F469505

General Info

Members Datasets Scaffolds Average Seq Length
616 332 612 73

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10164698|Ga0070658_101646983
Length 85
Sequence MPIIVRLDVMLALRKVRSKELAADIGITEANLSLLKSGKVKGIRFATLEAICERLQCQPGDLLEYAPDDGSATVDESLTGAAGSP

Samples

Sample ID Description Type Environment
1 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
2 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
3 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
4 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
128 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
232 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
233 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
234 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
235 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
236 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
237 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
238 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
239 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
240 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
314 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
315 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
316 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
317 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
318 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
319 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
320 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
321 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
324 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
327 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
328 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
329 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.16
Nodule 0.32
Rhizoplane 4.06
Rhizosphere 72.24
Stem 0
Stem Tuber 0
Unclassified 4.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1051727 3300001904 Bacteria 632
2 JGI24746J21847_1023735 3300001977 Bacteria 852
3 JGI24739J22299_10036301 3300001989 Bacteria 1666
4 JGI24737J22298_10128711 3300001990 Bacteria 748
5 JGI24737J22298_10168045 3300001990 Bacteria 647
6 JGI24743J22301_10126232 3300001991 Bacteria 563
7 JGI24735J21928_10003438 3300002067 Bacteria 5393
8 JGI24749J21850_1013240 3300002076 Bacteria 1158
9 JGI24033J26618_1038417 3300002155 Bacteria 662
10 JGI24742J22300_10026940 3300002244 Bacteria 996
11 JGI25155J39150_1000002 3300002704 Bacteria 292156
12 JGI25156J39149_1000003 3300002705 Bacteria 305434
13 JGI25154J39366_1000009 3300002738 Bacteria 305408
14 JGI25157J39369_1000002 3300002741 Bacteria 305434
15 JGI25150J39212_1008736 3300002774 Bacteria 1967
16 JGI25150J39212_1008811 3300002774 Bacteria 1954
17 JGI25159J45721_1008813 3300002987 Bacteria 2731
18 JGI25151J46595_10130458 3300003187 Bacteria 627
19 JGI25151J46595_10168592 3300003187 Bacteria 509
20 rootH2_10024667 3300003320 Bacteria 13213
21 rootL2_10317629 3300003322 Bacteria 1038
22 JGI25160J50197_1084271 3300003354 Bacteria 585
23 Ga0055526_1005186 3300003771 Bacteria 7571
24 Ga0055537_1000246 3300003773 Bacteria 39605
25 Ga0055537_1024471 3300003773 Bacteria 848
26 Ga0055524_1000083 3300003775 Bacteria 119259
27 Ga0055524_1009557 3300003775 Bacteria 3931
28 Ga0055524_1014274 3300003775 Bacteria 2951
29 Ga0055524_1076396 3300003775 Bacteria 625
30 Ga0055536_1000594 3300003781 Bacteria 24651
31 Ga0055536_1000644 3300003781 Bacteria 23734
32 Ga0055536_1013314 3300003781 Bacteria 2981
33 Ga0055536_1022606 3300003781 Bacteria 1871
34 Ga0055536_1038392 3300003781 Bacteria 1161
35 Ga0055536_1040232 3300003781 Bacteria 1115
36 Ga0055536_1068568 3300003781 Bacteria 708
37 Ga0055536_1089267 3300003781 Bacteria 569
38 Ga0055534_1004416 3300003784 Bacteria 4078
39 Ga0055534_1038777 3300003784 Bacteria 708
40 Ga0055534_1042630 3300003784 Bacteria 664
41 Ga0055528_1000450 3300003790 Bacteria 32880
42 Ga0055528_1071910 3300003790 Bacteria 623
43 Ga0055530_10000327 3300003791 Bacteria 42981
44 Ga0055530_10001376 3300003791 Bacteria 18020
45 Ga0055530_10053047 3300003791 Bacteria 933
46 Ga0055540_1000012 3300003792 Bacteria 262667
47 Ga0055531_10002179 3300003794 Bacteria 13370
48 Ga0055531_10003025 3300003794 Bacteria 10907
49 Ga0055531_10012688 3300003794 Bacteria 3942
50 Ga0055531_10013728 3300003794 Bacteria 3710
51 Ga0055531_10020404 3300003794 Bacteria 2622
52 Ga0055531_10031558 3300003794 Bacteria 1751
53 Ga0065165_1000569 3300005262 Bacteria 54781
54 Ga0065165_1034884 3300005262 Bacteria 1550
55 Ga0065715_10443413 3300005293 Bacteria 834
56 Ga0070658_10006118 3300005327 Bacteria 9760
57 Ga0070658_10009558 3300005327 Bacteria 7783
58 Ga0070658_10128975 3300005327 Bacteria 2106
59 Ga0070658_10164698 3300005327 Bacteria 1861
60 Ga0070658_11660308 3300005327 Bacteria 553
61 Ga0070676_10001015 3300005328 Bacteria 13927
62 Ga0070676_10063840 3300005328 Bacteria 2194
63 Ga0070676_10117667 3300005328 Bacteria 1663
64 Ga0070676_10815380 3300005328 Bacteria 689
65 Ga0070690_100032003 3300005330 Bacteria 3281
66 Ga0070690_100319354 3300005330 Bacteria 1118
67 Ga0070670_100134113 3300005331 Bacteria 2139
68 Ga0070670_100317916 3300005331 Bacteria 1364
69 Ga0070677_10008616 3300005333 Bacteria 3437
70 Ga0068869_100378176 3300005334 Bacteria 1160
71 Ga0070666_10002718 3300005335 Bacteria 10684
72 Ga0070666_10020041 3300005335 Bacteria 4320
73 Ga0070666_10169887 3300005335 Bacteria 1527
74 Ga0070666_10232044 3300005335 Bacteria 1304
75 Ga0070680_100000181 3300005336 Bacteria 40747
76 Ga0068868_100003120 3300005338 Bacteria 11534
77 Ga0068868_100005168 3300005338 Bacteria 9161
78 Ga0068868_100137392 3300005338 Bacteria 2004
79 Ga0070660_100490847 3300005339 Bacteria 1021
80 Ga0070660_100612903 3300005339 Bacteria 910
81 Ga0070660_100734251 3300005339 Bacteria 829
82 Ga0070689_100069990 3300005340 Bacteria 2738
83 Ga0070689_100794555 3300005340 Bacteria 832
84 Ga0070687_100995491 3300005343 Bacteria 607
85 Ga0070661_100047387 3300005344 Bacteria 3145
86 Ga0070661_100300626 3300005344 Bacteria 1249
87 Ga0070661_100546550 3300005344 Bacteria 931
88 Ga0070661_101028592 3300005344 Bacteria 684
89 Ga0070668_100237887 3300005347 Bacteria 1507
90 Ga0070668_101005291 3300005347 Bacteria 749
91 Ga0070669_100821909 3300005353 Bacteria 790
92 Ga0070675_100006519 3300005354 Bacteria 8967
93 Ga0070671_100007811 3300005355 Bacteria 8546
94 Ga0070671_100014488 3300005355 Bacteria 6373
95 Ga0070671_100089982 3300005355 Bacteria 2569
96 Ga0070671_101307973 3300005355 Bacteria 639
97 Ga0070674_100008788 3300005356 Bacteria 6027
98 Ga0070674_100023865 3300005356 Bacteria 3965
99 Ga0070674_100116069 3300005356 Bacteria 1974
100 Ga0070673_100005923 3300005364 Bacteria 7897
101 Ga0070673_100038519 3300005364 Bacteria 3651
102 Ga0070673_100109206 3300005364 Bacteria 2291
103 Ga0070673_100445195 3300005364 Bacteria 1164
104 Ga0070688_100058498 3300005365 Bacteria 2427
105 Ga0070688_101412625 3300005365 Bacteria 564
106 Ga0070659_100131600 3300005366 Bacteria 2032
107 Ga0070659_100931021 3300005366 Bacteria 760
108 Ga0070667_100006170 3300005367 Bacteria 9966
109 Ga0070667_100145304 3300005367 Bacteria 2079
110 Ga0070667_100204861 3300005367 Bacteria 1751
111 Ga0070667_100307874 3300005367 Bacteria 1427
112 Ga0070667_100514127 3300005367 Bacteria 1098
113 Ga0070713_100895053 3300005436 Bacteria 853
114 Ga0070711_101340254 3300005439 Bacteria 622
115 Ga0070705_100936510 3300005440 Bacteria 699
116 Ga0070700_100189177 3300005441 Bacteria 1438
117 Ga0070663_100235080 3300005455 Bacteria 1444
118 Ga0070663_100805750 3300005455 Bacteria 806
119 Ga0070678_100008844 3300005456 Bacteria 6058
120 Ga0070678_100026605 3300005456 Bacteria 3914
121 Ga0070662_100002319 3300005457 Bacteria 11690
122 Ga0070662_100002657 3300005457 Bacteria 11026
123 Ga0070662_100172243 3300005457 Bacteria 1700
124 Ga0070662_100973906 3300005457 Bacteria 725
125 Ga0070681_10000002 3300005458 Bacteria 821814
126 Ga0068867_100024829 3300005459 Bacteria 4297
127 Ga0070685_10109208 3300005466 Bacteria 1701
128 Ga0070679_100000380 3300005530 Bacteria 37755
129 Ga0070679_100090724 3300005530 Bacteria 3044
130 Ga0068853_101038618 3300005539 Bacteria 789
131 Ga0070672_100011211 3300005543 Bacteria 6248
132 Ga0070672_100159845 3300005543 Bacteria 1868
133 Ga0070686_100015980 3300005544 Bacteria 4359
134 Ga0070686_101761810 3300005544 Bacteria 527
135 Ga0070693_101010653 3300005547 Bacteria 629
136 Ga0070665_100024410 3300005548 Bacteria 6088
137 Ga0070665_100072277 3300005548 Bacteria 3457
138 Ga0070665_100218678 3300005548 Bacteria 1905
139 Ga0070665_100856041 3300005548 Bacteria 922
140 Ga0070704_102251289 3300005549 Bacteria 507
141 Ga0068855_100612987 3300005563 Bacteria 1172
142 Ga0070664_100266267 3300005564 Bacteria 1543
143 Ga0070664_102166141 3300005564 Bacteria 527
144 Ga0068857_100629203 3300005577 Bacteria 1016
145 Ga0068857_100871183 3300005577 Bacteria 863
146 Ga0068854_100321731 3300005578 Bacteria 1257
147 Ga0068854_100827416 3300005578 Bacteria 809
148 Ga0068854_101392731 3300005578 Bacteria 634
149 Ga0068856_100041790 3300005614 Bacteria 4507
150 Ga0068856_100889481 3300005614 Bacteria 909
151 Ga0068852_100027385 3300005616 Bacteria 4645
152 Ga0068852_100429648 3300005616 Bacteria 1304
153 Ga0068852_100486070 3300005616 Bacteria 1227
154 Ga0068852_101142323 3300005616 Bacteria 799
155 Ga0068859_100035149 3300005617 Bacteria 5027
156 Ga0068859_100056929 3300005617 Bacteria 3937
157 Ga0068859_100070884 3300005617 Bacteria 3521
158 Ga0068864_100058476 3300005618 Bacteria 3332
159 Ga0068864_100351974 3300005618 Bacteria 1390
160 Ga0068864_102077594 3300005618 Bacteria 574
161 Ga0068861_100053995 3300005719 Bacteria 3060
162 Ga0068861_102110048 3300005719 Bacteria 563
163 Ga0068851_11102655 3300005834 Bacteria 503
164 Ga0068870_10740182 3300005840 Bacteria 682
165 Ga0068863_100022253 3300005841 Bacteria 6052
166 Ga0068863_100070531 3300005841 Bacteria 3305
167 Ga0068858_100006240 3300005842 Bacteria 11615
168 Ga0068858_100089669 3300005842 Bacteria 2861
169 Ga0068860_100050321 3300005843 Bacteria 3967
170 Ga0068860_100166753 3300005843 Bacteria 2126
171 Ga0068860_101282879 3300005843 Bacteria 753
172 Ga0068862_100027088 3300005844 Bacteria 4823
173 Ga0075366_10377004 3300006195 Bacteria 872
174 Ga0097621_100271850 3300006237 Bacteria 1489
175 Ga0097621_100907902 3300006237 Bacteria 821
176 Ga0068871_100054690 3300006358 Bacteria 3239
177 Ga0068871_100264647 3300006358 Bacteria 1501
178 Ga0075430_101572543 3300006846 Bacteria 540
179 Ga0068865_100023365 3300006881 Bacteria 4047
180 Ga0068865_100037434 3300006881 Bacteria 3276
181 Ga0068865_100469335 3300006881 Bacteria 1044
182 Ga0068865_100875948 3300006881 Bacteria 779
183 Ga0075436_101320120 3300006914 Bacteria 546
184 Ga0097620_100035149 3300006931 Bacteria 5027
185 Ga0097620_100051392 3300006931 Bacteria 4142
186 Ga0097620_100056929 3300006931 Bacteria 3937
187 Ga0097620_100070885 3300006931 Bacteria 3521
188 Ga0079104_1022531 3300006946 Bacteria 1692
189 Ga0105240_10013261 3300009093 Bacteria 11335
190 Ga0105240_11960216 3300009093 Bacteria 609
191 Ga0111539_10133677 3300009094 Bacteria 2904
192 Ga0105245_10029216 3300009098 Bacteria 4869
193 Ga0105247_10028393 3300009101 Bacteria 3385
194 Ga0105247_10042611 3300009101 Bacteria 2781
195 Ga0105247_10297317 3300009101 Bacteria 1119
196 Ga0105243_10504422 3300009148 Bacteria 1147
197 Ga0105241_10109722 3300009174 Bacteria 2207
198 Ga0105241_10146923 3300009174 Unclassified 1925
199 Ga0105241_10341645 3300009174 Bacteria 1297
200 Ga0105241_12499536 3300009174 Bacteria 517
201 Ga0105242_10173509 3300009176 Bacteria 1896
202 Ga0105248_10014744 3300009177 Bacteria 8606
203 Ga0105248_10171293 3300009177 Bacteria 2447
204 Ga0105248_10324090 3300009177 Bacteria 1735
205 Ga0105248_10495672 3300009177 Bacteria 1377
206 Ga0105248_11433382 3300009177 Bacteria 782
207 Ga0105238_10010489 3300009551 Bacteria 9300
208 Ga0105238_12483631 3300009551 Bacteria 554
209 Ga0105249_10104517 3300009553 Bacteria 2669
210 Ga0105249_11587069 3300009553 Bacteria 727
211 Ga0105028_141959 3300009993 Unclassified 516
212 Ga0105239_10010608 3300010375 Bacteria 10305
213 Ga0105239_10864800 3300010375 Bacteria 1037
214 Ga0105239_12943177 3300010375 Bacteria 555
215 Ga0105239_13090962 3300010375 Bacteria 542
216 Ga0105246_10440689 3300011119 Bacteria 1092
217 Ga0157371_10017862 3300013102 Bacteria 5258
218 Ga0157369_10016105 3300013105 Bacteria 8413
219 Ga0157369_10079417 3300013105 Bacteria 3514
220 Ga0157369_10129097 3300013105 Bacteria 2679
221 Ga0157369_10137263 3300013105 Bacteria 2588
222 Ga0157369_10243788 3300013105 Bacteria 1877
223 Ga0157369_10924728 3300013105 Bacteria 894
224 Ga0157374_10154744 3300013296 Bacteria 2231
225 Ga0157374_10228049 3300013296 Bacteria 1829
226 Ga0157374_10306050 3300013296 Bacteria 1573
227 Ga0157374_11962328 3300013296 Bacteria 611
228 Ga0157378_10060761 3300013297 Bacteria 3372
229 Ga0157378_10106836 3300013297 Bacteria 2561
230 Ga0157378_10204983 3300013297 Bacteria 1867
231 Ga0157378_10486333 3300013297 Bacteria 1231
232 Ga0157378_10989859 3300013297 Bacteria 875
233 Ga0157378_12374387 3300013297 Bacteria 582
234 Ga0163162_10309432 3300013306 Bacteria 1712
235 Ga0163162_11881307 3300013306 Bacteria 685
236 Ga0157372_10003710 3300013307 Bacteria 16413
237 Ga0157372_11699718 3300013307 Bacteria 726
238 Ga0157375_10071528 3300013308 Bacteria 3482
239 Ga0157375_11984894 3300013308 Bacteria 691
240 Ga0163163_10042167 3300014325 Bacteria 4468
241 Ga0157380_10024709 3300014326 Bacteria 4550
242 Ga0157377_10011511 3300014745 Bacteria 4418
243 Ga0157379_10037397 3300014968 Bacteria 4328
244 Ga0157376_10266483 3300014969 Bacteria 1607
245 Ga0182005_1139568 3300015265 Bacteria 700
246 Ga0163161_10040001 3300017792 Bacteria 3367
247 Ga0213876_10001074 3300021384 Bacteria 17574
248 Ga0213876_10520470 3300021384 Bacteria 633
249 Ga0209435_100001 3300025206 Bacteria 1424171
250 Ga0207425_1005712 3300025245 Bacteria 3507
251 Ga0207425_1007315 3300025245 Bacteria 2925
252 Ga0207425_1020857 3300025245 Bacteria 1396
253 Ga0207425_1083092 3300025245 Bacteria 532
254 Ga0209646_1000001 3300025246 Bacteria 3092932
255 Ga0209026_1000003 3300025250 Bacteria 1060571
256 Ga0209759_1000001 3300025256 Bacteria 2799452
257 Ga0209565_1000004 3300025263 Bacteria 983150
258 Ga0209565_1000512 3300025263 Bacteria 27970
259 Ga0209673_1000074 3300025273 Bacteria 233552
260 Ga0209130_1000303 3300025284 Bacteria 60008
261 Ga0209130_1003980 3300025284 Bacteria 5899
262 Ga0209130_1058724 3300025284 Bacteria 674
263 Ga0209675_1000044 3300025291 Bacteria 230392
264 Ga0209675_1002583 3300025291 Bacteria 9190
265 Ga0209675_1011061 3300025291 Bacteria 3019
266 Ga0209675_1013155 3300025291 Bacteria 2611
267 Ga0209675_1059655 3300025291 Bacteria 758
268 Ga0209675_1060746 3300025291 Bacteria 748
269 Ga0209676_1000029 3300025292 Bacteria 520536
270 Ga0209676_1001411 3300025292 Bacteria 23180
271 Ga0209676_1001529 3300025292 Bacteria 21007
272 Ga0209676_1002203 3300025292 Bacteria 14541
273 Ga0209676_1005904 3300025292 Bacteria 6215
274 Ga0209676_1006092 3300025292 Bacteria 6064
275 Ga0209676_1007204 3300025292 Bacteria 5296
276 Ga0209676_1110634 3300025292 Bacteria 568
277 Ga0209025_1000562 3300025294 Bacteria 68180
278 Ga0209025_1005124 3300025294 Bacteria 10875
279 Ga0209025_1008130 3300025294 Bacteria 7618
280 Ga0209025_1032273 3300025294 Bacteria 2452
281 Ga0209025_1046191 3300025294 Bacteria 1794
282 Ga0209025_1064993 3300025294 Bacteria 1336
283 Ga0209025_1113131 3300025294 Bacteria 829
284 Ga0209025_1143605 3300025294 Bacteria 671
285 Ga0209025_1184491 3300025294 Bacteria 531
286 Ga0209564_1000824 3300025295 Bacteria 42177
287 Ga0209564_1006639 3300025295 Bacteria 6178
288 Ga0209564_1067423 3300025295 Bacteria 763
289 Ga0209758_1018098 3300025297 Bacteria 3472
290 Ga0209758_1067680 3300025297 Bacteria 1141
291 Ga0209758_1068524 3300025297 Bacteria 1129
292 Ga0209050_1000003 3300025298 Bacteria 1609245
293 Ga0209050_1001252 3300025298 Bacteria 29294
294 Ga0209050_1017396 3300025298 Bacteria 2870
295 Ga0209256_1000001 3300025299 Bacteria 2166974
296 Ga0209256_1000457 3300025299 Bacteria 61666
297 Ga0209256_1001133 3300025299 Bacteria 30376
298 Ga0209256_1001275 3300025299 Bacteria 27368
299 Ga0209256_1011883 3300025299 Bacteria 3417
300 Ga0207426_1001024 3300025302 Bacteria 26788
301 Ga0207426_1041745 3300025302 Bacteria 1419
302 Ga0209051_1000003 3300025303 Bacteria 1609245
303 Ga0209051_1019015 3300025303 Bacteria 3015
304 Ga0209257_1000018 3300025304 Bacteria 836016
305 Ga0209257_1000065 3300025304 Bacteria 353604
306 Ga0209257_1000529 3300025304 Bacteria 66275
307 Ga0209257_1000867 3300025304 Bacteria 42999
308 Ga0209257_1002673 3300025304 Bacteria 17100
309 Ga0209257_1003712 3300025304 Bacteria 12690
310 Ga0209257_1025478 3300025304 Bacteria 2020
311 Ga0207697_10045533 3300025315 Bacteria 1806
312 Ga0207697_10313158 3300025315 Bacteria 696
313 Ga0207656_10021329 3300025321 Bacteria 2587
314 Ga0207656_10702563 3300025321 Bacteria 518
315 Ga0207682_10001150 3300025893 Bacteria 12259
316 Ga0207692_10677555 3300025898 Bacteria 668
317 Ga0207710_10029361 3300025900 Bacteria 2393
318 Ga0207710_10151999 3300025900 Bacteria 1123
319 Ga0207688_10093881 3300025901 Bacteria 1726
320 Ga0207680_10003652 3300025903 Bacteria 7233
321 Ga0207680_11038621 3300025903 Bacteria 586
322 Ga0207647_10001683 3300025904 Bacteria 17030
323 Ga0207647_10023953 3300025904 Bacteria 4031
324 Ga0207647_10092516 3300025904 Bacteria 1803
325 Ga0207647_10517469 3300025904 Bacteria 664
326 Ga0207645_10002195 3300025907 Bacteria 15584
327 Ga0207645_10993268 3300025907 Bacteria 568
328 Ga0207643_10200001 3300025908 Bacteria 1216
329 Ga0207643_10597641 3300025908 Bacteria 710
330 Ga0207705_10845100 3300025909 Bacteria 710
331 Ga0207705_10919818 3300025909 Bacteria 677
332 Ga0207705_11310773 3300025909 Bacteria 553
333 Ga0207705_11401951 3300025909 Bacteria 531
334 Ga0207707_10000002 3300025912 Bacteria 1142054
335 Ga0207695_10010487 3300025913 Bacteria 11334
336 Ga0207693_10946085 3300025915 Bacteria 660
337 Ga0207660_10000269 3300025917 Bacteria 34082
338 Ga0207657_10028736 3300025919 Bacteria 5068
339 Ga0207649_10050602 3300025920 Bacteria 2570
340 Ga0207649_10546716 3300025920 Bacteria 885
341 Ga0207649_10572418 3300025920 Bacteria 866
342 Ga0207649_10693177 3300025920 Bacteria 789
343 Ga0207652_10000174 3300025921 Bacteria 69094
344 Ga0207694_11758669 3300025924 Bacteria 521
345 Ga0207650_10004942 3300025925 Bacteria 9108
346 Ga0207659_10000660 3300025926 Bacteria 20395
347 Ga0207687_10013818 3300025927 Bacteria 5273
348 Ga0207687_10833225 3300025927 Bacteria 788
349 Ga0207664_10274257 3300025929 Bacteria 1478
350 Ga0207644_10000230 3300025931 Bacteria 38307
351 Ga0207644_10011457 3300025931 Bacteria 5868
352 Ga0207644_10127306 3300025931 Bacteria 1945
353 Ga0207690_10102928 3300025932 Bacteria 2043
354 Ga0207706_10000411 3300025933 Bacteria 45884
355 Ga0207686_10108982 3300025934 Bacteria 1864
356 Ga0207686_11384003 3300025934 Bacteria 579
357 Ga0207670_10659930 3300025936 Bacteria 863
358 Ga0207670_10700060 3300025936 Bacteria 839
359 Ga0207669_10030882 3300025937 Bacteria 2984
360 Ga0207669_10384579 3300025937 Bacteria 1094
361 Ga0207669_11762892 3300025937 Bacteria 529
362 Ga0207704_10032281 3300025938 Bacteria 2961
363 Ga0207704_10167186 3300025938 Bacteria 1573
364 Ga0207704_10461732 3300025938 Bacteria 1016
365 Ga0207691_10001753 3300025940 Bacteria 21358
366 Ga0207691_10012591 3300025940 Bacteria 8109
367 Ga0207691_10252954 3300025940 Bacteria 1520
368 Ga0207711_10000107 3300025941 Bacteria 87146
369 Ga0207711_10002164 3300025941 Bacteria 17672
370 Ga0207711_10033835 3300025941 Bacteria 4326
371 Ga0207711_11219179 3300025941 Bacteria 694
372 Ga0207651_10001783 3300025960 Bacteria 9995
373 Ga0207651_10052252 3300025960 Bacteria 2785
374 Ga0207651_10079999 3300025960 Bacteria 2350
375 Ga0207651_11265125 3300025960 Bacteria 663
376 Ga0207712_11001960 3300025961 Bacteria 741
377 Ga0207712_11772201 3300025961 Bacteria 553
378 Ga0207668_10070880 3300025972 Bacteria 2487
379 Ga0207640_10299463 3300025981 Bacteria 1271
380 Ga0207640_11124791 3300025981 Bacteria 696
381 Ga0207658_10031446 3300025986 Bacteria 3769
382 Ga0207658_10047802 3300025986 Bacteria 3133
383 Ga0207658_12137349 3300025986 Bacteria 508
384 Ga0207677_10004992 3300026023 Bacteria 7162
385 Ga0207677_10008220 3300026023 Bacteria 5814
386 Ga0207677_10021663 3300026023 Bacteria 3932
387 Ga0207703_10004399 3300026035 Bacteria 11585
388 Ga0207703_10041032 3300026035 Bacteria 3706
389 Ga0207703_12200841 3300026035 Bacteria 527
390 Ga0207639_11921681 3300026041 Bacteria 553
391 Ga0207678_10141216 3300026067 Bacteria 2055
392 Ga0207678_10261609 3300026067 Bacteria 1483
393 Ga0207678_11368603 3300026067 Bacteria 626
394 Ga0207708_10199069 3300026075 Bacteria 1597
395 Ga0207702_10063649 3300026078 Bacteria 3155
396 Ga0207641_10004516 3300026088 Bacteria 12028
397 Ga0207648_10027513 3300026089 Bacteria 5048
398 Ga0207648_10065123 3300026089 Bacteria 3177
399 Ga0207648_11029895 3300026089 Bacteria 771
400 Ga0207676_10094063 3300026095 Bacteria 2469
401 Ga0207676_10421976 3300026095 Bacteria 1251
402 Ga0207676_12011526 3300026095 Bacteria 576
403 Ga0207676_12025886 3300026095 Bacteria 574
404 Ga0207674_10877294 3300026116 Bacteria 865
405 Ga0207675_100024020 3300026118 Bacteria 5667
406 Ga0207683_10008349 3300026121 Bacteria 8858
407 Ga0207683_10010591 3300026121 Bacteria 7864
408 Ga0207698_10042738 3300026142 Bacteria 3389
409 Ga0207698_10059107 3300026142 Bacteria 2975
410 Ga0207698_10370104 3300026142 Bacteria 1360
411 Ga0209281_1021783 3300027111 Bacteria 1234
412 Ga0209974_10266698 3300027876 Bacteria 648
413 Ga0207428_10139810 3300027907 Bacteria 1849
414 Ga0268266_10016545 3300028379 Bacteria 6305
415 Ga0268266_10525311 3300028379 Bacteria 1132
416 Ga0268266_11023623 3300028379 Bacteria 799
417 Ga0268266_11314845 3300028379 Bacteria 698
418 Ga0268265_10087728 3300028380 Bacteria 2476
419 Ga0268264_10971196 3300028381 Bacteria 855
420 Ga0268264_11120569 3300028381 Bacteria 796
421 Ga0265334_10003972 3300028573 Bacteria 6647
422 Ga0265338_10000011 3300028800 Bacteria 433370
423 Ga0265332_10157492 3300031238 Bacteria 949
424 Ga0265328_10001954 3300031239 Bacteria 9370
425 Ga0265328_10121975 3300031239 Bacteria 972
426 Ga0265325_10000009 3300031241 Bacteria 184273
427 Ga0265329_10009275 3300031242 Bacteria 3682
428 Ga0265339_10000320 3300031249 Bacteria 38805
429 Ga0265331_10000009 3300031250 Bacteria 314950
430 Ga0265331_10006579 3300031250 Bacteria 6847
431 Ga0265316_10235119 3300031344 Bacteria 1348
432 Ga0307513_10000014 3300031456 Bacteria 303157
433 Ga0265313_10017613 3300031595 Bacteria 4048
434 Ga0265314_10015560 3300031711 Bacteria 6033
435 Ga0265314_10068363 3300031711 Bacteria 2388
436 Ga0265342_10043741 3300031712 Bacteria 2702
437 Ga0307405_10107421 3300031731 Bacteria 1884
438 Ga0307410_11390335 3300031852 Bacteria 616
439 Ga0307406_11110239 3300031901 Bacteria 683
440 Ga0307412_10259764 3300031911 Bacteria 1353
441 Ga0307409_100561458 3300031995 Bacteria 1122
442 Ga0307409_101057136 3300031995 Bacteria 832
443 Ga0307414_10004112 3300032004 Bacteria 7858
444 Ga0307414_10754459 3300032004 Bacteria 884
445 Ga0307415_100524567 3300032126 Bacteria 1040
446 Ga0373960_0123907 3300035121 Bacteria 860
447 Ga0373943_0020237 3300035170 Bacteria 3066
448 Ga0373946_0320038 3300035171 Bacteria 770
449 Ga0373961_0177790 3300035241 Bacteria 740
450 Ga0373931_0148761 3300035691 Bacteria 1363
451 Ga0373935_0091061 3300035692 Bacteria 1997
452 Ga0373935_1245088 3300035692 Bacteria 555
453 Ga0373947_0223874 3300035725 Bacteria 1237
454 Ga0373937_0278179 3300036401 Bacteria 1580
455 Ga0373937_1344780 3300036401 Bacteria 662
456 Ga0395900_0759295 3300037418 Bacteria 900
457 Ga0395905_0000533 3300037471 Bacteria 52133
458 Ga0395905_1043357 3300037471 Bacteria 721
459 Ga0400489_22869 3300039093 Bacteria 5863
460 Ga0436365_0257402 3300039437 Bacteria 164674
461 Ga0451787_156676 3300041441 Bacteria 904
462 Ga0451789_0070028 3300041443 Bacteria 545
463 Ga0451791_0699446 3300041451 Bacteria 2124
464 Ga0451797_0815129 3300041453 Unclassified 515
465 Ga0451800_0019961 3300041459 Bacteria 1086
466 Ga0451802_0720684 3300041460 Bacteria 732
467 Ga0451802_1357694 3300041460 Bacteria 530
468 Ga0451807_0059270 3300041486 Bacteria 1306
469 Ga0451849_0779932 3300041505 Bacteria 897
470 Ga0439449_0157779 3300042007 Bacteria 847
471 Ga0450917_030607 3300042120 Bacteria 514
472 Ga0466961_0332552 3300044693 Bacteria 926
473 Ga0466963_0889100 3300044694 Bacteria 628
474 Ga0466967_0408933 3300045976 Bacteria 1321
475 Ga0466967_1812719 3300045976 Bacteria 607
476 Ga0495592_0195183 3300046454 Bacteria 1370
477 Ga0495592_0832777 3300046454 Bacteria 546
478 Ga0495651_0222564 3300046462 Bacteria 1305
479 Ga0495664_0121634 3300046477 Bacteria 1579
480 Ga0495607_0000003 3300046501 Bacteria 366900
481 Ga0495606_0215568 3300046507 Bacteria 1085
482 Ga0495628_0236024 3300046516 Bacteria 1369
483 Ga0495632_0390732 3300046519 Bacteria 608
484 Ga0495643_0000019 3300046522 Bacteria 303627
485 Ga0495663_0221647 3300046525 Bacteria 665
486 Ga0495652_0015889 3300046529 Bacteria 6738
487 Ga0495654_0288107 3300046530 Bacteria 674
488 Ga0495587_0060621 3300046536 Bacteria 2218
489 Ga0495597_0012259 3300046542 Bacteria 4138
490 Ga0495645_0436365 3300046543 Bacteria 828
491 Ga0495645_0463813 3300046543 Bacteria 797
492 Ga0495668_0038259 3300046616 Bacteria 2681
493 Ga0495669_0004896 3300046684 Bacteria 5557
494 Ga0495669_0302960 3300046684 Bacteria 770
495 Ga0495670_0786185 3300046691 Bacteria 519
496 Ga0495649_0466522 3300046694 Bacteria 630
497 Ga0495674_0484338 3300047319 Bacteria 991
498 Ga0495675_0019940 3300047444 Bacteria 4260
499 Ga0495686_0503579 3300047472 Bacteria 637
500 Ga0496100_0001736 3300048903 Bacteria 10866
501 Ga0496100_0722481 3300048903 Bacteria 778
502 Ga0496101_0000533 3300048904 Bacteria 23349
503 Ga0496104_0387831 3300048907 Bacteria 1309
504 Ga0496105_0022052 3300048908 Bacteria 5156
505 Ga0496105_0198280 3300048908 Bacteria 1639
506 Ga0496106_0331918 3300048909 Bacteria 1221
507 Ga0496107_0032591 3300048910 Bacteria 3724
508 Ga0496108_0001094 3300048911 Bacteria 21158
509 Ga0496109_0188515 3300048912 Bacteria 1937
510 Ga0496110_0000347 3300048913 Bacteria 30884
511 Ga0496111_0005235 3300048914 Bacteria 8269
512 Ga0496112_0001900 3300048915 Bacteria 16480
513 Ga0496112_0152910 3300048915 Bacteria 2275
514 Ga0496113_0028066 3300048916 Bacteria 4044
515 Ga0496114_0431851 3300048917 Bacteria 1167
516 Ga0496115_0000160 3300048918 Bacteria 63326
517 Ga0496116_0202881 3300048919 Bacteria 1036
518 Ga0496118_0009856 3300048921 Bacteria 9557
519 Ga0496121_0000264 3300048924 Bacteria 109400
520 Ga0496121_0464999 3300048924 Bacteria 812
521 Ga0496122_0231167 3300048925 Bacteria 1051
522 Ga0496122_0428377 3300048925 Bacteria 663
523 Ga0496123_0135608 3300048926 Bacteria 1355
524 Ga0495678_002606 3300049459 Bacteria 12046
525 Ga0495682_0004548 3300049460 Bacteria 5913
526 Ga0501031_0065927 3300049568 Bacteria 2359
527 Ga0501032_0038574 3300049569 Bacteria 3253
528 Ga0501032_0129277 3300049569 Bacteria 1667
529 Ga0501033_0016352 3300049570 Bacteria 5619
530 Ga0501033_0409555 3300049570 Bacteria 945
531 Ga0501033_1062164 3300049570 Bacteria 539
532 Ga0501034_0014058 3300049571 Bacteria 8245
533 Ga0501034_0110055 3300049571 Bacteria 2746
534 Ga0501034_0209071 3300049571 Bacteria 1907
535 Ga0501036_0032137 3300049572 Bacteria 4434
536 Ga0501036_0393615 3300049572 Bacteria 1156
537 Ga0501037_0028519 3300049573 Bacteria 4124
538 Ga0501037_0241394 3300049573 Bacteria 1266
539 Ga0501037_0666604 3300049573 Bacteria 694
540 Ga0501038_0025985 3300049574 Bacteria 5215
541 Ga0501038_0195279 3300049574 Bacteria 1627
542 Ga0501038_0673168 3300049574 Bacteria 777
543 Ga0501043_0001152 3300049579 Bacteria 23229
544 Ga0501043_0319168 3300049579 Bacteria 1185
545 Ga0501043_0620947 3300049579 Bacteria 797
546 Ga0501043_0635754 3300049579 Bacteria 785
547 Ga0501043_0687863 3300049579 Bacteria 748
548 Ga0501043_1049281 3300049579 Bacteria 578
549 Ga0501046_1161973 3300049580 Bacteria 531
550 Ga0501046_1169914 3300049580 Bacteria 529
551 Ga0501047_0061669 3300049581 Bacteria 3618
552 Ga0501047_0228600 3300049581 Bacteria 1714
553 Ga0501047_0328117 3300049581 Bacteria 1369
554 Ga0501048_1015270 3300049582 Bacteria 597
555 Ga0501048_1093730 3300049582 Bacteria 573
556 Ga0501067_0003061 3300049583 Bacteria 9231
557 Ga0501068_0214390 3300049584 Bacteria 1223
558 Ga0501068_0560218 3300049584 Bacteria 743
559 Ga0501068_0608482 3300049584 Bacteria 712
560 Ga0501069_0213405 3300049585 Bacteria 1120
561 Ga0501069_0702256 3300049585 Bacteria 610
562 Ga0501070_0000111 3300049586 Bacteria 71786
563 Ga0501070_0010329 3300049586 Bacteria 7892
564 Ga0501070_0214898 3300049586 Unclassified 1578
565 Ga0501070_0464683 3300049586 Bacteria 1019
566 Ga0501071_0453125 3300049587 Bacteria 982
567 Ga0501073_0007633 3300049589 Bacteria 8029
568 Ga0501073_0044784 3300049589 Bacteria 3119
569 Ga0501073_0260859 3300049589 Bacteria 1196
570 Ga0501074_0027325 3300049590 Bacteria 4137
571 Ga0501079_0008250 3300049741 Bacteria 7895
572 Ga0501079_0259984 3300049741 Bacteria 1357
573 Ga0501080_0009306 3300049742 Bacteria 8959
574 Ga0501080_0041350 3300049742 Bacteria 4296
575 Ga0501080_0116662 3300049742 Bacteria 2474
576 Ga0501083_0033850 3300049744 Bacteria 3497
577 Ga0501035_0000847 3300049822 Bacteria 32697
578 Ga0501035_0021076 3300049822 Bacteria 5992
579 Ga0501035_0824393 3300049822 Bacteria 740
580 Ga0501044_0001302 3300049823 Bacteria 29482
581 Ga0501044_0015687 3300049823 Bacteria 8157
582 Ga0501044_0035376 3300049823 Bacteria 5230
583 Ga0501044_0199740 3300049823 Bacteria 1958
584 Ga0501045_1429965 3300049824 Bacteria 502
585 nmdc:mga03n38_292748_c1 3300050490 Bacteria 872
586 nmdc:mga0qj67_1400586_c1 3300050509 Bacteria 540
587 nmdc:mga08y16_125312_c1 3300050511 Bacteria 2672
588 Ga0495655_0001722 3300053083 Bacteria 3388
589 Ga0500578_0000082 3300053086 Bacteria 105580
590 Ga0500644_0004238 3300053088 Bacteria 3583
591 Ga0500647_0072947 3300053091 Bacteria 1648
592 Ga0500651_0001739 3300053093 Bacteria 11140
593 Ga0500593_000922 3300053117 Bacteria 10921
594 Ga0500594_0000274 3300053118 Bacteria 11997
595 Ga0500628_001023 3300053129 Bacteria 4878
596 Ga0500655_001429 3300053133 Bacteria 4535
597 Ga0500655_003504 3300053133 Bacteria 2833
598 Ga0500568_0001614 3300053139 Bacteria 14262
599 Ga0500588_0433279 3300053146 Bacteria 501
600 Ga0500604_0000014 3300053151 Bacteria 92128
601 Ga0500604_0034442 3300053151 Bacteria 1502
602 Ga0500616_0000591 3300053153 Bacteria 44073
603 Ga0500616_0059453 3300053153 Bacteria 1985
604 Ga0500619_091121 3300053154 Bacteria 1030
605 Ga0500636_0434683 3300053177 Bacteria 598
606 Ga0500645_000100 3300053730 Bacteria 68299
607 Ga0500587_031846 3300053739 Bacteria 727
608 Ga0501084_0011686 3300054114 Bacteria 7267
609 Ga0501084_0977018 3300054114 Bacteria 712
610 Ga0500661_019605 3300055283 Bacteria 1204
611 Ga0501082_0073983 3300060353 Bacteria 2934
612 Ga0501082_0593864 3300060353 Bacteria 969

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_11368603 Ga0207678_113686031 59
2 3300048903 Ga0496100_0722481 Ga0496100_0722481_551_760 60
3 iso_pu_bacteria 2891088606 2891092161 61
4 iso_pu_bacteria 2593339239 2595452963 65
5 iso_pu_bacteria 2818991440 2819564707 65
6 iso_pu_bacteria 2904463128 2904465776 65
7 3300005327 Ga0070658_11660308 Ga0070658_116603081 66
8 3300013307 Ga0157372_10003710 Ga0157372_100037107 66
9 3300025909 Ga0207705_10845100 Ga0207705_108451001 66
10 3300025909 Ga0207705_11310773 Ga0207705_113107732 66
11 3300049459 Ga0495678_002606 Ga0495678_002606_3746_3958 67
12 3300049571 Ga0501034_0209071 Ga0501034_0209071_1493_1702 67
13 3300053086 Ga0500578_0000082 Ga0500578_0000082_98090_98302 67
14 3300053118 Ga0500594_0000274 Ga0500594_0000274_7034_7246 67
15 3300003320 rootH2_10024667 rootH2_100246673 68
16 3300003322 rootL2_10317629 rootL2_103176293 68
17 3300005327 Ga0070658_10009558 Ga0070658_100095585 68
18 3300005336 Ga0070680_100000181 Ga0070680_10000018132 68
19 3300005344 Ga0070661_100300626 Ga0070661_1003006262 68
20 3300005439 Ga0070711_101340254 Ga0070711_1013402541 68
21 3300005458 Ga0070681_10000002 Ga0070681_10000002670 68
22 3300005530 Ga0070679_100000380 Ga0070679_1000003807 68
23 3300005539 Ga0068853_101038618 Ga0068853_1010386181 68
24 3300005616 Ga0068852_100429648 Ga0068852_1004296483 68
25 3300006237 Ga0097621_100907902 Ga0097621_1009079022 68
26 3300006358 Ga0068871_100264647 Ga0068871_1002646472 68
27 3300009093 Ga0105240_10013261 Ga0105240_100132616 68
28 3300009101 Ga0105247_10028393 Ga0105247_100283935 68
29 3300009174 Ga0105241_10146923 Ga0105241_101469233 68
30 3300009174 Ga0105241_10341645 Ga0105241_103416452 68
31 3300009551 Ga0105238_12483631 Ga0105238_124836311 68
32 3300009553 Ga0105249_10104517 Ga0105249_101045174 68
33 3300010375 Ga0105239_10010608 Ga0105239_1001060812 68
34 3300010375 Ga0105239_12943177 Ga0105239_129431772 68
35 3300013105 Ga0157369_10016105 Ga0157369_1001610513 68
36 3300013105 Ga0157369_10137263 Ga0157369_101372634 68
37 3300013297 Ga0157378_10204983 Ga0157378_102049835 68
38 3300013297 Ga0157378_10486333 Ga0157378_104863333 68
39 3300013307 Ga0157372_11699718 Ga0157372_116997182 68
40 3300021384 Ga0213876_10001074 Ga0213876_100010744 68
41 3300021384 Ga0213876_10520470 Ga0213876_105204702 68
42 3300025898 Ga0207692_10677555 Ga0207692_106775552 68
43 3300025900 Ga0207710_10029361 Ga0207710_100293614 68
44 3300025912 Ga0207707_10000002 Ga0207707_10000002288 68
45 3300025913 Ga0207695_10010487 Ga0207695_100104876 68
46 3300025915 Ga0207693_10946085 Ga0207693_109460852 68
47 3300025917 Ga0207660_10000269 Ga0207660_1000026932 68
48 3300025920 Ga0207649_10546716 Ga0207649_105467162 68
49 3300025920 Ga0207649_10693177 Ga0207649_106931772 68
50 3300025921 Ga0207652_10000174 Ga0207652_1000017444 68
51 3300025934 Ga0207686_11384003 Ga0207686_113840031 68
52 3300025961 Ga0207712_11001960 Ga0207712_110019602 68
53 3300026142 Ga0207698_10370104 Ga0207698_103701042 68
54 3300028573 Ga0265334_10003972 Ga0265334_100039725 68
55 3300028800 Ga0265338_10000011 Ga0265338_10000011267 68
56 3300031238 Ga0265332_10157492 Ga0265332_101574922 68
57 3300031239 Ga0265328_10121975 Ga0265328_101219752 68
58 3300031241 Ga0265325_10000009 Ga0265325_10000009146 68
59 3300031242 Ga0265329_10009275 Ga0265329_100092753 68
60 3300031249 Ga0265339_10000320 Ga0265339_1000032010 68
61 3300031250 Ga0265331_10000009 Ga0265331_10000009291 68
62 3300031250 Ga0265331_10006579 Ga0265331_100065796 68
63 3300031344 Ga0265316_10235119 Ga0265316_102351192 68
64 3300031595 Ga0265313_10017613 Ga0265313_100176136 68
65 3300031711 Ga0265314_10015560 Ga0265314_100155604 68
66 3300031711 Ga0265314_10068363 Ga0265314_100683634 68
67 3300031712 Ga0265342_10043741 Ga0265342_100437414 68
68 3300031995 Ga0307409_100561458 Ga0307409_1005614582 68
69 3300032004 Ga0307414_10004112 Ga0307414_100041125 68
70 3300036401 Ga0373937_0278179 Ga0373937_0278179_265_474 68
71 3300036401 Ga0373937_1344780 Ga0373937_1344780_182_391 68
72 3300039437 Ga0436365_0257402 Ga0436365_0257402_161805_162014 68
73 3300041453 Ga0451797_0815129 Ga0451797_0815129_55_264 68
74 3300041460 Ga0451802_1357694 Ga0451802_1357694_50_259 68
75 3300046454 Ga0495592_0195183 Ga0495592_0195183_214_423 68
76 3300046454 Ga0495592_0832777 Ga0495592_0832777_55_264 68
77 3300046462 Ga0495651_0222564 Ga0495651_0222564_1077_1286 68
78 3300046477 Ga0495664_0121634 Ga0495664_0121634_806_1015 68
79 3300046516 Ga0495628_0236024 Ga0495628_0236024_1090_1299 68
80 3300046522 Ga0495643_0000019 Ga0495643_0000019_202125_202337 68
81 3300046529 Ga0495652_0015889 Ga0495652_0015889_1272_1481 68
82 3300046536 Ga0495587_0060621 Ga0495587_0060621_868_1077 68
83 3300046543 Ga0495645_0436365 Ga0495645_0436365_500_709 68
84 3300046543 Ga0495645_0463813 Ga0495645_0463813_170_379 68
85 3300046694 Ga0495649_0466522 Ga0495649_0466522_126_356 68
86 3300047319 Ga0495674_0484338 Ga0495674_0484338_626_835 68
87 3300047444 Ga0495675_0019940 Ga0495675_0019940_2967_3176 68
88 3300049460 Ga0495682_0004548 Ga0495682_0004548_3603_3812 68
89 3300049568 Ga0501031_0065927 Ga0501031_0065927_316_525 68
90 3300049569 Ga0501032_0038574 Ga0501032_0038574_1851_2060 68
91 3300049569 Ga0501032_0129277 Ga0501032_0129277_1145_1354 68
92 3300049570 Ga0501033_0016352 Ga0501033_0016352_154_363 68
93 3300049570 Ga0501033_0409555 Ga0501033_0409555_447_656 68
94 3300049570 Ga0501033_1062164 Ga0501033_1062164_102_311 68
95 3300049571 Ga0501034_0014058 Ga0501034_0014058_6808_7017 68
96 3300049571 Ga0501034_0110055 Ga0501034_0110055_193_402 68
97 3300049572 Ga0501036_0032137 Ga0501036_0032137_963_1172 68
98 3300049572 Ga0501036_0393615 Ga0501036_0393615_736_945 68
99 3300049573 Ga0501037_0028519 Ga0501037_0028519_2729_2938 68
100 3300049573 Ga0501037_0241394 Ga0501037_0241394_501_710 68
101 3300049573 Ga0501037_0666604 Ga0501037_0666604_81_290 68
102 3300049574 Ga0501038_0025985 Ga0501038_0025985_1042_1251 68
103 3300049574 Ga0501038_0195279 Ga0501038_0195279_22_231 68
104 3300049574 Ga0501038_0673168 Ga0501038_0673168_232_441 68
105 3300049579 Ga0501043_0319168 Ga0501043_0319168_139_348 68
106 3300049579 Ga0501043_0620947 Ga0501043_0620947_395_604 68
107 3300049579 Ga0501043_0635754 Ga0501043_0635754_208_417 68
108 3300049579 Ga0501043_0687863 Ga0501043_0687863_264_473 68
109 3300049579 Ga0501043_1049281 Ga0501043_1049281_334_543 68
110 3300049580 Ga0501046_1161973 Ga0501046_1161973_161_370 68
111 3300049580 Ga0501046_1169914 Ga0501046_1169914_267_476 68
112 3300049581 Ga0501047_0061669 Ga0501047_0061669_2476_2685 68
113 3300049581 Ga0501047_0228600 Ga0501047_0228600_84_293 68
114 3300049581 Ga0501047_0328117 Ga0501047_0328117_390_599 68
115 3300049582 Ga0501048_1093730 Ga0501048_1093730_28_237 68
116 3300049583 Ga0501067_0003061 Ga0501067_0003061_5532_5741 68
117 3300049584 Ga0501068_0214390 Ga0501068_0214390_813_1022 68
118 3300049584 Ga0501068_0560218 Ga0501068_0560218_306_515 68
119 3300049584 Ga0501068_0608482 Ga0501068_0608482_158_367 68
120 3300049585 Ga0501069_0213405 Ga0501069_0213405_379_588 68
121 3300049586 Ga0501070_0000111 Ga0501070_0000111_34219_34428 68
122 3300049586 Ga0501070_0010329 Ga0501070_0010329_6096_6305 68
123 3300049586 Ga0501070_0214898 Ga0501070_0214898_642_851 68
124 3300049586 Ga0501070_0464683 Ga0501070_0464683_538_747 68
125 3300049587 Ga0501071_0453125 Ga0501071_0453125_581_790 68
126 3300049589 Ga0501073_0007633 Ga0501073_0007633_468_677 68
127 3300049589 Ga0501073_0044784 Ga0501073_0044784_2860_3069 68
128 3300049590 Ga0501074_0027325 Ga0501074_0027325_2161_2370 68
129 3300049741 Ga0501079_0008250 Ga0501079_0008250_7327_7536 68
130 3300049741 Ga0501079_0259984 Ga0501079_0259984_606_815 68
131 3300049742 Ga0501080_0009306 Ga0501080_0009306_5324_5533 68
132 3300049742 Ga0501080_0041350 Ga0501080_0041350_2169_2378 68
133 3300049742 Ga0501080_0116662 Ga0501080_0116662_233_442 68
134 3300049744 Ga0501083_0033850 Ga0501083_0033850_625_834 68
135 3300049822 Ga0501035_0000847 Ga0501035_0000847_32307_32516 68
136 3300049822 Ga0501035_0021076 Ga0501035_0021076_1274_1483 68
137 3300049822 Ga0501035_0824393 Ga0501035_0824393_151_363 68
138 3300049823 Ga0501044_0001302 Ga0501044_0001302_13330_13539 68
139 3300049823 Ga0501044_0015687 Ga0501044_0015687_6396_6605 68
140 3300049823 Ga0501044_0035376 Ga0501044_0035376_4694_4903 68
141 3300049823 Ga0501044_0199740 Ga0501044_0199740_1032_1241 68
142 3300049824 Ga0501045_1429965 Ga0501045_1429965_51_260 68
143 3300053133 Ga0500655_001429 Ga0500655_001429_4278_4487 68
144 3300053133 Ga0500655_003504 Ga0500655_003504_1097_1306 68
145 3300053139 Ga0500568_0001614 Ga0500568_0001614_6225_6434 68
146 3300053151 Ga0500604_0000014 Ga0500604_0000014_87172_87381 68
147 3300053153 Ga0500616_0000591 Ga0500616_0000591_7833_8042 68
148 3300053153 Ga0500616_0059453 Ga0500616_0059453_610_822 68
149 3300053154 Ga0500619_091121 Ga0500619_091121_188_397 68
150 3300053739 Ga0500587_031846 Ga0500587_031846_316_525 68
151 3300054114 Ga0501084_0011686 Ga0501084_0011686_5906_6115 68
152 3300054114 Ga0501084_0977018 Ga0501084_0977018_416_625 68
153 3300060353 Ga0501082_0073983 Ga0501082_0073983_1324_1533 68
154 3300060353 Ga0501082_0593864 Ga0501082_0593864_617_826 68
155 3300001977 JGI24746J21847_1023735 JGI24746J21847_10237352 69
156 3300001990 JGI24737J22298_10168045 JGI24737J22298_101680452 69
157 3300002067 JGI24735J21928_10003438 JGI24735J21928_100034383 69
158 3300002076 JGI24749J21850_1013240 JGI24749J21850_10132401 69
159 3300002155 JGI24033J26618_1038417 JGI24033J26618_10384171 69
160 3300002244 JGI24742J22300_10026940 JGI24742J22300_100269402 69
161 3300002704 JGI25155J39150_1000002 JGI25155J39150_1000002179 69
162 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003127 69
163 3300002738 JGI25154J39366_1000009 JGI25154J39366_1000009179 69
164 3300002741 JGI25157J39369_1000002 JGI25157J39369_1000002179 69
165 3300002774 JGI25150J39212_1008736 JGI25150J39212_10087363 69
166 3300002774 JGI25150J39212_1008811 JGI25150J39212_10088112 69
167 3300002987 JGI25159J45721_1008813 JGI25159J45721_10088133 69
168 3300003187 JGI25151J46595_10130458 JGI25151J46595_101304581 69
169 3300003187 JGI25151J46595_10168592 JGI25151J46595_101685922 69
170 3300003354 JGI25160J50197_1084271 JGI25160J50197_10842712 69
171 3300003771 Ga0055526_1005186 Ga0055526_10051862 69
172 3300003773 Ga0055537_1000246 Ga0055537_10002468 69
173 3300003773 Ga0055537_1024471 Ga0055537_10244712 69
174 3300003775 Ga0055524_1000083 Ga0055524_100008387 69
175 3300003775 Ga0055524_1009557 Ga0055524_10095571 69
176 3300003775 Ga0055524_1014274 Ga0055524_10142742 69
177 3300003775 Ga0055524_1076396 Ga0055524_10763961 69
178 3300003781 Ga0055536_1000594 Ga0055536_10005945 69
179 3300003781 Ga0055536_1000644 Ga0055536_10006443 69
180 3300003781 Ga0055536_1013314 Ga0055536_10133143 69
181 3300003781 Ga0055536_1022606 Ga0055536_10226063 69
182 3300003781 Ga0055536_1038392 Ga0055536_10383922 69
183 3300003781 Ga0055536_1040232 Ga0055536_10402322 69
184 3300003781 Ga0055536_1068568 Ga0055536_10685681 69
185 3300003781 Ga0055536_1089267 Ga0055536_10892672 69
186 3300003784 Ga0055534_1004416 Ga0055534_10044164 69
187 3300003784 Ga0055534_1038777 Ga0055534_10387772 69
188 3300003784 Ga0055534_1042630 Ga0055534_10426302 69
189 3300003790 Ga0055528_1000450 Ga0055528_100045014 69
190 3300003790 Ga0055528_1071910 Ga0055528_10719101 69
191 3300003791 Ga0055530_10000327 Ga0055530_1000032712 69
192 3300003791 Ga0055530_10001376 Ga0055530_1000137612 69
193 3300003791 Ga0055530_10053047 Ga0055530_100530472 69
194 3300003792 Ga0055540_1000012 Ga0055540_100001286 69
195 3300003794 Ga0055531_10002179 Ga0055531_100021799 69
196 3300003794 Ga0055531_10003025 Ga0055531_1000302511 69
197 3300003794 Ga0055531_10012688 Ga0055531_100126884 69
198 3300003794 Ga0055531_10013728 Ga0055531_100137283 69
199 3300003794 Ga0055531_10020404 Ga0055531_100204044 69
200 3300003794 Ga0055531_10031558 Ga0055531_100315583 69
201 3300005262 Ga0065165_1034884 Ga0065165_10348842 69
202 3300005293 Ga0065715_10443413 Ga0065715_104434132 69
203 3300005327 Ga0070658_10128975 Ga0070658_101289753 69
204 3300005328 Ga0070676_10001015 Ga0070676_100010155 69
205 3300005328 Ga0070676_10117667 Ga0070676_101176671 69
206 3300005331 Ga0070670_100134113 Ga0070670_1001341133 69
207 3300005333 Ga0070677_10008616 Ga0070677_100086165 69
208 3300005334 Ga0068869_100378176 Ga0068869_1003781762 69
209 3300005335 Ga0070666_10002718 Ga0070666_100027185 69
210 3300005335 Ga0070666_10169887 Ga0070666_101698873 69
211 3300005335 Ga0070666_10232044 Ga0070666_102320442 69
212 3300005338 Ga0068868_100005168 Ga0068868_1000051687 69
213 3300005339 Ga0070660_100490847 Ga0070660_1004908472 69
214 3300005340 Ga0070689_100069990 Ga0070689_1000699902 69
215 3300005340 Ga0070689_100794555 Ga0070689_1007945551 69
216 3300005344 Ga0070661_101028592 Ga0070661_1010285922 69
217 3300005347 Ga0070668_100237887 Ga0070668_1002378874 69
218 3300005347 Ga0070668_101005291 Ga0070668_1010052912 69
219 3300005353 Ga0070669_100821909 Ga0070669_1008219093 69
220 3300005354 Ga0070675_100006519 Ga0070675_1000065197 69
221 3300005355 Ga0070671_100007811 Ga0070671_1000078115 69
222 3300005355 Ga0070671_100014488 Ga0070671_1000144888 69
223 3300005355 Ga0070671_101307973 Ga0070671_1013079732 69
224 3300005356 Ga0070674_100008788 Ga0070674_1000087883 69
225 3300005356 Ga0070674_100023865 Ga0070674_1000238655 69
226 3300005364 Ga0070673_100038519 Ga0070673_1000385195 69
227 3300005364 Ga0070673_100109206 Ga0070673_1001092063 69
228 3300005364 Ga0070673_100445195 Ga0070673_1004451954 69
229 3300005365 Ga0070688_100058498 Ga0070688_1000584982 69
230 3300005365 Ga0070688_101412625 Ga0070688_1014126251 69
231 3300005366 Ga0070659_100131600 Ga0070659_1001316003 69
232 3300005366 Ga0070659_100931021 Ga0070659_1009310212 69
233 3300005367 Ga0070667_100006170 Ga0070667_1000061704 69
234 3300005367 Ga0070667_100145304 Ga0070667_1001453042 69
235 3300005367 Ga0070667_100307874 Ga0070667_1003078744 69
236 3300005440 Ga0070705_100936510 Ga0070705_1009365102 69
237 3300005441 Ga0070700_100189177 Ga0070700_1001891773 69
238 3300005455 Ga0070663_100805750 Ga0070663_1008057501 69
239 3300005456 Ga0070678_100008844 Ga0070678_1000088447 69
240 3300005457 Ga0070662_100002657 Ga0070662_10000265714 69
241 3300005457 Ga0070662_100172243 Ga0070662_1001722433 69
242 3300005466 Ga0070685_10109208 Ga0070685_101092082 69
243 3300005530 Ga0070679_100090724 Ga0070679_1000907243 69
244 3300005543 Ga0070672_100011211 Ga0070672_1000112117 69
245 3300005544 Ga0070686_100015980 Ga0070686_1000159802 69
246 3300005544 Ga0070686_101761810 Ga0070686_1017618102 69
247 3300005548 Ga0070665_100024410 Ga0070665_1000244105 69
248 3300005548 Ga0070665_100218678 Ga0070665_1002186782 69
249 3300005548 Ga0070665_100856041 Ga0070665_1008560412 69
250 3300005549 Ga0070704_102251289 Ga0070704_1022512891 69
251 3300005564 Ga0070664_100266267 Ga0070664_1002662673 69
252 3300005577 Ga0068857_100629203 Ga0068857_1006292031 69
253 3300005577 Ga0068857_100871183 Ga0068857_1008711832 69
254 3300005578 Ga0068854_100321731 Ga0068854_1003217312 69
255 3300005578 Ga0068854_101392731 Ga0068854_1013927312 69
256 3300005616 Ga0068852_101142323 Ga0068852_1011423231 69
257 3300005617 Ga0068859_100056929 Ga0068859_1000569297 69
258 3300005617 Ga0068859_100070884 Ga0068859_1000708845 69
259 3300005618 Ga0068864_102077594 Ga0068864_1020775942 69
260 3300005719 Ga0068861_100053995 Ga0068861_1000539953 69
261 3300005840 Ga0068870_10740182 Ga0068870_107401822 69
262 3300005841 Ga0068863_100070531 Ga0068863_1000705313 69
263 3300005842 Ga0068858_100006240 Ga0068858_10000624012 69
264 3300005843 Ga0068860_100050321 Ga0068860_1000503212 69
265 3300005843 Ga0068860_101282879 Ga0068860_1012828791 69
266 3300005844 Ga0068862_100027088 Ga0068862_1000270886 69
267 3300006195 Ga0075366_10377004 Ga0075366_103770042 69
268 3300006846 Ga0075430_101572543 Ga0075430_1015725432 69
269 3300006881 Ga0068865_100037434 Ga0068865_1000374343 69
270 3300006881 Ga0068865_100469335 Ga0068865_1004693351 69
271 3300006881 Ga0068865_100875948 Ga0068865_1008759482 69
272 3300006914 Ga0075436_101320120 Ga0075436_1013201201 69
273 3300006931 Ga0097620_100051392 Ga0097620_1000513926 69
274 3300006931 Ga0097620_100056929 Ga0097620_1000569297 69
275 3300006931 Ga0097620_100070885 Ga0097620_1000708855 69
276 3300006946 Ga0079104_1022531 Ga0079104_10225314 69
277 3300009094 Ga0111539_10133677 Ga0111539_101336775 69
278 3300009101 Ga0105247_10297317 Ga0105247_102973175 69
279 3300009148 Ga0105243_10504422 Ga0105243_105044223 69
280 3300009174 Ga0105241_12499536 Ga0105241_124995362 69
281 3300009177 Ga0105248_10014744 Ga0105248_100147447 69
282 3300009177 Ga0105248_10324090 Ga0105248_103240903 69
283 3300009177 Ga0105248_10495672 Ga0105248_104956722 69
284 3300009553 Ga0105249_11587069 Ga0105249_115870692 69
285 3300009993 Ga0105028_141959 Ga0105028_1419591 69
286 3300010375 Ga0105239_10864800 Ga0105239_108648003 69
287 3300013105 Ga0157369_10243788 Ga0157369_102437883 69
288 3300013105 Ga0157369_10924728 Ga0157369_109247282 69
289 3300013296 Ga0157374_11962328 Ga0157374_119623282 69
290 3300013297 Ga0157378_10106836 Ga0157378_101068364 69
291 3300013308 Ga0157375_11984894 Ga0157375_119848942 69
292 3300014326 Ga0157380_10024709 Ga0157380_100247095 69
293 3300017792 Ga0163161_10040001 Ga0163161_100400013 69
294 3300025206 Ga0209435_100001 Ga0209435_100001538 69
295 3300025245 Ga0207425_1005712 Ga0207425_10057124 69
296 3300025245 Ga0207425_1007315 Ga0207425_10073153 69
297 3300025245 Ga0207425_1020857 Ga0207425_10208573 69
298 3300025245 Ga0207425_1083092 Ga0207425_10830922 69
299 3300025246 Ga0209646_1000001 Ga0209646_1000001907 69
300 3300025250 Ga0209026_1000003 Ga0209026_1000003538 69
301 3300025256 Ga0209759_1000001 Ga0209759_1000001538 69
302 3300025263 Ga0209565_1000004 Ga0209565_1000004667 69
303 3300025263 Ga0209565_1000512 Ga0209565_10005126 69
304 3300025273 Ga0209673_1000074 Ga0209673_1000074115 69
305 3300025284 Ga0209130_1000303 Ga0209130_100030335 69
306 3300025284 Ga0209130_1003980 Ga0209130_10039802 69
307 3300025284 Ga0209130_1058724 Ga0209130_10587241 69
308 3300025291 Ga0209675_1000044 Ga0209675_100004490 69
309 3300025291 Ga0209675_1002583 Ga0209675_10025833 69
310 3300025291 Ga0209675_1011061 Ga0209675_10110613 69
311 3300025291 Ga0209675_1013155 Ga0209675_10131552 69
312 3300025291 Ga0209675_1059655 Ga0209675_10596552 69
313 3300025291 Ga0209675_1060746 Ga0209675_10607462 69
314 3300025292 Ga0209676_1000029 Ga0209676_1000029234 69
315 3300025292 Ga0209676_1001411 Ga0209676_10014114 69
316 3300025292 Ga0209676_1001529 Ga0209676_10015297 69
317 3300025292 Ga0209676_1002203 Ga0209676_100220315 69
318 3300025292 Ga0209676_1005904 Ga0209676_10059044 69
319 3300025292 Ga0209676_1006092 Ga0209676_10060925 69
320 3300025292 Ga0209676_1007204 Ga0209676_10072046 69
321 3300025292 Ga0209676_1110634 Ga0209676_11106342 69
322 3300025294 Ga0209025_1000562 Ga0209025_100056234 69
323 3300025294 Ga0209025_1005124 Ga0209025_100512412 69
324 3300025294 Ga0209025_1008130 Ga0209025_10081308 69
325 3300025294 Ga0209025_1032273 Ga0209025_10322734 69
326 3300025294 Ga0209025_1046191 Ga0209025_10461912 69
327 3300025294 Ga0209025_1064993 Ga0209025_10649932 69
328 3300025294 Ga0209025_1113131 Ga0209025_11131312 69
329 3300025294 Ga0209025_1143605 Ga0209025_11436052 69
330 3300025294 Ga0209025_1184491 Ga0209025_11844912 69
331 3300025295 Ga0209564_1000824 Ga0209564_100082428 69
332 3300025295 Ga0209564_1006639 Ga0209564_10066394 69
333 3300025295 Ga0209564_1067423 Ga0209564_10674232 69
334 3300025297 Ga0209758_1018098 Ga0209758_10180984 69
335 3300025297 Ga0209758_1067680 Ga0209758_10676802 69
336 3300025297 Ga0209758_1068524 Ga0209758_10685242 69
337 3300025298 Ga0209050_1000003 Ga0209050_1000003296 69
338 3300025298 Ga0209050_1001252 Ga0209050_10012524 69
339 3300025298 Ga0209050_1017396 Ga0209050_10173963 69
340 3300025299 Ga0209256_1000001 Ga0209256_1000001300 69
341 3300025299 Ga0209256_1000457 Ga0209256_100045731 69
342 3300025299 Ga0209256_1001133 Ga0209256_100113319 69
343 3300025299 Ga0209256_1001275 Ga0209256_10012759 69
344 3300025299 Ga0209256_1011883 Ga0209256_10118833 69
345 3300025302 Ga0207426_1001024 Ga0207426_100102424 69
346 3300025302 Ga0207426_1041745 Ga0207426_10417452 69
347 3300025303 Ga0209051_1000003 Ga0209051_1000003296 69
348 3300025303 Ga0209051_1019015 Ga0209051_10190153 69
349 3300025304 Ga0209257_1000018 Ga0209257_1000018296 69
350 3300025304 Ga0209257_1000065 Ga0209257_1000065298 69
351 3300025304 Ga0209257_1000529 Ga0209257_100052923 69
352 3300025304 Ga0209257_1000867 Ga0209257_100086733 69
353 3300025304 Ga0209257_1002673 Ga0209257_10026733 69
354 3300025304 Ga0209257_1003712 Ga0209257_10037124 69
355 3300025304 Ga0209257_1025478 Ga0209257_10254783 69
356 3300025315 Ga0207697_10045533 Ga0207697_100455332 69
357 3300025893 Ga0207682_10001150 Ga0207682_1000115013 69
358 3300025900 Ga0207710_10151999 Ga0207710_101519992 69
359 3300025901 Ga0207688_10093881 Ga0207688_100938812 69
360 3300025903 Ga0207680_10003652 Ga0207680_100036526 69
361 3300025903 Ga0207680_11038621 Ga0207680_110386212 69
362 3300025904 Ga0207647_10023953 Ga0207647_100239533 69
363 3300025904 Ga0207647_10517469 Ga0207647_105174692 69
364 3300025907 Ga0207645_10002195 Ga0207645_1000219516 69
365 3300025908 Ga0207643_10597641 Ga0207643_105976412 69
366 3300025925 Ga0207650_10004942 Ga0207650_100049428 69
367 3300025926 Ga0207659_10000660 Ga0207659_1000066014 69
368 3300025931 Ga0207644_10011457 Ga0207644_100114574 69
369 3300025931 Ga0207644_10127306 Ga0207644_101273065 69
370 3300025932 Ga0207690_10102928 Ga0207690_101029283 69
371 3300025933 Ga0207706_10000411 Ga0207706_100004112 69
372 3300025936 Ga0207670_10659930 Ga0207670_106599302 69
373 3300025936 Ga0207670_10700060 Ga0207670_107000603 69
374 3300025937 Ga0207669_10030882 Ga0207669_100308824 69
375 3300025937 Ga0207669_10384579 Ga0207669_103845793 69
376 3300025938 Ga0207704_10167186 Ga0207704_101671862 69
377 3300025938 Ga0207704_10461732 Ga0207704_104617323 69
378 3300025940 Ga0207691_10001753 Ga0207691_1000175319 69
379 3300025940 Ga0207691_10252954 Ga0207691_102529543 69
380 3300025941 Ga0207711_10000107 Ga0207711_1000010764 69
381 3300025941 Ga0207711_11219179 Ga0207711_112191792 69
382 3300025960 Ga0207651_10052252 Ga0207651_100522522 69
383 3300025960 Ga0207651_10079999 Ga0207651_100799993 69
384 3300025960 Ga0207651_11265125 Ga0207651_112651252 69
385 3300025961 Ga0207712_11772201 Ga0207712_117722012 69
386 3300025972 Ga0207668_10070880 Ga0207668_100708805 69
387 3300025981 Ga0207640_11124791 Ga0207640_111247912 69
388 3300025986 Ga0207658_10031446 Ga0207658_100314465 69
389 3300025986 Ga0207658_10047802 Ga0207658_100478022 69
390 3300026023 Ga0207677_10008220 Ga0207677_100082204 69
391 3300026035 Ga0207703_10004399 Ga0207703_100043999 69
392 3300026041 Ga0207639_11921681 Ga0207639_119216812 69
393 3300026067 Ga0207678_10141216 Ga0207678_101412164 69
394 3300026075 Ga0207708_10199069 Ga0207708_101990692 69
395 3300026089 Ga0207648_10065123 Ga0207648_100651232 69
396 3300026089 Ga0207648_11029895 Ga0207648_110298952 69
397 3300026095 Ga0207676_10094063 Ga0207676_100940633 69
398 3300026095 Ga0207676_12025886 Ga0207676_120258862 69
399 3300026116 Ga0207674_10877294 Ga0207674_108772942 69
400 3300026118 Ga0207675_100024020 Ga0207675_1000240205 69
401 3300026121 Ga0207683_10008349 Ga0207683_1000834910 69
402 3300027111 Ga0209281_1021783 Ga0209281_10217833 69
403 3300027876 Ga0209974_10266698 Ga0209974_102666981 69
404 3300027907 Ga0207428_10139810 Ga0207428_101398102 69
405 3300028379 Ga0268266_10016545 Ga0268266_100165456 69
406 3300028379 Ga0268266_10525311 Ga0268266_105253113 69
407 3300028379 Ga0268266_11023623 Ga0268266_110236232 69
408 3300028380 Ga0268265_10087728 Ga0268265_100877284 69
409 3300028381 Ga0268264_11120569 Ga0268264_111205692 69
410 3300031239 Ga0265328_10001954 Ga0265328_100019546 69
411 3300031456 Ga0307513_10000014 Ga0307513_10000014211 69
412 3300031731 Ga0307405_10107421 Ga0307405_101074213 69
413 3300031852 Ga0307410_11390335 Ga0307410_113903351 69
414 3300031901 Ga0307406_11110239 Ga0307406_111102392 69
415 3300031911 Ga0307412_10259764 Ga0307412_102597641 69
416 3300031995 Ga0307409_101057136 Ga0307409_1010571361 69
417 3300032004 Ga0307414_10754459 Ga0307414_107544592 69
418 3300032126 Ga0307415_100524567 Ga0307415_1005245673 69
419 3300035241 Ga0373961_0177790 Ga0373961_0177790_463_678 69
420 3300037418 Ga0395900_0759295 Ga0395900_0759295_490_711 69
421 3300037471 Ga0395905_0000533 Ga0395905_0000533_24064_24285 69
422 3300037471 Ga0395905_1043357 Ga0395905_1043357_448_684 69
423 3300039093 Ga0400489_22869 Ga0400489_22869_4163_4387 69
424 3300041441 Ga0451787_156676 Ga0451787_156676_121_336 69
425 3300041443 Ga0451789_0070028 Ga0451789_0070028_55_270 69
426 3300041451 Ga0451791_0699446 Ga0451791_0699446_931_1146 69
427 3300041459 Ga0451800_0019961 Ga0451800_0019961_684_899 69
428 3300041460 Ga0451802_0720684 Ga0451802_0720684_463_684 69
429 3300041486 Ga0451807_0059270 Ga0451807_0059270_927_1142 69
430 3300041505 Ga0451849_0779932 Ga0451849_0779932_667_882 69
431 3300042007 Ga0439449_0157779 Ga0439449_0157779_163_393 69
432 3300042120 Ga0450917_030607 Ga0450917_030607_35_253 69
433 3300044693 Ga0466961_0332552 Ga0466961_0332552_423_644 69
434 3300044694 Ga0466963_0889100 Ga0466963_0889100_90_326 69
435 3300045976 Ga0466967_1812719 Ga0466967_1812719_243_479 69
436 3300046501 Ga0495607_0000003 Ga0495607_0000003_200820_201041 69
437 3300046507 Ga0495606_0215568 Ga0495606_0215568_126_341 69
438 3300046519 Ga0495632_0390732 Ga0495632_0390732_88_303 69
439 3300046525 Ga0495663_0221647 Ga0495663_0221647_204_419 69
440 3300046530 Ga0495654_0288107 Ga0495654_0288107_47_262 69
441 3300046542 Ga0495597_0012259 Ga0495597_0012259_968_1186 69
442 3300046616 Ga0495668_0038259 Ga0495668_0038259_2131_2346 69
443 3300046684 Ga0495669_0004896 Ga0495669_0004896_4869_5084 69
444 3300046684 Ga0495669_0302960 Ga0495669_0302960_450_668 69
445 3300046691 Ga0495670_0786185 Ga0495670_0786185_256_471 69
446 3300047472 Ga0495686_0503579 Ga0495686_0503579_186_401 69
447 3300048908 Ga0496105_0198280 Ga0496105_0198280_465_692 69
448 3300048909 Ga0496106_0331918 Ga0496106_0331918_474_695 69
449 3300048915 Ga0496112_0152910 Ga0496112_0152910_1321_1536 69
450 3300048916 Ga0496113_0028066 Ga0496113_0028066_1997_2224 69
451 3300048918 Ga0496115_0000160 Ga0496115_0000160_48585_48812 69
452 3300048919 Ga0496116_0202881 Ga0496116_0202881_404_625 69
453 3300048921 Ga0496118_0009856 Ga0496118_0009856_616_837 69
454 3300048924 Ga0496121_0000264 Ga0496121_0000264_66980_67201 69
455 3300048924 Ga0496121_0464999 Ga0496121_0464999_15_236 69
456 3300048925 Ga0496122_0231167 Ga0496122_0231167_291_512 69
457 3300048925 Ga0496122_0428377 Ga0496122_0428377_348_569 69
458 3300048926 Ga0496123_0135608 Ga0496123_0135608_1047_1268 69
459 3300049579 Ga0501043_0001152 Ga0501043_0001152_15356_15574 69
460 3300049585 Ga0501069_0702256 Ga0501069_0702256_54_272 69
461 3300049589 Ga0501073_0260859 Ga0501073_0260859_696_911 69
462 3300050490 nmdc:mga03n38_292748_c1 nmdc:mga03n38_292748_c1_303_518 69
463 3300050509 nmdc:mga0qj67_1400586_c1 nmdc:mga0qj67_1400586_c1_161_391 69
464 3300050511 nmdc:mga08y16_125312_c1 nmdc:mga08y16_125312_c1_1357_1575 69
465 3300053083 Ga0495655_0001722 Ga0495655_0001722_217_432 69
466 3300053088 Ga0500644_0004238 Ga0500644_0004238_1768_1983 69
467 3300053091 Ga0500647_0072947 Ga0500647_0072947_1053_1301 69
468 3300053093 Ga0500651_0001739 Ga0500651_0001739_3894_4109 69
469 3300053117 Ga0500593_000922 Ga0500593_000922_4878_5093 69
470 3300053129 Ga0500628_001023 Ga0500628_001023_3732_3947 69
471 3300053146 Ga0500588_0433279 Ga0500588_0433279_189_404 69
472 3300053151 Ga0500604_0034442 Ga0500604_0034442_395_610 69
473 3300053177 Ga0500636_0434683 Ga0500636_0434683_82_330 69
474 3300053730 Ga0500645_000100 Ga0500645_000100_59142_59357 69
475 3300055283 Ga0500661_019605 Ga0500661_019605_925_1140 69
476 3300005262 Ga0065165_1000569 Ga0065165_100056928 70
477 3300005327 Ga0070658_10164698 Ga0070658_101646983 70
478 3300005339 Ga0070660_100612903 Ga0070660_1006129031 70
479 3300005344 Ga0070661_100047387 Ga0070661_1000473873 70
480 3300005436 Ga0070713_100895053 Ga0070713_1008950532 70
481 3300005455 Ga0070663_100235080 Ga0070663_1002350803 70
482 3300005547 Ga0070693_101010653 Ga0070693_1010106531 70
483 3300005564 Ga0070664_102166141 Ga0070664_1021661411 70
484 3300005614 Ga0068856_100889481 Ga0068856_1008894813 70
485 3300005616 Ga0068852_100486070 Ga0068852_1004860701 70
486 3300005834 Ga0068851_11102655 Ga0068851_111026552 70
487 3300013105 Ga0157369_10129097 Ga0157369_101290973 70
488 3300013296 Ga0157374_10306050 Ga0157374_103060503 70
489 3300025321 Ga0207656_10702563 Ga0207656_107025632 70
490 3300025909 Ga0207705_11401951 Ga0207705_114019512 70
491 3300025919 Ga0207657_10028736 Ga0207657_100287365 70
492 3300025920 Ga0207649_10050602 Ga0207649_100506023 70
493 3300025929 Ga0207664_10274257 Ga0207664_102742572 70
494 3300026067 Ga0207678_10261609 Ga0207678_102616093 70
495 3300026078 Ga0207702_10063649 Ga0207702_100636493 70
496 3300026142 Ga0207698_10042738 Ga0207698_100427383 70
497 3300035170 Ga0373943_0020237 Ga0373943_0020237_2699_2944 70
498 3300035171 Ga0373946_0320038 Ga0373946_0320038_227_472 70
499 3300035692 Ga0373935_1245088 Ga0373935_1245088_67_312 70
500 3300035725 Ga0373947_0223874 Ga0373947_0223874_181_426 70
501 3300045976 Ga0466967_0408933 Ga0466967_0408933_137_394 70
502 3300001904 JGI24736J21556_1051727 JGI24736J21556_10517272 71
503 3300001989 JGI24739J22299_10036301 JGI24739J22299_100363013 71
504 3300001990 JGI24737J22298_10128711 JGI24737J22298_101287111 71
505 3300001991 JGI24743J22301_10126232 JGI24743J22301_101262321 71
506 3300005327 Ga0070658_10006118 Ga0070658_100061189 71
507 3300005328 Ga0070676_10063840 Ga0070676_100638403 71
508 3300005328 Ga0070676_10815380 Ga0070676_108153802 71
509 3300005330 Ga0070690_100032003 Ga0070690_1000320033 71
510 3300005330 Ga0070690_100319354 Ga0070690_1003193541 71
511 3300005331 Ga0070670_100317916 Ga0070670_1003179163 71
512 3300005335 Ga0070666_10020041 Ga0070666_100200411 71
513 3300005338 Ga0068868_100003120 Ga0068868_10000312012 71
514 3300005338 Ga0068868_100137392 Ga0068868_1001373921 71
515 3300005339 Ga0070660_100734251 Ga0070660_1007342512 71
516 3300005343 Ga0070687_100995491 Ga0070687_1009954911 71
517 3300005344 Ga0070661_100546550 Ga0070661_1005465502 71
518 3300005355 Ga0070671_100089982 Ga0070671_1000899822 71
519 3300005356 Ga0070674_100116069 Ga0070674_1001160693 71
520 3300005364 Ga0070673_100005923 Ga0070673_1000059234 71
521 3300005367 Ga0070667_100204861 Ga0070667_1002048613 71
522 3300005367 Ga0070667_100514127 Ga0070667_1005141271 71
523 3300005456 Ga0070678_100026605 Ga0070678_1000266055 71
524 3300005457 Ga0070662_100002319 Ga0070662_1000023197 71
525 3300005457 Ga0070662_100973906 Ga0070662_1009739062 71
526 3300005459 Ga0068867_100024829 Ga0068867_1000248293 71
527 3300005543 Ga0070672_100159845 Ga0070672_1001598453 71
528 3300005548 Ga0070665_100072277 Ga0070665_1000722774 71
529 3300005563 Ga0068855_100612987 Ga0068855_1006129873 71
530 3300005578 Ga0068854_100827416 Ga0068854_1008274161 71
531 3300005614 Ga0068856_100041790 Ga0068856_1000417904 71
532 3300005616 Ga0068852_100027385 Ga0068852_1000273852 71
533 3300005617 Ga0068859_100035149 Ga0068859_1000351492 71
534 3300005618 Ga0068864_100058476 Ga0068864_1000584761 71
535 3300005618 Ga0068864_100351974 Ga0068864_1003519742 71
536 3300005719 Ga0068861_102110048 Ga0068861_1021100481 71
537 3300005841 Ga0068863_100022253 Ga0068863_1000222533 71
538 3300005842 Ga0068858_100089669 Ga0068858_1000896694 71
539 3300005843 Ga0068860_100166753 Ga0068860_1001667533 71
540 3300006237 Ga0097621_100271850 Ga0097621_1002718503 71
541 3300006358 Ga0068871_100054690 Ga0068871_1000546903 71
542 3300006881 Ga0068865_100023365 Ga0068865_1000233651 71
543 3300006931 Ga0097620_100035149 Ga0097620_1000351492 71
544 3300009093 Ga0105240_11960216 Ga0105240_119602161 71
545 3300009098 Ga0105245_10029216 Ga0105245_100292164 71
546 3300009101 Ga0105247_10042611 Ga0105247_100426111 71
547 3300009174 Ga0105241_10109722 Ga0105241_101097222 71
548 3300009176 Ga0105242_10173509 Ga0105242_101735094 71
549 3300009177 Ga0105248_10171293 Ga0105248_101712932 71
550 3300009177 Ga0105248_11433382 Ga0105248_114333822 71
551 3300009551 Ga0105238_10010489 Ga0105238_1001048912 71
552 3300010375 Ga0105239_13090962 Ga0105239_130909622 71
553 3300011119 Ga0105246_10440689 Ga0105246_104406892 71
554 3300013102 Ga0157371_10017862 Ga0157371_100178624 71
555 3300013105 Ga0157369_10079417 Ga0157369_100794173 71
556 3300013296 Ga0157374_10154744 Ga0157374_101547443 71
557 3300013296 Ga0157374_10228049 Ga0157374_102280491 71
558 3300013297 Ga0157378_10060761 Ga0157378_100607612 71
559 3300013297 Ga0157378_10989859 Ga0157378_109898592 71
560 3300013297 Ga0157378_12374387 Ga0157378_123743872 71
561 3300013306 Ga0163162_10309432 Ga0163162_103094321 71
562 3300013306 Ga0163162_11881307 Ga0163162_118813072 71
563 3300013308 Ga0157375_10071528 Ga0157375_100715283 71
564 3300014325 Ga0163163_10042167 Ga0163163_100421673 71
565 3300014745 Ga0157377_10011511 Ga0157377_100115116 71
566 3300014968 Ga0157379_10037397 Ga0157379_100373973 71
567 3300014969 Ga0157376_10266483 Ga0157376_102664833 71
568 3300015265 Ga0182005_1139568 Ga0182005_11395681 71
569 3300025315 Ga0207697_10313158 Ga0207697_103131582 71
570 3300025321 Ga0207656_10021329 Ga0207656_100213294 71
571 3300025904 Ga0207647_10001683 Ga0207647_100016833 71
572 3300025904 Ga0207647_10092516 Ga0207647_100925162 71
573 3300025907 Ga0207645_10993268 Ga0207645_109932682 71
574 3300025908 Ga0207643_10200001 Ga0207643_102000012 71
575 3300025909 Ga0207705_10919818 Ga0207705_109198182 71
576 3300025920 Ga0207649_10572418 Ga0207649_105724182 71
577 3300025924 Ga0207694_11758669 Ga0207694_117586692 71
578 3300025927 Ga0207687_10013818 Ga0207687_100138184 71
579 3300025927 Ga0207687_10833225 Ga0207687_108332252 71
580 3300025931 Ga0207644_10000230 Ga0207644_1000023019 71
581 3300025934 Ga0207686_10108982 Ga0207686_101089824 71
582 3300025937 Ga0207669_11762892 Ga0207669_117628922 71
583 3300025938 Ga0207704_10032281 Ga0207704_100322814 71
584 3300025940 Ga0207691_10012591 Ga0207691_100125915 71
585 3300025941 Ga0207711_10002164 Ga0207711_100021644 71
586 3300025941 Ga0207711_10033835 Ga0207711_100338351 71
587 3300025960 Ga0207651_10001783 Ga0207651_100017834 71
588 3300025981 Ga0207640_10299463 Ga0207640_102994632 71
589 3300025986 Ga0207658_12137349 Ga0207658_121373492 71
590 3300026023 Ga0207677_10004992 Ga0207677_100049922 71
591 3300026023 Ga0207677_10021663 Ga0207677_100216635 71
592 3300026035 Ga0207703_10041032 Ga0207703_100410325 71
593 3300026035 Ga0207703_12200841 Ga0207703_122008412 71
594 3300026088 Ga0207641_10004516 Ga0207641_100045169 71
595 3300026089 Ga0207648_10027513 Ga0207648_100275134 71
596 3300026095 Ga0207676_10421976 Ga0207676_104219762 71
597 3300026095 Ga0207676_12011526 Ga0207676_120115262 71
598 3300026121 Ga0207683_10010591 Ga0207683_100105914 71
599 3300026142 Ga0207698_10059107 Ga0207698_100591072 71
600 3300028379 Ga0268266_11314845 Ga0268266_113148453 71
601 3300028381 Ga0268264_10971196 Ga0268264_109711962 71
602 3300035121 Ga0373960_0123907 Ga0373960_0123907_552_788 71
603 3300035691 Ga0373931_0148761 Ga0373931_0148761_452_688 71
604 3300035692 Ga0373935_0091061 Ga0373935_0091061_1487_1714 71
605 3300048903 Ga0496100_0001736 Ga0496100_0001736_5879_6115 71
606 3300048904 Ga0496101_0000533 Ga0496101_0000533_17048_17284 71
607 3300048907 Ga0496104_0387831 Ga0496104_0387831_238_474 71
608 3300048908 Ga0496105_0022052 Ga0496105_0022052_2496_2732 71
609 3300048910 Ga0496107_0032591 Ga0496107_0032591_3174_3410 71
610 3300048911 Ga0496108_0001094 Ga0496108_0001094_5209_5445 71
611 3300048912 Ga0496109_0188515 Ga0496109_0188515_992_1228 71
612 3300048913 Ga0496110_0000347 Ga0496110_0000347_13868_14104 71
613 3300048914 Ga0496111_0005235 Ga0496111_0005235_710_946 71
614 3300048915 Ga0496112_0001900 Ga0496112_0001900_5209_5445 71
615 3300048917 Ga0496114_0431851 Ga0496114_0431851_167_403 71
616 3300049582 Ga0501048_1015270 Ga0501048_1015270_207_524 71

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

6

68

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bs3-assembly1.cif.gz_A-2 crystal structure of a putative dna-binding protein from bacteroides fragilis 0.9366 3 64
3bs3-assembly1.cif.gz_A-2 crystal structure of a putative dna-binding protein from bacteroides fragilis 0.9084 3 64
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.8968 6 61
3kxa-assembly2.cif.gz_D crystal structure of ngo0477 from neisseria gonorrhoeae 0.894 10 61
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.8933 4 67
ID Description Score Start End Superfamily
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8968 6 61 1.10.260.40
3f51C00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8886 6 61 1.10.260.40
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8807 6 61 1.10.260.40
2axuB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8747 7 61 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8738 6 60 1.10.260.40
ID Description Score Start End GO Terms
AF-U4QB68-F1-model_v4 XRE family transcriptional regulator 0.9873 3 68 GO:0003677
GO:0016020
AF-A0A1W9IL55-F1-model_v4 deleted 0.9867 1 68
AF-A0A2E7F2W9-F1-model_v4 Cro/Cl family transcriptional regulator 0.9795 3 66 GO:0003677
AF-A0A1I1SD26-F1-model_v4 Putative transcriptional regulator 0.9783 1 67 GO:0003677
AF-A0A5C1B701-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9764 1 68 GO:0003677

Feature Viewer

pLDDT pTM Quality
89.96 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map