited-ep 0.6256 54 101
3t2n-assembly2.cif.gz_B human hepsin protease in complex with the fab fragment of an inhibitory antibody 0.6228 50 101
ID Description Score Start End Superfamily
af_A5PF55_136_229_3.10.250.10 Alpha Beta;Roll;Mac-2 Binding Protein;SRCR-like domain 0.7696 35 76 3.10.250.10
af_A0A2R8Q7N1_200_302_3.10.250.10 Alpha Beta;Roll;Mac-2 Binding Protein;SRCR-like domain 0.6897 54 103 3.10.250.10
af_Q9BYE2_224_316_3.10.250.10 Alpha Beta;Roll;Mac-2 Binding Protein;SRCR-like domain 0.6635 33 81 3.10.250.10
af_P98073_679_785_3.10.250.10 Alpha Beta;Roll;Mac-2 Binding Protein;SRCR-like domain 0.6454 54 101 3.10.250.10
1o5eL00 Alpha Beta;Roll;Mac-2 Binding Protein;SRCR-like domain 0.6447 50 103 3.10.250.10
ID Description Score Start End GO Terms
AF-A0A0R3D0D0-F1-model_v4 DUF4189 domain-containing protein 0.8589 21 103
AF-A0A0Q7TZN3-F1-model_v4 DUF4189 domain-containing protein 0.8114 26 103
AF-A0A1M3CGE1-F1-model_v4 Uncharacterized protein 0.7796 21 103
AF-F7QLL0-F1-model_v4 Uncharacterized protein 0.7775 26 103
AF-A0A2T1HVR5-F1-model_v4 Secreted protein 0.7749 26 103

Map