F469505
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 616 | 332 | 612 | 73 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10164698|Ga0070658_101646983 |
| Length | 85 |
| Sequence | MPIIVRLDVMLALRKVRSKELAADIGITEANLSLLKSGKVKGIRFATLEAICERLQCQPGDLLEYAPDDGSATVDESLTGAAGSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 2 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 3 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 4 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 5 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 6 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 15 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 16 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 19 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 20 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 214 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 239 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 240 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 241 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 280 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 283 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 284 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 315 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 317 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 318 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 319 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 320 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 321 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 322 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 323 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 324 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0 |
| Isolates | 0.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.16 |
| Nodule | 0.32 |
| Rhizoplane | 4.06 |
| Rhizosphere | 72.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1051727 | 3300001904 | Bacteria | 632 |
| 2 | JGI24746J21847_1023735 | 3300001977 | Bacteria | 852 |
| 3 | JGI24739J22299_10036301 | 3300001989 | Bacteria | 1666 |
| 4 | JGI24737J22298_10128711 | 3300001990 | Bacteria | 748 |
| 5 | JGI24737J22298_10168045 | 3300001990 | Bacteria | 647 |
| 6 | JGI24743J22301_10126232 | 3300001991 | Bacteria | 563 |
| 7 | JGI24735J21928_10003438 | 3300002067 | Bacteria | 5393 |
| 8 | JGI24749J21850_1013240 | 3300002076 | Bacteria | 1158 |
| 9 | JGI24033J26618_1038417 | 3300002155 | Bacteria | 662 |
| 10 | JGI24742J22300_10026940 | 3300002244 | Bacteria | 996 |
| 11 | JGI25155J39150_1000002 | 3300002704 | Bacteria | 292156 |
| 12 | JGI25156J39149_1000003 | 3300002705 | Bacteria | 305434 |
| 13 | JGI25154J39366_1000009 | 3300002738 | Bacteria | 305408 |
| 14 | JGI25157J39369_1000002 | 3300002741 | Bacteria | 305434 |
| 15 | JGI25150J39212_1008736 | 3300002774 | Bacteria | 1967 |
| 16 | JGI25150J39212_1008811 | 3300002774 | Bacteria | 1954 |
| 17 | JGI25159J45721_1008813 | 3300002987 | Bacteria | 2731 |
| 18 | JGI25151J46595_10130458 | 3300003187 | Bacteria | 627 |
| 19 | JGI25151J46595_10168592 | 3300003187 | Bacteria | 509 |
| 20 | rootH2_10024667 | 3300003320 | Bacteria | 13213 |
| 21 | rootL2_10317629 | 3300003322 | Bacteria | 1038 |
| 22 | JGI25160J50197_1084271 | 3300003354 | Bacteria | 585 |
| 23 | Ga0055526_1005186 | 3300003771 | Bacteria | 7571 |
| 24 | Ga0055537_1000246 | 3300003773 | Bacteria | 39605 |
| 25 | Ga0055537_1024471 | 3300003773 | Bacteria | 848 |
| 26 | Ga0055524_1000083 | 3300003775 | Bacteria | 119259 |
| 27 | Ga0055524_1009557 | 3300003775 | Bacteria | 3931 |
| 28 | Ga0055524_1014274 | 3300003775 | Bacteria | 2951 |
| 29 | Ga0055524_1076396 | 3300003775 | Bacteria | 625 |
| 30 | Ga0055536_1000594 | 3300003781 | Bacteria | 24651 |
| 31 | Ga0055536_1000644 | 3300003781 | Bacteria | 23734 |
| 32 | Ga0055536_1013314 | 3300003781 | Bacteria | 2981 |
| 33 | Ga0055536_1022606 | 3300003781 | Bacteria | 1871 |
| 34 | Ga0055536_1038392 | 3300003781 | Bacteria | 1161 |
| 35 | Ga0055536_1040232 | 3300003781 | Bacteria | 1115 |
| 36 | Ga0055536_1068568 | 3300003781 | Bacteria | 708 |
| 37 | Ga0055536_1089267 | 3300003781 | Bacteria | 569 |
| 38 | Ga0055534_1004416 | 3300003784 | Bacteria | 4078 |
| 39 | Ga0055534_1038777 | 3300003784 | Bacteria | 708 |
| 40 | Ga0055534_1042630 | 3300003784 | Bacteria | 664 |
| 41 | Ga0055528_1000450 | 3300003790 | Bacteria | 32880 |
| 42 | Ga0055528_1071910 | 3300003790 | Bacteria | 623 |
| 43 | Ga0055530_10000327 | 3300003791 | Bacteria | 42981 |
| 44 | Ga0055530_10001376 | 3300003791 | Bacteria | 18020 |
| 45 | Ga0055530_10053047 | 3300003791 | Bacteria | 933 |
| 46 | Ga0055540_1000012 | 3300003792 | Bacteria | 262667 |
| 47 | Ga0055531_10002179 | 3300003794 | Bacteria | 13370 |
| 48 | Ga0055531_10003025 | 3300003794 | Bacteria | 10907 |
| 49 | Ga0055531_10012688 | 3300003794 | Bacteria | 3942 |
| 50 | Ga0055531_10013728 | 3300003794 | Bacteria | 3710 |
| 51 | Ga0055531_10020404 | 3300003794 | Bacteria | 2622 |
| 52 | Ga0055531_10031558 | 3300003794 | Bacteria | 1751 |
| 53 | Ga0065165_1000569 | 3300005262 | Bacteria | 54781 |
| 54 | Ga0065165_1034884 | 3300005262 | Bacteria | 1550 |
| 55 | Ga0065715_10443413 | 3300005293 | Bacteria | 834 |
| 56 | Ga0070658_10006118 | 3300005327 | Bacteria | 9760 |
| 57 | Ga0070658_10009558 | 3300005327 | Bacteria | 7783 |
| 58 | Ga0070658_10128975 | 3300005327 | Bacteria | 2106 |
| 59 | Ga0070658_10164698 | 3300005327 | Bacteria | 1861 |
| 60 | Ga0070658_11660308 | 3300005327 | Bacteria | 553 |
| 61 | Ga0070676_10001015 | 3300005328 | Bacteria | 13927 |
| 62 | Ga0070676_10063840 | 3300005328 | Bacteria | 2194 |
| 63 | Ga0070676_10117667 | 3300005328 | Bacteria | 1663 |
| 64 | Ga0070676_10815380 | 3300005328 | Bacteria | 689 |
| 65 | Ga0070690_100032003 | 3300005330 | Bacteria | 3281 |
| 66 | Ga0070690_100319354 | 3300005330 | Bacteria | 1118 |
| 67 | Ga0070670_100134113 | 3300005331 | Bacteria | 2139 |
| 68 | Ga0070670_100317916 | 3300005331 | Bacteria | 1364 |
| 69 | Ga0070677_10008616 | 3300005333 | Bacteria | 3437 |
| 70 | Ga0068869_100378176 | 3300005334 | Bacteria | 1160 |
| 71 | Ga0070666_10002718 | 3300005335 | Bacteria | 10684 |
| 72 | Ga0070666_10020041 | 3300005335 | Bacteria | 4320 |
| 73 | Ga0070666_10169887 | 3300005335 | Bacteria | 1527 |
| 74 | Ga0070666_10232044 | 3300005335 | Bacteria | 1304 |
| 75 | Ga0070680_100000181 | 3300005336 | Bacteria | 40747 |
| 76 | Ga0068868_100003120 | 3300005338 | Bacteria | 11534 |
| 77 | Ga0068868_100005168 | 3300005338 | Bacteria | 9161 |
| 78 | Ga0068868_100137392 | 3300005338 | Bacteria | 2004 |
| 79 | Ga0070660_100490847 | 3300005339 | Bacteria | 1021 |
| 80 | Ga0070660_100612903 | 3300005339 | Bacteria | 910 |
| 81 | Ga0070660_100734251 | 3300005339 | Bacteria | 829 |
| 82 | Ga0070689_100069990 | 3300005340 | Bacteria | 2738 |
| 83 | Ga0070689_100794555 | 3300005340 | Bacteria | 832 |
| 84 | Ga0070687_100995491 | 3300005343 | Bacteria | 607 |
| 85 | Ga0070661_100047387 | 3300005344 | Bacteria | 3145 |
| 86 | Ga0070661_100300626 | 3300005344 | Bacteria | 1249 |
| 87 | Ga0070661_100546550 | 3300005344 | Bacteria | 931 |
| 88 | Ga0070661_101028592 | 3300005344 | Bacteria | 684 |
| 89 | Ga0070668_100237887 | 3300005347 | Bacteria | 1507 |
| 90 | Ga0070668_101005291 | 3300005347 | Bacteria | 749 |
| 91 | Ga0070669_100821909 | 3300005353 | Bacteria | 790 |
| 92 | Ga0070675_100006519 | 3300005354 | Bacteria | 8967 |
| 93 | Ga0070671_100007811 | 3300005355 | Bacteria | 8546 |
| 94 | Ga0070671_100014488 | 3300005355 | Bacteria | 6373 |
| 95 | Ga0070671_100089982 | 3300005355 | Bacteria | 2569 |
| 96 | Ga0070671_101307973 | 3300005355 | Bacteria | 639 |
| 97 | Ga0070674_100008788 | 3300005356 | Bacteria | 6027 |
| 98 | Ga0070674_100023865 | 3300005356 | Bacteria | 3965 |
| 99 | Ga0070674_100116069 | 3300005356 | Bacteria | 1974 |
| 100 | Ga0070673_100005923 | 3300005364 | Bacteria | 7897 |
| 101 | Ga0070673_100038519 | 3300005364 | Bacteria | 3651 |
| 102 | Ga0070673_100109206 | 3300005364 | Bacteria | 2291 |
| 103 | Ga0070673_100445195 | 3300005364 | Bacteria | 1164 |
| 104 | Ga0070688_100058498 | 3300005365 | Bacteria | 2427 |
| 105 | Ga0070688_101412625 | 3300005365 | Bacteria | 564 |
| 106 | Ga0070659_100131600 | 3300005366 | Bacteria | 2032 |
| 107 | Ga0070659_100931021 | 3300005366 | Bacteria | 760 |
| 108 | Ga0070667_100006170 | 3300005367 | Bacteria | 9966 |
| 109 | Ga0070667_100145304 | 3300005367 | Bacteria | 2079 |
| 110 | Ga0070667_100204861 | 3300005367 | Bacteria | 1751 |
| 111 | Ga0070667_100307874 | 3300005367 | Bacteria | 1427 |
| 112 | Ga0070667_100514127 | 3300005367 | Bacteria | 1098 |
| 113 | Ga0070713_100895053 | 3300005436 | Bacteria | 853 |
| 114 | Ga0070711_101340254 | 3300005439 | Bacteria | 622 |
| 115 | Ga0070705_100936510 | 3300005440 | Bacteria | 699 |
| 116 | Ga0070700_100189177 | 3300005441 | Bacteria | 1438 |
| 117 | Ga0070663_100235080 | 3300005455 | Bacteria | 1444 |
| 118 | Ga0070663_100805750 | 3300005455 | Bacteria | 806 |
| 119 | Ga0070678_100008844 | 3300005456 | Bacteria | 6058 |
| 120 | Ga0070678_100026605 | 3300005456 | Bacteria | 3914 |
| 121 | Ga0070662_100002319 | 3300005457 | Bacteria | 11690 |
| 122 | Ga0070662_100002657 | 3300005457 | Bacteria | 11026 |
| 123 | Ga0070662_100172243 | 3300005457 | Bacteria | 1700 |
| 124 | Ga0070662_100973906 | 3300005457 | Bacteria | 725 |
| 125 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 126 | Ga0068867_100024829 | 3300005459 | Bacteria | 4297 |
| 127 | Ga0070685_10109208 | 3300005466 | Bacteria | 1701 |
| 128 | Ga0070679_100000380 | 3300005530 | Bacteria | 37755 |
| 129 | Ga0070679_100090724 | 3300005530 | Bacteria | 3044 |
| 130 | Ga0068853_101038618 | 3300005539 | Bacteria | 789 |
| 131 | Ga0070672_100011211 | 3300005543 | Bacteria | 6248 |
| 132 | Ga0070672_100159845 | 3300005543 | Bacteria | 1868 |
| 133 | Ga0070686_100015980 | 3300005544 | Bacteria | 4359 |
| 134 | Ga0070686_101761810 | 3300005544 | Bacteria | 527 |
| 135 | Ga0070693_101010653 | 3300005547 | Bacteria | 629 |
| 136 | Ga0070665_100024410 | 3300005548 | Bacteria | 6088 |
| 137 | Ga0070665_100072277 | 3300005548 | Bacteria | 3457 |
| 138 | Ga0070665_100218678 | 3300005548 | Bacteria | 1905 |
| 139 | Ga0070665_100856041 | 3300005548 | Bacteria | 922 |
| 140 | Ga0070704_102251289 | 3300005549 | Bacteria | 507 |
| 141 | Ga0068855_100612987 | 3300005563 | Bacteria | 1172 |
| 142 | Ga0070664_100266267 | 3300005564 | Bacteria | 1543 |
| 143 | Ga0070664_102166141 | 3300005564 | Bacteria | 527 |
| 144 | Ga0068857_100629203 | 3300005577 | Bacteria | 1016 |
| 145 | Ga0068857_100871183 | 3300005577 | Bacteria | 863 |
| 146 | Ga0068854_100321731 | 3300005578 | Bacteria | 1257 |
| 147 | Ga0068854_100827416 | 3300005578 | Bacteria | 809 |
| 148 | Ga0068854_101392731 | 3300005578 | Bacteria | 634 |
| 149 | Ga0068856_100041790 | 3300005614 | Bacteria | 4507 |
| 150 | Ga0068856_100889481 | 3300005614 | Bacteria | 909 |
| 151 | Ga0068852_100027385 | 3300005616 | Bacteria | 4645 |
| 152 | Ga0068852_100429648 | 3300005616 | Bacteria | 1304 |
| 153 | Ga0068852_100486070 | 3300005616 | Bacteria | 1227 |
| 154 | Ga0068852_101142323 | 3300005616 | Bacteria | 799 |
| 155 | Ga0068859_100035149 | 3300005617 | Bacteria | 5027 |
| 156 | Ga0068859_100056929 | 3300005617 | Bacteria | 3937 |
| 157 | Ga0068859_100070884 | 3300005617 | Bacteria | 3521 |
| 158 | Ga0068864_100058476 | 3300005618 | Bacteria | 3332 |
| 159 | Ga0068864_100351974 | 3300005618 | Bacteria | 1390 |
| 160 | Ga0068864_102077594 | 3300005618 | Bacteria | 574 |
| 161 | Ga0068861_100053995 | 3300005719 | Bacteria | 3060 |
| 162 | Ga0068861_102110048 | 3300005719 | Bacteria | 563 |
| 163 | Ga0068851_11102655 | 3300005834 | Bacteria | 503 |
| 164 | Ga0068870_10740182 | 3300005840 | Bacteria | 682 |
| 165 | Ga0068863_100022253 | 3300005841 | Bacteria | 6052 |
| 166 | Ga0068863_100070531 | 3300005841 | Bacteria | 3305 |
| 167 | Ga0068858_100006240 | 3300005842 | Bacteria | 11615 |
| 168 | Ga0068858_100089669 | 3300005842 | Bacteria | 2861 |
| 169 | Ga0068860_100050321 | 3300005843 | Bacteria | 3967 |
| 170 | Ga0068860_100166753 | 3300005843 | Bacteria | 2126 |
| 171 | Ga0068860_101282879 | 3300005843 | Bacteria | 753 |
| 172 | Ga0068862_100027088 | 3300005844 | Bacteria | 4823 |
| 173 | Ga0075366_10377004 | 3300006195 | Bacteria | 872 |
| 174 | Ga0097621_100271850 | 3300006237 | Bacteria | 1489 |
| 175 | Ga0097621_100907902 | 3300006237 | Bacteria | 821 |
| 176 | Ga0068871_100054690 | 3300006358 | Bacteria | 3239 |
| 177 | Ga0068871_100264647 | 3300006358 | Bacteria | 1501 |
| 178 | Ga0075430_101572543 | 3300006846 | Bacteria | 540 |
| 179 | Ga0068865_100023365 | 3300006881 | Bacteria | 4047 |
| 180 | Ga0068865_100037434 | 3300006881 | Bacteria | 3276 |
| 181 | Ga0068865_100469335 | 3300006881 | Bacteria | 1044 |
| 182 | Ga0068865_100875948 | 3300006881 | Bacteria | 779 |
| 183 | Ga0075436_101320120 | 3300006914 | Bacteria | 546 |
| 184 | Ga0097620_100035149 | 3300006931 | Bacteria | 5027 |
| 185 | Ga0097620_100051392 | 3300006931 | Bacteria | 4142 |
| 186 | Ga0097620_100056929 | 3300006931 | Bacteria | 3937 |
| 187 | Ga0097620_100070885 | 3300006931 | Bacteria | 3521 |
| 188 | Ga0079104_1022531 | 3300006946 | Bacteria | 1692 |
| 189 | Ga0105240_10013261 | 3300009093 | Bacteria | 11335 |
| 190 | Ga0105240_11960216 | 3300009093 | Bacteria | 609 |
| 191 | Ga0111539_10133677 | 3300009094 | Bacteria | 2904 |
| 192 | Ga0105245_10029216 | 3300009098 | Bacteria | 4869 |
| 193 | Ga0105247_10028393 | 3300009101 | Bacteria | 3385 |
| 194 | Ga0105247_10042611 | 3300009101 | Bacteria | 2781 |
| 195 | Ga0105247_10297317 | 3300009101 | Bacteria | 1119 |
| 196 | Ga0105243_10504422 | 3300009148 | Bacteria | 1147 |
| 197 | Ga0105241_10109722 | 3300009174 | Bacteria | 2207 |
| 198 | Ga0105241_10146923 | 3300009174 | Unclassified | 1925 |
| 199 | Ga0105241_10341645 | 3300009174 | Bacteria | 1297 |
| 200 | Ga0105241_12499536 | 3300009174 | Bacteria | 517 |
| 201 | Ga0105242_10173509 | 3300009176 | Bacteria | 1896 |
| 202 | Ga0105248_10014744 | 3300009177 | Bacteria | 8606 |
| 203 | Ga0105248_10171293 | 3300009177 | Bacteria | 2447 |
| 204 | Ga0105248_10324090 | 3300009177 | Bacteria | 1735 |
| 205 | Ga0105248_10495672 | 3300009177 | Bacteria | 1377 |
| 206 | Ga0105248_11433382 | 3300009177 | Bacteria | 782 |
| 207 | Ga0105238_10010489 | 3300009551 | Bacteria | 9300 |
| 208 | Ga0105238_12483631 | 3300009551 | Bacteria | 554 |
| 209 | Ga0105249_10104517 | 3300009553 | Bacteria | 2669 |
| 210 | Ga0105249_11587069 | 3300009553 | Bacteria | 727 |
| 211 | Ga0105028_141959 | 3300009993 | Unclassified | 516 |
| 212 | Ga0105239_10010608 | 3300010375 | Bacteria | 10305 |
| 213 | Ga0105239_10864800 | 3300010375 | Bacteria | 1037 |
| 214 | Ga0105239_12943177 | 3300010375 | Bacteria | 555 |
| 215 | Ga0105239_13090962 | 3300010375 | Bacteria | 542 |
| 216 | Ga0105246_10440689 | 3300011119 | Bacteria | 1092 |
| 217 | Ga0157371_10017862 | 3300013102 | Bacteria | 5258 |
| 218 | Ga0157369_10016105 | 3300013105 | Bacteria | 8413 |
| 219 | Ga0157369_10079417 | 3300013105 | Bacteria | 3514 |
| 220 | Ga0157369_10129097 | 3300013105 | Bacteria | 2679 |
| 221 | Ga0157369_10137263 | 3300013105 | Bacteria | 2588 |
| 222 | Ga0157369_10243788 | 3300013105 | Bacteria | 1877 |
| 223 | Ga0157369_10924728 | 3300013105 | Bacteria | 894 |
| 224 | Ga0157374_10154744 | 3300013296 | Bacteria | 2231 |
| 225 | Ga0157374_10228049 | 3300013296 | Bacteria | 1829 |
| 226 | Ga0157374_10306050 | 3300013296 | Bacteria | 1573 |
| 227 | Ga0157374_11962328 | 3300013296 | Bacteria | 611 |
| 228 | Ga0157378_10060761 | 3300013297 | Bacteria | 3372 |
| 229 | Ga0157378_10106836 | 3300013297 | Bacteria | 2561 |
| 230 | Ga0157378_10204983 | 3300013297 | Bacteria | 1867 |
| 231 | Ga0157378_10486333 | 3300013297 | Bacteria | 1231 |
| 232 | Ga0157378_10989859 | 3300013297 | Bacteria | 875 |
| 233 | Ga0157378_12374387 | 3300013297 | Bacteria | 582 |
| 234 | Ga0163162_10309432 | 3300013306 | Bacteria | 1712 |
| 235 | Ga0163162_11881307 | 3300013306 | Bacteria | 685 |
| 236 | Ga0157372_10003710 | 3300013307 | Bacteria | 16413 |
| 237 | Ga0157372_11699718 | 3300013307 | Bacteria | 726 |
| 238 | Ga0157375_10071528 | 3300013308 | Bacteria | 3482 |
| 239 | Ga0157375_11984894 | 3300013308 | Bacteria | 691 |
| 240 | Ga0163163_10042167 | 3300014325 | Bacteria | 4468 |
| 241 | Ga0157380_10024709 | 3300014326 | Bacteria | 4550 |
| 242 | Ga0157377_10011511 | 3300014745 | Bacteria | 4418 |
| 243 | Ga0157379_10037397 | 3300014968 | Bacteria | 4328 |
| 244 | Ga0157376_10266483 | 3300014969 | Bacteria | 1607 |
| 245 | Ga0182005_1139568 | 3300015265 | Bacteria | 700 |
| 246 | Ga0163161_10040001 | 3300017792 | Bacteria | 3367 |
| 247 | Ga0213876_10001074 | 3300021384 | Bacteria | 17574 |
| 248 | Ga0213876_10520470 | 3300021384 | Bacteria | 633 |
| 249 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 250 | Ga0207425_1005712 | 3300025245 | Bacteria | 3507 |
| 251 | Ga0207425_1007315 | 3300025245 | Bacteria | 2925 |
| 252 | Ga0207425_1020857 | 3300025245 | Bacteria | 1396 |
| 253 | Ga0207425_1083092 | 3300025245 | Bacteria | 532 |
| 254 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 255 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 256 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 257 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 258 | Ga0209565_1000512 | 3300025263 | Bacteria | 27970 |
| 259 | Ga0209673_1000074 | 3300025273 | Bacteria | 233552 |
| 260 | Ga0209130_1000303 | 3300025284 | Bacteria | 60008 |
| 261 | Ga0209130_1003980 | 3300025284 | Bacteria | 5899 |
| 262 | Ga0209130_1058724 | 3300025284 | Bacteria | 674 |
| 263 | Ga0209675_1000044 | 3300025291 | Bacteria | 230392 |
| 264 | Ga0209675_1002583 | 3300025291 | Bacteria | 9190 |
| 265 | Ga0209675_1011061 | 3300025291 | Bacteria | 3019 |
| 266 | Ga0209675_1013155 | 3300025291 | Bacteria | 2611 |
| 267 | Ga0209675_1059655 | 3300025291 | Bacteria | 758 |
| 268 | Ga0209675_1060746 | 3300025291 | Bacteria | 748 |
| 269 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 270 | Ga0209676_1001411 | 3300025292 | Bacteria | 23180 |
| 271 | Ga0209676_1001529 | 3300025292 | Bacteria | 21007 |
| 272 | Ga0209676_1002203 | 3300025292 | Bacteria | 14541 |
| 273 | Ga0209676_1005904 | 3300025292 | Bacteria | 6215 |
| 274 | Ga0209676_1006092 | 3300025292 | Bacteria | 6064 |
| 275 | Ga0209676_1007204 | 3300025292 | Bacteria | 5296 |
| 276 | Ga0209676_1110634 | 3300025292 | Bacteria | 568 |
| 277 | Ga0209025_1000562 | 3300025294 | Bacteria | 68180 |
| 278 | Ga0209025_1005124 | 3300025294 | Bacteria | 10875 |
| 279 | Ga0209025_1008130 | 3300025294 | Bacteria | 7618 |
| 280 | Ga0209025_1032273 | 3300025294 | Bacteria | 2452 |
| 281 | Ga0209025_1046191 | 3300025294 | Bacteria | 1794 |
| 282 | Ga0209025_1064993 | 3300025294 | Bacteria | 1336 |
| 283 | Ga0209025_1113131 | 3300025294 | Bacteria | 829 |
| 284 | Ga0209025_1143605 | 3300025294 | Bacteria | 671 |
| 285 | Ga0209025_1184491 | 3300025294 | Bacteria | 531 |
| 286 | Ga0209564_1000824 | 3300025295 | Bacteria | 42177 |
| 287 | Ga0209564_1006639 | 3300025295 | Bacteria | 6178 |
| 288 | Ga0209564_1067423 | 3300025295 | Bacteria | 763 |
| 289 | Ga0209758_1018098 | 3300025297 | Bacteria | 3472 |
| 290 | Ga0209758_1067680 | 3300025297 | Bacteria | 1141 |
| 291 | Ga0209758_1068524 | 3300025297 | Bacteria | 1129 |
| 292 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 293 | Ga0209050_1001252 | 3300025298 | Bacteria | 29294 |
| 294 | Ga0209050_1017396 | 3300025298 | Bacteria | 2870 |
| 295 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 296 | Ga0209256_1000457 | 3300025299 | Bacteria | 61666 |
| 297 | Ga0209256_1001133 | 3300025299 | Bacteria | 30376 |
| 298 | Ga0209256_1001275 | 3300025299 | Bacteria | 27368 |
| 299 | Ga0209256_1011883 | 3300025299 | Bacteria | 3417 |
| 300 | Ga0207426_1001024 | 3300025302 | Bacteria | 26788 |
| 301 | Ga0207426_1041745 | 3300025302 | Bacteria | 1419 |
| 302 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 303 | Ga0209051_1019015 | 3300025303 | Bacteria | 3015 |
| 304 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 305 | Ga0209257_1000065 | 3300025304 | Bacteria | 353604 |
| 306 | Ga0209257_1000529 | 3300025304 | Bacteria | 66275 |
| 307 | Ga0209257_1000867 | 3300025304 | Bacteria | 42999 |
| 308 | Ga0209257_1002673 | 3300025304 | Bacteria | 17100 |
| 309 | Ga0209257_1003712 | 3300025304 | Bacteria | 12690 |
| 310 | Ga0209257_1025478 | 3300025304 | Bacteria | 2020 |
| 311 | Ga0207697_10045533 | 3300025315 | Bacteria | 1806 |
| 312 | Ga0207697_10313158 | 3300025315 | Bacteria | 696 |
| 313 | Ga0207656_10021329 | 3300025321 | Bacteria | 2587 |
| 314 | Ga0207656_10702563 | 3300025321 | Bacteria | 518 |
| 315 | Ga0207682_10001150 | 3300025893 | Bacteria | 12259 |
| 316 | Ga0207692_10677555 | 3300025898 | Bacteria | 668 |
| 317 | Ga0207710_10029361 | 3300025900 | Bacteria | 2393 |
| 318 | Ga0207710_10151999 | 3300025900 | Bacteria | 1123 |
| 319 | Ga0207688_10093881 | 3300025901 | Bacteria | 1726 |
| 320 | Ga0207680_10003652 | 3300025903 | Bacteria | 7233 |
| 321 | Ga0207680_11038621 | 3300025903 | Bacteria | 586 |
| 322 | Ga0207647_10001683 | 3300025904 | Bacteria | 17030 |
| 323 | Ga0207647_10023953 | 3300025904 | Bacteria | 4031 |
| 324 | Ga0207647_10092516 | 3300025904 | Bacteria | 1803 |
| 325 | Ga0207647_10517469 | 3300025904 | Bacteria | 664 |
| 326 | Ga0207645_10002195 | 3300025907 | Bacteria | 15584 |
| 327 | Ga0207645_10993268 | 3300025907 | Bacteria | 568 |
| 328 | Ga0207643_10200001 | 3300025908 | Bacteria | 1216 |
| 329 | Ga0207643_10597641 | 3300025908 | Bacteria | 710 |
| 330 | Ga0207705_10845100 | 3300025909 | Bacteria | 710 |
| 331 | Ga0207705_10919818 | 3300025909 | Bacteria | 677 |
| 332 | Ga0207705_11310773 | 3300025909 | Bacteria | 553 |
| 333 | Ga0207705_11401951 | 3300025909 | Bacteria | 531 |
| 334 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 335 | Ga0207695_10010487 | 3300025913 | Bacteria | 11334 |
| 336 | Ga0207693_10946085 | 3300025915 | Bacteria | 660 |
| 337 | Ga0207660_10000269 | 3300025917 | Bacteria | 34082 |
| 338 | Ga0207657_10028736 | 3300025919 | Bacteria | 5068 |
| 339 | Ga0207649_10050602 | 3300025920 | Bacteria | 2570 |
| 340 | Ga0207649_10546716 | 3300025920 | Bacteria | 885 |
| 341 | Ga0207649_10572418 | 3300025920 | Bacteria | 866 |
| 342 | Ga0207649_10693177 | 3300025920 | Bacteria | 789 |
| 343 | Ga0207652_10000174 | 3300025921 | Bacteria | 69094 |
| 344 | Ga0207694_11758669 | 3300025924 | Bacteria | 521 |
| 345 | Ga0207650_10004942 | 3300025925 | Bacteria | 9108 |
| 346 | Ga0207659_10000660 | 3300025926 | Bacteria | 20395 |
| 347 | Ga0207687_10013818 | 3300025927 | Bacteria | 5273 |
| 348 | Ga0207687_10833225 | 3300025927 | Bacteria | 788 |
| 349 | Ga0207664_10274257 | 3300025929 | Bacteria | 1478 |
| 350 | Ga0207644_10000230 | 3300025931 | Bacteria | 38307 |
| 351 | Ga0207644_10011457 | 3300025931 | Bacteria | 5868 |
| 352 | Ga0207644_10127306 | 3300025931 | Bacteria | 1945 |
| 353 | Ga0207690_10102928 | 3300025932 | Bacteria | 2043 |
| 354 | Ga0207706_10000411 | 3300025933 | Bacteria | 45884 |
| 355 | Ga0207686_10108982 | 3300025934 | Bacteria | 1864 |
| 356 | Ga0207686_11384003 | 3300025934 | Bacteria | 579 |
| 357 | Ga0207670_10659930 | 3300025936 | Bacteria | 863 |
| 358 | Ga0207670_10700060 | 3300025936 | Bacteria | 839 |
| 359 | Ga0207669_10030882 | 3300025937 | Bacteria | 2984 |
| 360 | Ga0207669_10384579 | 3300025937 | Bacteria | 1094 |
| 361 | Ga0207669_11762892 | 3300025937 | Bacteria | 529 |
| 362 | Ga0207704_10032281 | 3300025938 | Bacteria | 2961 |
| 363 | Ga0207704_10167186 | 3300025938 | Bacteria | 1573 |
| 364 | Ga0207704_10461732 | 3300025938 | Bacteria | 1016 |
| 365 | Ga0207691_10001753 | 3300025940 | Bacteria | 21358 |
| 366 | Ga0207691_10012591 | 3300025940 | Bacteria | 8109 |
| 367 | Ga0207691_10252954 | 3300025940 | Bacteria | 1520 |
| 368 | Ga0207711_10000107 | 3300025941 | Bacteria | 87146 |
| 369 | Ga0207711_10002164 | 3300025941 | Bacteria | 17672 |
| 370 | Ga0207711_10033835 | 3300025941 | Bacteria | 4326 |
| 371 | Ga0207711_11219179 | 3300025941 | Bacteria | 694 |
| 372 | Ga0207651_10001783 | 3300025960 | Bacteria | 9995 |
| 373 | Ga0207651_10052252 | 3300025960 | Bacteria | 2785 |
| 374 | Ga0207651_10079999 | 3300025960 | Bacteria | 2350 |
| 375 | Ga0207651_11265125 | 3300025960 | Bacteria | 663 |
| 376 | Ga0207712_11001960 | 3300025961 | Bacteria | 741 |
| 377 | Ga0207712_11772201 | 3300025961 | Bacteria | 553 |
| 378 | Ga0207668_10070880 | 3300025972 | Bacteria | 2487 |
| 379 | Ga0207640_10299463 | 3300025981 | Bacteria | 1271 |
| 380 | Ga0207640_11124791 | 3300025981 | Bacteria | 696 |
| 381 | Ga0207658_10031446 | 3300025986 | Bacteria | 3769 |
| 382 | Ga0207658_10047802 | 3300025986 | Bacteria | 3133 |
| 383 | Ga0207658_12137349 | 3300025986 | Bacteria | 508 |
| 384 | Ga0207677_10004992 | 3300026023 | Bacteria | 7162 |
| 385 | Ga0207677_10008220 | 3300026023 | Bacteria | 5814 |
| 386 | Ga0207677_10021663 | 3300026023 | Bacteria | 3932 |
| 387 | Ga0207703_10004399 | 3300026035 | Bacteria | 11585 |
| 388 | Ga0207703_10041032 | 3300026035 | Bacteria | 3706 |
| 389 | Ga0207703_12200841 | 3300026035 | Bacteria | 527 |
| 390 | Ga0207639_11921681 | 3300026041 | Bacteria | 553 |
| 391 | Ga0207678_10141216 | 3300026067 | Bacteria | 2055 |
| 392 | Ga0207678_10261609 | 3300026067 | Bacteria | 1483 |
| 393 | Ga0207678_11368603 | 3300026067 | Bacteria | 626 |
| 394 | Ga0207708_10199069 | 3300026075 | Bacteria | 1597 |
| 395 | Ga0207702_10063649 | 3300026078 | Bacteria | 3155 |
| 396 | Ga0207641_10004516 | 3300026088 | Bacteria | 12028 |
| 397 | Ga0207648_10027513 | 3300026089 | Bacteria | 5048 |
| 398 | Ga0207648_10065123 | 3300026089 | Bacteria | 3177 |
| 399 | Ga0207648_11029895 | 3300026089 | Bacteria | 771 |
| 400 | Ga0207676_10094063 | 3300026095 | Bacteria | 2469 |
| 401 | Ga0207676_10421976 | 3300026095 | Bacteria | 1251 |
| 402 | Ga0207676_12011526 | 3300026095 | Bacteria | 576 |
| 403 | Ga0207676_12025886 | 3300026095 | Bacteria | 574 |
| 404 | Ga0207674_10877294 | 3300026116 | Bacteria | 865 |
| 405 | Ga0207675_100024020 | 3300026118 | Bacteria | 5667 |
| 406 | Ga0207683_10008349 | 3300026121 | Bacteria | 8858 |
| 407 | Ga0207683_10010591 | 3300026121 | Bacteria | 7864 |
| 408 | Ga0207698_10042738 | 3300026142 | Bacteria | 3389 |
| 409 | Ga0207698_10059107 | 3300026142 | Bacteria | 2975 |
| 410 | Ga0207698_10370104 | 3300026142 | Bacteria | 1360 |
| 411 | Ga0209281_1021783 | 3300027111 | Bacteria | 1234 |
| 412 | Ga0209974_10266698 | 3300027876 | Bacteria | 648 |
| 413 | Ga0207428_10139810 | 3300027907 | Bacteria | 1849 |
| 414 | Ga0268266_10016545 | 3300028379 | Bacteria | 6305 |
| 415 | Ga0268266_10525311 | 3300028379 | Bacteria | 1132 |
| 416 | Ga0268266_11023623 | 3300028379 | Bacteria | 799 |
| 417 | Ga0268266_11314845 | 3300028379 | Bacteria | 698 |
| 418 | Ga0268265_10087728 | 3300028380 | Bacteria | 2476 |
| 419 | Ga0268264_10971196 | 3300028381 | Bacteria | 855 |
| 420 | Ga0268264_11120569 | 3300028381 | Bacteria | 796 |
| 421 | Ga0265334_10003972 | 3300028573 | Bacteria | 6647 |
| 422 | Ga0265338_10000011 | 3300028800 | Bacteria | 433370 |
| 423 | Ga0265332_10157492 | 3300031238 | Bacteria | 949 |
| 424 | Ga0265328_10001954 | 3300031239 | Bacteria | 9370 |
| 425 | Ga0265328_10121975 | 3300031239 | Bacteria | 972 |
| 426 | Ga0265325_10000009 | 3300031241 | Bacteria | 184273 |
| 427 | Ga0265329_10009275 | 3300031242 | Bacteria | 3682 |
| 428 | Ga0265339_10000320 | 3300031249 | Bacteria | 38805 |
| 429 | Ga0265331_10000009 | 3300031250 | Bacteria | 314950 |
| 430 | Ga0265331_10006579 | 3300031250 | Bacteria | 6847 |
| 431 | Ga0265316_10235119 | 3300031344 | Bacteria | 1348 |
| 432 | Ga0307513_10000014 | 3300031456 | Bacteria | 303157 |
| 433 | Ga0265313_10017613 | 3300031595 | Bacteria | 4048 |
| 434 | Ga0265314_10015560 | 3300031711 | Bacteria | 6033 |
| 435 | Ga0265314_10068363 | 3300031711 | Bacteria | 2388 |
| 436 | Ga0265342_10043741 | 3300031712 | Bacteria | 2702 |
| 437 | Ga0307405_10107421 | 3300031731 | Bacteria | 1884 |
| 438 | Ga0307410_11390335 | 3300031852 | Bacteria | 616 |
| 439 | Ga0307406_11110239 | 3300031901 | Bacteria | 683 |
| 440 | Ga0307412_10259764 | 3300031911 | Bacteria | 1353 |
| 441 | Ga0307409_100561458 | 3300031995 | Bacteria | 1122 |
| 442 | Ga0307409_101057136 | 3300031995 | Bacteria | 832 |
| 443 | Ga0307414_10004112 | 3300032004 | Bacteria | 7858 |
| 444 | Ga0307414_10754459 | 3300032004 | Bacteria | 884 |
| 445 | Ga0307415_100524567 | 3300032126 | Bacteria | 1040 |
| 446 | Ga0373960_0123907 | 3300035121 | Bacteria | 860 |
| 447 | Ga0373943_0020237 | 3300035170 | Bacteria | 3066 |
| 448 | Ga0373946_0320038 | 3300035171 | Bacteria | 770 |
| 449 | Ga0373961_0177790 | 3300035241 | Bacteria | 740 |
| 450 | Ga0373931_0148761 | 3300035691 | Bacteria | 1363 |
| 451 | Ga0373935_0091061 | 3300035692 | Bacteria | 1997 |
| 452 | Ga0373935_1245088 | 3300035692 | Bacteria | 555 |
| 453 | Ga0373947_0223874 | 3300035725 | Bacteria | 1237 |
| 454 | Ga0373937_0278179 | 3300036401 | Bacteria | 1580 |
| 455 | Ga0373937_1344780 | 3300036401 | Bacteria | 662 |
| 456 | Ga0395900_0759295 | 3300037418 | Bacteria | 900 |
| 457 | Ga0395905_0000533 | 3300037471 | Bacteria | 52133 |
| 458 | Ga0395905_1043357 | 3300037471 | Bacteria | 721 |
| 459 | Ga0400489_22869 | 3300039093 | Bacteria | 5863 |
| 460 | Ga0436365_0257402 | 3300039437 | Bacteria | 164674 |
| 461 | Ga0451787_156676 | 3300041441 | Bacteria | 904 |
| 462 | Ga0451789_0070028 | 3300041443 | Bacteria | 545 |
| 463 | Ga0451791_0699446 | 3300041451 | Bacteria | 2124 |
| 464 | Ga0451797_0815129 | 3300041453 | Unclassified | 515 |
| 465 | Ga0451800_0019961 | 3300041459 | Bacteria | 1086 |
| 466 | Ga0451802_0720684 | 3300041460 | Bacteria | 732 |
| 467 | Ga0451802_1357694 | 3300041460 | Bacteria | 530 |
| 468 | Ga0451807_0059270 | 3300041486 | Bacteria | 1306 |
| 469 | Ga0451849_0779932 | 3300041505 | Bacteria | 897 |
| 470 | Ga0439449_0157779 | 3300042007 | Bacteria | 847 |
| 471 | Ga0450917_030607 | 3300042120 | Bacteria | 514 |
| 472 | Ga0466961_0332552 | 3300044693 | Bacteria | 926 |
| 473 | Ga0466963_0889100 | 3300044694 | Bacteria | 628 |
| 474 | Ga0466967_0408933 | 3300045976 | Bacteria | 1321 |
| 475 | Ga0466967_1812719 | 3300045976 | Bacteria | 607 |
| 476 | Ga0495592_0195183 | 3300046454 | Bacteria | 1370 |
| 477 | Ga0495592_0832777 | 3300046454 | Bacteria | 546 |
| 478 | Ga0495651_0222564 | 3300046462 | Bacteria | 1305 |
| 479 | Ga0495664_0121634 | 3300046477 | Bacteria | 1579 |
| 480 | Ga0495607_0000003 | 3300046501 | Bacteria | 366900 |
| 481 | Ga0495606_0215568 | 3300046507 | Bacteria | 1085 |
| 482 | Ga0495628_0236024 | 3300046516 | Bacteria | 1369 |
| 483 | Ga0495632_0390732 | 3300046519 | Bacteria | 608 |
| 484 | Ga0495643_0000019 | 3300046522 | Bacteria | 303627 |
| 485 | Ga0495663_0221647 | 3300046525 | Bacteria | 665 |
| 486 | Ga0495652_0015889 | 3300046529 | Bacteria | 6738 |
| 487 | Ga0495654_0288107 | 3300046530 | Bacteria | 674 |
| 488 | Ga0495587_0060621 | 3300046536 | Bacteria | 2218 |
| 489 | Ga0495597_0012259 | 3300046542 | Bacteria | 4138 |
| 490 | Ga0495645_0436365 | 3300046543 | Bacteria | 828 |
| 491 | Ga0495645_0463813 | 3300046543 | Bacteria | 797 |
| 492 | Ga0495668_0038259 | 3300046616 | Bacteria | 2681 |
| 493 | Ga0495669_0004896 | 3300046684 | Bacteria | 5557 |
| 494 | Ga0495669_0302960 | 3300046684 | Bacteria | 770 |
| 495 | Ga0495670_0786185 | 3300046691 | Bacteria | 519 |
| 496 | Ga0495649_0466522 | 3300046694 | Bacteria | 630 |
| 497 | Ga0495674_0484338 | 3300047319 | Bacteria | 991 |
| 498 | Ga0495675_0019940 | 3300047444 | Bacteria | 4260 |
| 499 | Ga0495686_0503579 | 3300047472 | Bacteria | 637 |
| 500 | Ga0496100_0001736 | 3300048903 | Bacteria | 10866 |
| 501 | Ga0496100_0722481 | 3300048903 | Bacteria | 778 |
| 502 | Ga0496101_0000533 | 3300048904 | Bacteria | 23349 |
| 503 | Ga0496104_0387831 | 3300048907 | Bacteria | 1309 |
| 504 | Ga0496105_0022052 | 3300048908 | Bacteria | 5156 |
| 505 | Ga0496105_0198280 | 3300048908 | Bacteria | 1639 |
| 506 | Ga0496106_0331918 | 3300048909 | Bacteria | 1221 |
| 507 | Ga0496107_0032591 | 3300048910 | Bacteria | 3724 |
| 508 | Ga0496108_0001094 | 3300048911 | Bacteria | 21158 |
| 509 | Ga0496109_0188515 | 3300048912 | Bacteria | 1937 |
| 510 | Ga0496110_0000347 | 3300048913 | Bacteria | 30884 |
| 511 | Ga0496111_0005235 | 3300048914 | Bacteria | 8269 |
| 512 | Ga0496112_0001900 | 3300048915 | Bacteria | 16480 |
| 513 | Ga0496112_0152910 | 3300048915 | Bacteria | 2275 |
| 514 | Ga0496113_0028066 | 3300048916 | Bacteria | 4044 |
| 515 | Ga0496114_0431851 | 3300048917 | Bacteria | 1167 |
| 516 | Ga0496115_0000160 | 3300048918 | Bacteria | 63326 |
| 517 | Ga0496116_0202881 | 3300048919 | Bacteria | 1036 |
| 518 | Ga0496118_0009856 | 3300048921 | Bacteria | 9557 |
| 519 | Ga0496121_0000264 | 3300048924 | Bacteria | 109400 |
| 520 | Ga0496121_0464999 | 3300048924 | Bacteria | 812 |
| 521 | Ga0496122_0231167 | 3300048925 | Bacteria | 1051 |
| 522 | Ga0496122_0428377 | 3300048925 | Bacteria | 663 |
| 523 | Ga0496123_0135608 | 3300048926 | Bacteria | 1355 |
| 524 | Ga0495678_002606 | 3300049459 | Bacteria | 12046 |
| 525 | Ga0495682_0004548 | 3300049460 | Bacteria | 5913 |
| 526 | Ga0501031_0065927 | 3300049568 | Bacteria | 2359 |
| 527 | Ga0501032_0038574 | 3300049569 | Bacteria | 3253 |
| 528 | Ga0501032_0129277 | 3300049569 | Bacteria | 1667 |
| 529 | Ga0501033_0016352 | 3300049570 | Bacteria | 5619 |
| 530 | Ga0501033_0409555 | 3300049570 | Bacteria | 945 |
| 531 | Ga0501033_1062164 | 3300049570 | Bacteria | 539 |
| 532 | Ga0501034_0014058 | 3300049571 | Bacteria | 8245 |
| 533 | Ga0501034_0110055 | 3300049571 | Bacteria | 2746 |
| 534 | Ga0501034_0209071 | 3300049571 | Bacteria | 1907 |
| 535 | Ga0501036_0032137 | 3300049572 | Bacteria | 4434 |
| 536 | Ga0501036_0393615 | 3300049572 | Bacteria | 1156 |
| 537 | Ga0501037_0028519 | 3300049573 | Bacteria | 4124 |
| 538 | Ga0501037_0241394 | 3300049573 | Bacteria | 1266 |
| 539 | Ga0501037_0666604 | 3300049573 | Bacteria | 694 |
| 540 | Ga0501038_0025985 | 3300049574 | Bacteria | 5215 |
| 541 | Ga0501038_0195279 | 3300049574 | Bacteria | 1627 |
| 542 | Ga0501038_0673168 | 3300049574 | Bacteria | 777 |
| 543 | Ga0501043_0001152 | 3300049579 | Bacteria | 23229 |
| 544 | Ga0501043_0319168 | 3300049579 | Bacteria | 1185 |
| 545 | Ga0501043_0620947 | 3300049579 | Bacteria | 797 |
| 546 | Ga0501043_0635754 | 3300049579 | Bacteria | 785 |
| 547 | Ga0501043_0687863 | 3300049579 | Bacteria | 748 |
| 548 | Ga0501043_1049281 | 3300049579 | Bacteria | 578 |
| 549 | Ga0501046_1161973 | 3300049580 | Bacteria | 531 |
| 550 | Ga0501046_1169914 | 3300049580 | Bacteria | 529 |
| 551 | Ga0501047_0061669 | 3300049581 | Bacteria | 3618 |
| 552 | Ga0501047_0228600 | 3300049581 | Bacteria | 1714 |
| 553 | Ga0501047_0328117 | 3300049581 | Bacteria | 1369 |
| 554 | Ga0501048_1015270 | 3300049582 | Bacteria | 597 |
| 555 | Ga0501048_1093730 | 3300049582 | Bacteria | 573 |
| 556 | Ga0501067_0003061 | 3300049583 | Bacteria | 9231 |
| 557 | Ga0501068_0214390 | 3300049584 | Bacteria | 1223 |
| 558 | Ga0501068_0560218 | 3300049584 | Bacteria | 743 |
| 559 | Ga0501068_0608482 | 3300049584 | Bacteria | 712 |
| 560 | Ga0501069_0213405 | 3300049585 | Bacteria | 1120 |
| 561 | Ga0501069_0702256 | 3300049585 | Bacteria | 610 |
| 562 | Ga0501070_0000111 | 3300049586 | Bacteria | 71786 |
| 563 | Ga0501070_0010329 | 3300049586 | Bacteria | 7892 |
| 564 | Ga0501070_0214898 | 3300049586 | Unclassified | 1578 |
| 565 | Ga0501070_0464683 | 3300049586 | Bacteria | 1019 |
| 566 | Ga0501071_0453125 | 3300049587 | Bacteria | 982 |
| 567 | Ga0501073_0007633 | 3300049589 | Bacteria | 8029 |
| 568 | Ga0501073_0044784 | 3300049589 | Bacteria | 3119 |
| 569 | Ga0501073_0260859 | 3300049589 | Bacteria | 1196 |
| 570 | Ga0501074_0027325 | 3300049590 | Bacteria | 4137 |
| 571 | Ga0501079_0008250 | 3300049741 | Bacteria | 7895 |
| 572 | Ga0501079_0259984 | 3300049741 | Bacteria | 1357 |
| 573 | Ga0501080_0009306 | 3300049742 | Bacteria | 8959 |
| 574 | Ga0501080_0041350 | 3300049742 | Bacteria | 4296 |
| 575 | Ga0501080_0116662 | 3300049742 | Bacteria | 2474 |
| 576 | Ga0501083_0033850 | 3300049744 | Bacteria | 3497 |
| 577 | Ga0501035_0000847 | 3300049822 | Bacteria | 32697 |
| 578 | Ga0501035_0021076 | 3300049822 | Bacteria | 5992 |
| 579 | Ga0501035_0824393 | 3300049822 | Bacteria | 740 |
| 580 | Ga0501044_0001302 | 3300049823 | Bacteria | 29482 |
| 581 | Ga0501044_0015687 | 3300049823 | Bacteria | 8157 |
| 582 | Ga0501044_0035376 | 3300049823 | Bacteria | 5230 |
| 583 | Ga0501044_0199740 | 3300049823 | Bacteria | 1958 |
| 584 | Ga0501045_1429965 | 3300049824 | Bacteria | 502 |
| 585 | nmdc:mga03n38_292748_c1 | 3300050490 | Bacteria | 872 |
| 586 | nmdc:mga0qj67_1400586_c1 | 3300050509 | Bacteria | 540 |
| 587 | nmdc:mga08y16_125312_c1 | 3300050511 | Bacteria | 2672 |
| 588 | Ga0495655_0001722 | 3300053083 | Bacteria | 3388 |
| 589 | Ga0500578_0000082 | 3300053086 | Bacteria | 105580 |
| 590 | Ga0500644_0004238 | 3300053088 | Bacteria | 3583 |
| 591 | Ga0500647_0072947 | 3300053091 | Bacteria | 1648 |
| 592 | Ga0500651_0001739 | 3300053093 | Bacteria | 11140 |
| 593 | Ga0500593_000922 | 3300053117 | Bacteria | 10921 |
| 594 | Ga0500594_0000274 | 3300053118 | Bacteria | 11997 |
| 595 | Ga0500628_001023 | 3300053129 | Bacteria | 4878 |
| 596 | Ga0500655_001429 | 3300053133 | Bacteria | 4535 |
| 597 | Ga0500655_003504 | 3300053133 | Bacteria | 2833 |
| 598 | Ga0500568_0001614 | 3300053139 | Bacteria | 14262 |
| 599 | Ga0500588_0433279 | 3300053146 | Bacteria | 501 |
| 600 | Ga0500604_0000014 | 3300053151 | Bacteria | 92128 |
| 601 | Ga0500604_0034442 | 3300053151 | Bacteria | 1502 |
| 602 | Ga0500616_0000591 | 3300053153 | Bacteria | 44073 |
| 603 | Ga0500616_0059453 | 3300053153 | Bacteria | 1985 |
| 604 | Ga0500619_091121 | 3300053154 | Bacteria | 1030 |
| 605 | Ga0500636_0434683 | 3300053177 | Bacteria | 598 |
| 606 | Ga0500645_000100 | 3300053730 | Bacteria | 68299 |
| 607 | Ga0500587_031846 | 3300053739 | Bacteria | 727 |
| 608 | Ga0501084_0011686 | 3300054114 | Bacteria | 7267 |
| 609 | Ga0501084_0977018 | 3300054114 | Bacteria | 712 |
| 610 | Ga0500661_019605 | 3300055283 | Bacteria | 1204 |
| 611 | Ga0501082_0073983 | 3300060353 | Bacteria | 2934 |
| 612 | Ga0501082_0593864 | 3300060353 | Bacteria | 969 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026067 | Ga0207678_11368603 | Ga0207678_113686031 | 59 |
| 2 | 3300048903 | Ga0496100_0722481 | Ga0496100_0722481_551_760 | 60 |
| 3 | iso_pu_bacteria | 2891088606 | 2891092161 | 61 |
| 4 | iso_pu_bacteria | 2593339239 | 2595452963 | 65 |
| 5 | iso_pu_bacteria | 2818991440 | 2819564707 | 65 |
| 6 | iso_pu_bacteria | 2904463128 | 2904465776 | 65 |
| 7 | 3300005327 | Ga0070658_11660308 | Ga0070658_116603081 | 66 |
| 8 | 3300013307 | Ga0157372_10003710 | Ga0157372_100037107 | 66 |
| 9 | 3300025909 | Ga0207705_10845100 | Ga0207705_108451001 | 66 |
| 10 | 3300025909 | Ga0207705_11310773 | Ga0207705_113107732 | 66 |
| 11 | 3300049459 | Ga0495678_002606 | Ga0495678_002606_3746_3958 | 67 |
| 12 | 3300049571 | Ga0501034_0209071 | Ga0501034_0209071_1493_1702 | 67 |
| 13 | 3300053086 | Ga0500578_0000082 | Ga0500578_0000082_98090_98302 | 67 |
| 14 | 3300053118 | Ga0500594_0000274 | Ga0500594_0000274_7034_7246 | 67 |
| 15 | 3300003320 | rootH2_10024667 | rootH2_100246673 | 68 |
| 16 | 3300003322 | rootL2_10317629 | rootL2_103176293 | 68 |
| 17 | 3300005327 | Ga0070658_10009558 | Ga0070658_100095585 | 68 |
| 18 | 3300005336 | Ga0070680_100000181 | Ga0070680_10000018132 | 68 |
| 19 | 3300005344 | Ga0070661_100300626 | Ga0070661_1003006262 | 68 |
| 20 | 3300005439 | Ga0070711_101340254 | Ga0070711_1013402541 | 68 |
| 21 | 3300005458 | Ga0070681_10000002 | Ga0070681_10000002670 | 68 |
| 22 | 3300005530 | Ga0070679_100000380 | Ga0070679_1000003807 | 68 |
| 23 | 3300005539 | Ga0068853_101038618 | Ga0068853_1010386181 | 68 |
| 24 | 3300005616 | Ga0068852_100429648 | Ga0068852_1004296483 | 68 |
| 25 | 3300006237 | Ga0097621_100907902 | Ga0097621_1009079022 | 68 |
| 26 | 3300006358 | Ga0068871_100264647 | Ga0068871_1002646472 | 68 |
| 27 | 3300009093 | Ga0105240_10013261 | Ga0105240_100132616 | 68 |
| 28 | 3300009101 | Ga0105247_10028393 | Ga0105247_100283935 | 68 |
| 29 | 3300009174 | Ga0105241_10146923 | Ga0105241_101469233 | 68 |
| 30 | 3300009174 | Ga0105241_10341645 | Ga0105241_103416452 | 68 |
| 31 | 3300009551 | Ga0105238_12483631 | Ga0105238_124836311 | 68 |
| 32 | 3300009553 | Ga0105249_10104517 | Ga0105249_101045174 | 68 |
| 33 | 3300010375 | Ga0105239_10010608 | Ga0105239_1001060812 | 68 |
| 34 | 3300010375 | Ga0105239_12943177 | Ga0105239_129431772 | 68 |
| 35 | 3300013105 | Ga0157369_10016105 | Ga0157369_1001610513 | 68 |
| 36 | 3300013105 | Ga0157369_10137263 | Ga0157369_101372634 | 68 |
| 37 | 3300013297 | Ga0157378_10204983 | Ga0157378_102049835 | 68 |
| 38 | 3300013297 | Ga0157378_10486333 | Ga0157378_104863333 | 68 |
| 39 | 3300013307 | Ga0157372_11699718 | Ga0157372_116997182 | 68 |
| 40 | 3300021384 | Ga0213876_10001074 | Ga0213876_100010744 | 68 |
| 41 | 3300021384 | Ga0213876_10520470 | Ga0213876_105204702 | 68 |
| 42 | 3300025898 | Ga0207692_10677555 | Ga0207692_106775552 | 68 |
| 43 | 3300025900 | Ga0207710_10029361 | Ga0207710_100293614 | 68 |
| 44 | 3300025912 | Ga0207707_10000002 | Ga0207707_10000002288 | 68 |
| 45 | 3300025913 | Ga0207695_10010487 | Ga0207695_100104876 | 68 |
| 46 | 3300025915 | Ga0207693_10946085 | Ga0207693_109460852 | 68 |
| 47 | 3300025917 | Ga0207660_10000269 | Ga0207660_1000026932 | 68 |
| 48 | 3300025920 | Ga0207649_10546716 | Ga0207649_105467162 | 68 |
| 49 | 3300025920 | Ga0207649_10693177 | Ga0207649_106931772 | 68 |
| 50 | 3300025921 | Ga0207652_10000174 | Ga0207652_1000017444 | 68 |
| 51 | 3300025934 | Ga0207686_11384003 | Ga0207686_113840031 | 68 |
| 52 | 3300025961 | Ga0207712_11001960 | Ga0207712_110019602 | 68 |
| 53 | 3300026142 | Ga0207698_10370104 | Ga0207698_103701042 | 68 |
| 54 | 3300028573 | Ga0265334_10003972 | Ga0265334_100039725 | 68 |
| 55 | 3300028800 | Ga0265338_10000011 | Ga0265338_10000011267 | 68 |
| 56 | 3300031238 | Ga0265332_10157492 | Ga0265332_101574922 | 68 |
| 57 | 3300031239 | Ga0265328_10121975 | Ga0265328_101219752 | 68 |
| 58 | 3300031241 | Ga0265325_10000009 | Ga0265325_10000009146 | 68 |
| 59 | 3300031242 | Ga0265329_10009275 | Ga0265329_100092753 | 68 |
| 60 | 3300031249 | Ga0265339_10000320 | Ga0265339_1000032010 | 68 |
| 61 | 3300031250 | Ga0265331_10000009 | Ga0265331_10000009291 | 68 |
| 62 | 3300031250 | Ga0265331_10006579 | Ga0265331_100065796 | 68 |
| 63 | 3300031344 | Ga0265316_10235119 | Ga0265316_102351192 | 68 |
| 64 | 3300031595 | Ga0265313_10017613 | Ga0265313_100176136 | 68 |
| 65 | 3300031711 | Ga0265314_10015560 | Ga0265314_100155604 | 68 |
| 66 | 3300031711 | Ga0265314_10068363 | Ga0265314_100683634 | 68 |
| 67 | 3300031712 | Ga0265342_10043741 | Ga0265342_100437414 | 68 |
| 68 | 3300031995 | Ga0307409_100561458 | Ga0307409_1005614582 | 68 |
| 69 | 3300032004 | Ga0307414_10004112 | Ga0307414_100041125 | 68 |
| 70 | 3300036401 | Ga0373937_0278179 | Ga0373937_0278179_265_474 | 68 |
| 71 | 3300036401 | Ga0373937_1344780 | Ga0373937_1344780_182_391 | 68 |
| 72 | 3300039437 | Ga0436365_0257402 | Ga0436365_0257402_161805_162014 | 68 |
| 73 | 3300041453 | Ga0451797_0815129 | Ga0451797_0815129_55_264 | 68 |
| 74 | 3300041460 | Ga0451802_1357694 | Ga0451802_1357694_50_259 | 68 |
| 75 | 3300046454 | Ga0495592_0195183 | Ga0495592_0195183_214_423 | 68 |
| 76 | 3300046454 | Ga0495592_0832777 | Ga0495592_0832777_55_264 | 68 |
| 77 | 3300046462 | Ga0495651_0222564 | Ga0495651_0222564_1077_1286 | 68 |
| 78 | 3300046477 | Ga0495664_0121634 | Ga0495664_0121634_806_1015 | 68 |
| 79 | 3300046516 | Ga0495628_0236024 | Ga0495628_0236024_1090_1299 | 68 |
| 80 | 3300046522 | Ga0495643_0000019 | Ga0495643_0000019_202125_202337 | 68 |
| 81 | 3300046529 | Ga0495652_0015889 | Ga0495652_0015889_1272_1481 | 68 |
| 82 | 3300046536 | Ga0495587_0060621 | Ga0495587_0060621_868_1077 | 68 |
| 83 | 3300046543 | Ga0495645_0436365 | Ga0495645_0436365_500_709 | 68 |
| 84 | 3300046543 | Ga0495645_0463813 | Ga0495645_0463813_170_379 | 68 |
| 85 | 3300046694 | Ga0495649_0466522 | Ga0495649_0466522_126_356 | 68 |
| 86 | 3300047319 | Ga0495674_0484338 | Ga0495674_0484338_626_835 | 68 |
| 87 | 3300047444 | Ga0495675_0019940 | Ga0495675_0019940_2967_3176 | 68 |
| 88 | 3300049460 | Ga0495682_0004548 | Ga0495682_0004548_3603_3812 | 68 |
| 89 | 3300049568 | Ga0501031_0065927 | Ga0501031_0065927_316_525 | 68 |
| 90 | 3300049569 | Ga0501032_0038574 | Ga0501032_0038574_1851_2060 | 68 |
| 91 | 3300049569 | Ga0501032_0129277 | Ga0501032_0129277_1145_1354 | 68 |
| 92 | 3300049570 | Ga0501033_0016352 | Ga0501033_0016352_154_363 | 68 |
| 93 | 3300049570 | Ga0501033_0409555 | Ga0501033_0409555_447_656 | 68 |
| 94 | 3300049570 | Ga0501033_1062164 | Ga0501033_1062164_102_311 | 68 |
| 95 | 3300049571 | Ga0501034_0014058 | Ga0501034_0014058_6808_7017 | 68 |
| 96 | 3300049571 | Ga0501034_0110055 | Ga0501034_0110055_193_402 | 68 |
| 97 | 3300049572 | Ga0501036_0032137 | Ga0501036_0032137_963_1172 | 68 |
| 98 | 3300049572 | Ga0501036_0393615 | Ga0501036_0393615_736_945 | 68 |
| 99 | 3300049573 | Ga0501037_0028519 | Ga0501037_0028519_2729_2938 | 68 |
| 100 | 3300049573 | Ga0501037_0241394 | Ga0501037_0241394_501_710 | 68 |
| 101 | 3300049573 | Ga0501037_0666604 | Ga0501037_0666604_81_290 | 68 |
| 102 | 3300049574 | Ga0501038_0025985 | Ga0501038_0025985_1042_1251 | 68 |
| 103 | 3300049574 | Ga0501038_0195279 | Ga0501038_0195279_22_231 | 68 |
| 104 | 3300049574 | Ga0501038_0673168 | Ga0501038_0673168_232_441 | 68 |
| 105 | 3300049579 | Ga0501043_0319168 | Ga0501043_0319168_139_348 | 68 |
| 106 | 3300049579 | Ga0501043_0620947 | Ga0501043_0620947_395_604 | 68 |
| 107 | 3300049579 | Ga0501043_0635754 | Ga0501043_0635754_208_417 | 68 |
| 108 | 3300049579 | Ga0501043_0687863 | Ga0501043_0687863_264_473 | 68 |
| 109 | 3300049579 | Ga0501043_1049281 | Ga0501043_1049281_334_543 | 68 |
| 110 | 3300049580 | Ga0501046_1161973 | Ga0501046_1161973_161_370 | 68 |
| 111 | 3300049580 | Ga0501046_1169914 | Ga0501046_1169914_267_476 | 68 |
| 112 | 3300049581 | Ga0501047_0061669 | Ga0501047_0061669_2476_2685 | 68 |
| 113 | 3300049581 | Ga0501047_0228600 | Ga0501047_0228600_84_293 | 68 |
| 114 | 3300049581 | Ga0501047_0328117 | Ga0501047_0328117_390_599 | 68 |
| 115 | 3300049582 | Ga0501048_1093730 | Ga0501048_1093730_28_237 | 68 |
| 116 | 3300049583 | Ga0501067_0003061 | Ga0501067_0003061_5532_5741 | 68 |
| 117 | 3300049584 | Ga0501068_0214390 | Ga0501068_0214390_813_1022 | 68 |
| 118 | 3300049584 | Ga0501068_0560218 | Ga0501068_0560218_306_515 | 68 |
| 119 | 3300049584 | Ga0501068_0608482 | Ga0501068_0608482_158_367 | 68 |
| 120 | 3300049585 | Ga0501069_0213405 | Ga0501069_0213405_379_588 | 68 |
| 121 | 3300049586 | Ga0501070_0000111 | Ga0501070_0000111_34219_34428 | 68 |
| 122 | 3300049586 | Ga0501070_0010329 | Ga0501070_0010329_6096_6305 | 68 |
| 123 | 3300049586 | Ga0501070_0214898 | Ga0501070_0214898_642_851 | 68 |
| 124 | 3300049586 | Ga0501070_0464683 | Ga0501070_0464683_538_747 | 68 |
| 125 | 3300049587 | Ga0501071_0453125 | Ga0501071_0453125_581_790 | 68 |
| 126 | 3300049589 | Ga0501073_0007633 | Ga0501073_0007633_468_677 | 68 |
| 127 | 3300049589 | Ga0501073_0044784 | Ga0501073_0044784_2860_3069 | 68 |
| 128 | 3300049590 | Ga0501074_0027325 | Ga0501074_0027325_2161_2370 | 68 |
| 129 | 3300049741 | Ga0501079_0008250 | Ga0501079_0008250_7327_7536 | 68 |
| 130 | 3300049741 | Ga0501079_0259984 | Ga0501079_0259984_606_815 | 68 |
| 131 | 3300049742 | Ga0501080_0009306 | Ga0501080_0009306_5324_5533 | 68 |
| 132 | 3300049742 | Ga0501080_0041350 | Ga0501080_0041350_2169_2378 | 68 |
| 133 | 3300049742 | Ga0501080_0116662 | Ga0501080_0116662_233_442 | 68 |
| 134 | 3300049744 | Ga0501083_0033850 | Ga0501083_0033850_625_834 | 68 |
| 135 | 3300049822 | Ga0501035_0000847 | Ga0501035_0000847_32307_32516 | 68 |
| 136 | 3300049822 | Ga0501035_0021076 | Ga0501035_0021076_1274_1483 | 68 |
| 137 | 3300049822 | Ga0501035_0824393 | Ga0501035_0824393_151_363 | 68 |
| 138 | 3300049823 | Ga0501044_0001302 | Ga0501044_0001302_13330_13539 | 68 |
| 139 | 3300049823 | Ga0501044_0015687 | Ga0501044_0015687_6396_6605 | 68 |
| 140 | 3300049823 | Ga0501044_0035376 | Ga0501044_0035376_4694_4903 | 68 |
| 141 | 3300049823 | Ga0501044_0199740 | Ga0501044_0199740_1032_1241 | 68 |
| 142 | 3300049824 | Ga0501045_1429965 | Ga0501045_1429965_51_260 | 68 |
| 143 | 3300053133 | Ga0500655_001429 | Ga0500655_001429_4278_4487 | 68 |
| 144 | 3300053133 | Ga0500655_003504 | Ga0500655_003504_1097_1306 | 68 |
| 145 | 3300053139 | Ga0500568_0001614 | Ga0500568_0001614_6225_6434 | 68 |
| 146 | 3300053151 | Ga0500604_0000014 | Ga0500604_0000014_87172_87381 | 68 |
| 147 | 3300053153 | Ga0500616_0000591 | Ga0500616_0000591_7833_8042 | 68 |
| 148 | 3300053153 | Ga0500616_0059453 | Ga0500616_0059453_610_822 | 68 |
| 149 | 3300053154 | Ga0500619_091121 | Ga0500619_091121_188_397 | 68 |
| 150 | 3300053739 | Ga0500587_031846 | Ga0500587_031846_316_525 | 68 |
| 151 | 3300054114 | Ga0501084_0011686 | Ga0501084_0011686_5906_6115 | 68 |
| 152 | 3300054114 | Ga0501084_0977018 | Ga0501084_0977018_416_625 | 68 |
| 153 | 3300060353 | Ga0501082_0073983 | Ga0501082_0073983_1324_1533 | 68 |
| 154 | 3300060353 | Ga0501082_0593864 | Ga0501082_0593864_617_826 | 68 |
| 155 | 3300001977 | JGI24746J21847_1023735 | JGI24746J21847_10237352 | 69 |
| 156 | 3300001990 | JGI24737J22298_10168045 | JGI24737J22298_101680452 | 69 |
| 157 | 3300002067 | JGI24735J21928_10003438 | JGI24735J21928_100034383 | 69 |
| 158 | 3300002076 | JGI24749J21850_1013240 | JGI24749J21850_10132401 | 69 |
| 159 | 3300002155 | JGI24033J26618_1038417 | JGI24033J26618_10384171 | 69 |
| 160 | 3300002244 | JGI24742J22300_10026940 | JGI24742J22300_100269402 | 69 |
| 161 | 3300002704 | JGI25155J39150_1000002 | JGI25155J39150_1000002179 | 69 |
| 162 | 3300002705 | JGI25156J39149_1000003 | JGI25156J39149_1000003127 | 69 |
| 163 | 3300002738 | JGI25154J39366_1000009 | JGI25154J39366_1000009179 | 69 |
| 164 | 3300002741 | JGI25157J39369_1000002 | JGI25157J39369_1000002179 | 69 |
| 165 | 3300002774 | JGI25150J39212_1008736 | JGI25150J39212_10087363 | 69 |
| 166 | 3300002774 | JGI25150J39212_1008811 | JGI25150J39212_10088112 | 69 |
| 167 | 3300002987 | JGI25159J45721_1008813 | JGI25159J45721_10088133 | 69 |
| 168 | 3300003187 | JGI25151J46595_10130458 | JGI25151J46595_101304581 | 69 |
| 169 | 3300003187 | JGI25151J46595_10168592 | JGI25151J46595_101685922 | 69 |
| 170 | 3300003354 | JGI25160J50197_1084271 | JGI25160J50197_10842712 | 69 |
| 171 | 3300003771 | Ga0055526_1005186 | Ga0055526_10051862 | 69 |
| 172 | 3300003773 | Ga0055537_1000246 | Ga0055537_10002468 | 69 |
| 173 | 3300003773 | Ga0055537_1024471 | Ga0055537_10244712 | 69 |
| 174 | 3300003775 | Ga0055524_1000083 | Ga0055524_100008387 | 69 |
| 175 | 3300003775 | Ga0055524_1009557 | Ga0055524_10095571 | 69 |
| 176 | 3300003775 | Ga0055524_1014274 | Ga0055524_10142742 | 69 |
| 177 | 3300003775 | Ga0055524_1076396 | Ga0055524_10763961 | 69 |
| 178 | 3300003781 | Ga0055536_1000594 | Ga0055536_10005945 | 69 |
| 179 | 3300003781 | Ga0055536_1000644 | Ga0055536_10006443 | 69 |
| 180 | 3300003781 | Ga0055536_1013314 | Ga0055536_10133143 | 69 |
| 181 | 3300003781 | Ga0055536_1022606 | Ga0055536_10226063 | 69 |
| 182 | 3300003781 | Ga0055536_1038392 | Ga0055536_10383922 | 69 |
| 183 | 3300003781 | Ga0055536_1040232 | Ga0055536_10402322 | 69 |
| 184 | 3300003781 | Ga0055536_1068568 | Ga0055536_10685681 | 69 |
| 185 | 3300003781 | Ga0055536_1089267 | Ga0055536_10892672 | 69 |
| 186 | 3300003784 | Ga0055534_1004416 | Ga0055534_10044164 | 69 |
| 187 | 3300003784 | Ga0055534_1038777 | Ga0055534_10387772 | 69 |
| 188 | 3300003784 | Ga0055534_1042630 | Ga0055534_10426302 | 69 |
| 189 | 3300003790 | Ga0055528_1000450 | Ga0055528_100045014 | 69 |
| 190 | 3300003790 | Ga0055528_1071910 | Ga0055528_10719101 | 69 |
| 191 | 3300003791 | Ga0055530_10000327 | Ga0055530_1000032712 | 69 |
| 192 | 3300003791 | Ga0055530_10001376 | Ga0055530_1000137612 | 69 |
| 193 | 3300003791 | Ga0055530_10053047 | Ga0055530_100530472 | 69 |
| 194 | 3300003792 | Ga0055540_1000012 | Ga0055540_100001286 | 69 |
| 195 | 3300003794 | Ga0055531_10002179 | Ga0055531_100021799 | 69 |
| 196 | 3300003794 | Ga0055531_10003025 | Ga0055531_1000302511 | 69 |
| 197 | 3300003794 | Ga0055531_10012688 | Ga0055531_100126884 | 69 |
| 198 | 3300003794 | Ga0055531_10013728 | Ga0055531_100137283 | 69 |
| 199 | 3300003794 | Ga0055531_10020404 | Ga0055531_100204044 | 69 |
| 200 | 3300003794 | Ga0055531_10031558 | Ga0055531_100315583 | 69 |
| 201 | 3300005262 | Ga0065165_1034884 | Ga0065165_10348842 | 69 |
| 202 | 3300005293 | Ga0065715_10443413 | Ga0065715_104434132 | 69 |
| 203 | 3300005327 | Ga0070658_10128975 | Ga0070658_101289753 | 69 |
| 204 | 3300005328 | Ga0070676_10001015 | Ga0070676_100010155 | 69 |
| 205 | 3300005328 | Ga0070676_10117667 | Ga0070676_101176671 | 69 |
| 206 | 3300005331 | Ga0070670_100134113 | Ga0070670_1001341133 | 69 |
| 207 | 3300005333 | Ga0070677_10008616 | Ga0070677_100086165 | 69 |
| 208 | 3300005334 | Ga0068869_100378176 | Ga0068869_1003781762 | 69 |
| 209 | 3300005335 | Ga0070666_10002718 | Ga0070666_100027185 | 69 |
| 210 | 3300005335 | Ga0070666_10169887 | Ga0070666_101698873 | 69 |
| 211 | 3300005335 | Ga0070666_10232044 | Ga0070666_102320442 | 69 |
| 212 | 3300005338 | Ga0068868_100005168 | Ga0068868_1000051687 | 69 |
| 213 | 3300005339 | Ga0070660_100490847 | Ga0070660_1004908472 | 69 |
| 214 | 3300005340 | Ga0070689_100069990 | Ga0070689_1000699902 | 69 |
| 215 | 3300005340 | Ga0070689_100794555 | Ga0070689_1007945551 | 69 |
| 216 | 3300005344 | Ga0070661_101028592 | Ga0070661_1010285922 | 69 |
| 217 | 3300005347 | Ga0070668_100237887 | Ga0070668_1002378874 | 69 |
| 218 | 3300005347 | Ga0070668_101005291 | Ga0070668_1010052912 | 69 |
| 219 | 3300005353 | Ga0070669_100821909 | Ga0070669_1008219093 | 69 |
| 220 | 3300005354 | Ga0070675_100006519 | Ga0070675_1000065197 | 69 |
| 221 | 3300005355 | Ga0070671_100007811 | Ga0070671_1000078115 | 69 |
| 222 | 3300005355 | Ga0070671_100014488 | Ga0070671_1000144888 | 69 |
| 223 | 3300005355 | Ga0070671_101307973 | Ga0070671_1013079732 | 69 |
| 224 | 3300005356 | Ga0070674_100008788 | Ga0070674_1000087883 | 69 |
| 225 | 3300005356 | Ga0070674_100023865 | Ga0070674_1000238655 | 69 |
| 226 | 3300005364 | Ga0070673_100038519 | Ga0070673_1000385195 | 69 |
| 227 | 3300005364 | Ga0070673_100109206 | Ga0070673_1001092063 | 69 |
| 228 | 3300005364 | Ga0070673_100445195 | Ga0070673_1004451954 | 69 |
| 229 | 3300005365 | Ga0070688_100058498 | Ga0070688_1000584982 | 69 |
| 230 | 3300005365 | Ga0070688_101412625 | Ga0070688_1014126251 | 69 |
| 231 | 3300005366 | Ga0070659_100131600 | Ga0070659_1001316003 | 69 |
| 232 | 3300005366 | Ga0070659_100931021 | Ga0070659_1009310212 | 69 |
| 233 | 3300005367 | Ga0070667_100006170 | Ga0070667_1000061704 | 69 |
| 234 | 3300005367 | Ga0070667_100145304 | Ga0070667_1001453042 | 69 |
| 235 | 3300005367 | Ga0070667_100307874 | Ga0070667_1003078744 | 69 |
| 236 | 3300005440 | Ga0070705_100936510 | Ga0070705_1009365102 | 69 |
| 237 | 3300005441 | Ga0070700_100189177 | Ga0070700_1001891773 | 69 |
| 238 | 3300005455 | Ga0070663_100805750 | Ga0070663_1008057501 | 69 |
| 239 | 3300005456 | Ga0070678_100008844 | Ga0070678_1000088447 | 69 |
| 240 | 3300005457 | Ga0070662_100002657 | Ga0070662_10000265714 | 69 |
| 241 | 3300005457 | Ga0070662_100172243 | Ga0070662_1001722433 | 69 |
| 242 | 3300005466 | Ga0070685_10109208 | Ga0070685_101092082 | 69 |
| 243 | 3300005530 | Ga0070679_100090724 | Ga0070679_1000907243 | 69 |
| 244 | 3300005543 | Ga0070672_100011211 | Ga0070672_1000112117 | 69 |
| 245 | 3300005544 | Ga0070686_100015980 | Ga0070686_1000159802 | 69 |
| 246 | 3300005544 | Ga0070686_101761810 | Ga0070686_1017618102 | 69 |
| 247 | 3300005548 | Ga0070665_100024410 | Ga0070665_1000244105 | 69 |
| 248 | 3300005548 | Ga0070665_100218678 | Ga0070665_1002186782 | 69 |
| 249 | 3300005548 | Ga0070665_100856041 | Ga0070665_1008560412 | 69 |
| 250 | 3300005549 | Ga0070704_102251289 | Ga0070704_1022512891 | 69 |
| 251 | 3300005564 | Ga0070664_100266267 | Ga0070664_1002662673 | 69 |
| 252 | 3300005577 | Ga0068857_100629203 | Ga0068857_1006292031 | 69 |
| 253 | 3300005577 | Ga0068857_100871183 | Ga0068857_1008711832 | 69 |
| 254 | 3300005578 | Ga0068854_100321731 | Ga0068854_1003217312 | 69 |
| 255 | 3300005578 | Ga0068854_101392731 | Ga0068854_1013927312 | 69 |
| 256 | 3300005616 | Ga0068852_101142323 | Ga0068852_1011423231 | 69 |
| 257 | 3300005617 | Ga0068859_100056929 | Ga0068859_1000569297 | 69 |
| 258 | 3300005617 | Ga0068859_100070884 | Ga0068859_1000708845 | 69 |
| 259 | 3300005618 | Ga0068864_102077594 | Ga0068864_1020775942 | 69 |
| 260 | 3300005719 | Ga0068861_100053995 | Ga0068861_1000539953 | 69 |
| 261 | 3300005840 | Ga0068870_10740182 | Ga0068870_107401822 | 69 |
| 262 | 3300005841 | Ga0068863_100070531 | Ga0068863_1000705313 | 69 |
| 263 | 3300005842 | Ga0068858_100006240 | Ga0068858_10000624012 | 69 |
| 264 | 3300005843 | Ga0068860_100050321 | Ga0068860_1000503212 | 69 |
| 265 | 3300005843 | Ga0068860_101282879 | Ga0068860_1012828791 | 69 |
| 266 | 3300005844 | Ga0068862_100027088 | Ga0068862_1000270886 | 69 |
| 267 | 3300006195 | Ga0075366_10377004 | Ga0075366_103770042 | 69 |
| 268 | 3300006846 | Ga0075430_101572543 | Ga0075430_1015725432 | 69 |
| 269 | 3300006881 | Ga0068865_100037434 | Ga0068865_1000374343 | 69 |
| 270 | 3300006881 | Ga0068865_100469335 | Ga0068865_1004693351 | 69 |
| 271 | 3300006881 | Ga0068865_100875948 | Ga0068865_1008759482 | 69 |
| 272 | 3300006914 | Ga0075436_101320120 | Ga0075436_1013201201 | 69 |
| 273 | 3300006931 | Ga0097620_100051392 | Ga0097620_1000513926 | 69 |
| 274 | 3300006931 | Ga0097620_100056929 | Ga0097620_1000569297 | 69 |
| 275 | 3300006931 | Ga0097620_100070885 | Ga0097620_1000708855 | 69 |
| 276 | 3300006946 | Ga0079104_1022531 | Ga0079104_10225314 | 69 |
| 277 | 3300009094 | Ga0111539_10133677 | Ga0111539_101336775 | 69 |
| 278 | 3300009101 | Ga0105247_10297317 | Ga0105247_102973175 | 69 |
| 279 | 3300009148 | Ga0105243_10504422 | Ga0105243_105044223 | 69 |
| 280 | 3300009174 | Ga0105241_12499536 | Ga0105241_124995362 | 69 |
| 281 | 3300009177 | Ga0105248_10014744 | Ga0105248_100147447 | 69 |
| 282 | 3300009177 | Ga0105248_10324090 | Ga0105248_103240903 | 69 |
| 283 | 3300009177 | Ga0105248_10495672 | Ga0105248_104956722 | 69 |
| 284 | 3300009553 | Ga0105249_11587069 | Ga0105249_115870692 | 69 |
| 285 | 3300009993 | Ga0105028_141959 | Ga0105028_1419591 | 69 |
| 286 | 3300010375 | Ga0105239_10864800 | Ga0105239_108648003 | 69 |
| 287 | 3300013105 | Ga0157369_10243788 | Ga0157369_102437883 | 69 |
| 288 | 3300013105 | Ga0157369_10924728 | Ga0157369_109247282 | 69 |
| 289 | 3300013296 | Ga0157374_11962328 | Ga0157374_119623282 | 69 |
| 290 | 3300013297 | Ga0157378_10106836 | Ga0157378_101068364 | 69 |
| 291 | 3300013308 | Ga0157375_11984894 | Ga0157375_119848942 | 69 |
| 292 | 3300014326 | Ga0157380_10024709 | Ga0157380_100247095 | 69 |
| 293 | 3300017792 | Ga0163161_10040001 | Ga0163161_100400013 | 69 |
| 294 | 3300025206 | Ga0209435_100001 | Ga0209435_100001538 | 69 |
| 295 | 3300025245 | Ga0207425_1005712 | Ga0207425_10057124 | 69 |
| 296 | 3300025245 | Ga0207425_1007315 | Ga0207425_10073153 | 69 |
| 297 | 3300025245 | Ga0207425_1020857 | Ga0207425_10208573 | 69 |
| 298 | 3300025245 | Ga0207425_1083092 | Ga0207425_10830922 | 69 |
| 299 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001907 | 69 |
| 300 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003538 | 69 |
| 301 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001538 | 69 |
| 302 | 3300025263 | Ga0209565_1000004 | Ga0209565_1000004667 | 69 |
| 303 | 3300025263 | Ga0209565_1000512 | Ga0209565_10005126 | 69 |
| 304 | 3300025273 | Ga0209673_1000074 | Ga0209673_1000074115 | 69 |
| 305 | 3300025284 | Ga0209130_1000303 | Ga0209130_100030335 | 69 |
| 306 | 3300025284 | Ga0209130_1003980 | Ga0209130_10039802 | 69 |
| 307 | 3300025284 | Ga0209130_1058724 | Ga0209130_10587241 | 69 |
| 308 | 3300025291 | Ga0209675_1000044 | Ga0209675_100004490 | 69 |
| 309 | 3300025291 | Ga0209675_1002583 | Ga0209675_10025833 | 69 |
| 310 | 3300025291 | Ga0209675_1011061 | Ga0209675_10110613 | 69 |
| 311 | 3300025291 | Ga0209675_1013155 | Ga0209675_10131552 | 69 |
| 312 | 3300025291 | Ga0209675_1059655 | Ga0209675_10596552 | 69 |
| 313 | 3300025291 | Ga0209675_1060746 | Ga0209675_10607462 | 69 |
| 314 | 3300025292 | Ga0209676_1000029 | Ga0209676_1000029234 | 69 |
| 315 | 3300025292 | Ga0209676_1001411 | Ga0209676_10014114 | 69 |
| 316 | 3300025292 | Ga0209676_1001529 | Ga0209676_10015297 | 69 |
| 317 | 3300025292 | Ga0209676_1002203 | Ga0209676_100220315 | 69 |
| 318 | 3300025292 | Ga0209676_1005904 | Ga0209676_10059044 | 69 |
| 319 | 3300025292 | Ga0209676_1006092 | Ga0209676_10060925 | 69 |
| 320 | 3300025292 | Ga0209676_1007204 | Ga0209676_10072046 | 69 |
| 321 | 3300025292 | Ga0209676_1110634 | Ga0209676_11106342 | 69 |
| 322 | 3300025294 | Ga0209025_1000562 | Ga0209025_100056234 | 69 |
| 323 | 3300025294 | Ga0209025_1005124 | Ga0209025_100512412 | 69 |
| 324 | 3300025294 | Ga0209025_1008130 | Ga0209025_10081308 | 69 |
| 325 | 3300025294 | Ga0209025_1032273 | Ga0209025_10322734 | 69 |
| 326 | 3300025294 | Ga0209025_1046191 | Ga0209025_10461912 | 69 |
| 327 | 3300025294 | Ga0209025_1064993 | Ga0209025_10649932 | 69 |
| 328 | 3300025294 | Ga0209025_1113131 | Ga0209025_11131312 | 69 |
| 329 | 3300025294 | Ga0209025_1143605 | Ga0209025_11436052 | 69 |
| 330 | 3300025294 | Ga0209025_1184491 | Ga0209025_11844912 | 69 |
| 331 | 3300025295 | Ga0209564_1000824 | Ga0209564_100082428 | 69 |
| 332 | 3300025295 | Ga0209564_1006639 | Ga0209564_10066394 | 69 |
| 333 | 3300025295 | Ga0209564_1067423 | Ga0209564_10674232 | 69 |
| 334 | 3300025297 | Ga0209758_1018098 | Ga0209758_10180984 | 69 |
| 335 | 3300025297 | Ga0209758_1067680 | Ga0209758_10676802 | 69 |
| 336 | 3300025297 | Ga0209758_1068524 | Ga0209758_10685242 | 69 |
| 337 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003296 | 69 |
| 338 | 3300025298 | Ga0209050_1001252 | Ga0209050_10012524 | 69 |
| 339 | 3300025298 | Ga0209050_1017396 | Ga0209050_10173963 | 69 |
| 340 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001300 | 69 |
| 341 | 3300025299 | Ga0209256_1000457 | Ga0209256_100045731 | 69 |
| 342 | 3300025299 | Ga0209256_1001133 | Ga0209256_100113319 | 69 |
| 343 | 3300025299 | Ga0209256_1001275 | Ga0209256_10012759 | 69 |
| 344 | 3300025299 | Ga0209256_1011883 | Ga0209256_10118833 | 69 |
| 345 | 3300025302 | Ga0207426_1001024 | Ga0207426_100102424 | 69 |
| 346 | 3300025302 | Ga0207426_1041745 | Ga0207426_10417452 | 69 |
| 347 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003296 | 69 |
| 348 | 3300025303 | Ga0209051_1019015 | Ga0209051_10190153 | 69 |
| 349 | 3300025304 | Ga0209257_1000018 | Ga0209257_1000018296 | 69 |
| 350 | 3300025304 | Ga0209257_1000065 | Ga0209257_1000065298 | 69 |
| 351 | 3300025304 | Ga0209257_1000529 | Ga0209257_100052923 | 69 |
| 352 | 3300025304 | Ga0209257_1000867 | Ga0209257_100086733 | 69 |
| 353 | 3300025304 | Ga0209257_1002673 | Ga0209257_10026733 | 69 |
| 354 | 3300025304 | Ga0209257_1003712 | Ga0209257_10037124 | 69 |
| 355 | 3300025304 | Ga0209257_1025478 | Ga0209257_10254783 | 69 |
| 356 | 3300025315 | Ga0207697_10045533 | Ga0207697_100455332 | 69 |
| 357 | 3300025893 | Ga0207682_10001150 | Ga0207682_1000115013 | 69 |
| 358 | 3300025900 | Ga0207710_10151999 | Ga0207710_101519992 | 69 |
| 359 | 3300025901 | Ga0207688_10093881 | Ga0207688_100938812 | 69 |
| 360 | 3300025903 | Ga0207680_10003652 | Ga0207680_100036526 | 69 |
| 361 | 3300025903 | Ga0207680_11038621 | Ga0207680_110386212 | 69 |
| 362 | 3300025904 | Ga0207647_10023953 | Ga0207647_100239533 | 69 |
| 363 | 3300025904 | Ga0207647_10517469 | Ga0207647_105174692 | 69 |
| 364 | 3300025907 | Ga0207645_10002195 | Ga0207645_1000219516 | 69 |
| 365 | 3300025908 | Ga0207643_10597641 | Ga0207643_105976412 | 69 |
| 366 | 3300025925 | Ga0207650_10004942 | Ga0207650_100049428 | 69 |
| 367 | 3300025926 | Ga0207659_10000660 | Ga0207659_1000066014 | 69 |
| 368 | 3300025931 | Ga0207644_10011457 | Ga0207644_100114574 | 69 |
| 369 | 3300025931 | Ga0207644_10127306 | Ga0207644_101273065 | 69 |
| 370 | 3300025932 | Ga0207690_10102928 | Ga0207690_101029283 | 69 |
| 371 | 3300025933 | Ga0207706_10000411 | Ga0207706_100004112 | 69 |
| 372 | 3300025936 | Ga0207670_10659930 | Ga0207670_106599302 | 69 |
| 373 | 3300025936 | Ga0207670_10700060 | Ga0207670_107000603 | 69 |
| 374 | 3300025937 | Ga0207669_10030882 | Ga0207669_100308824 | 69 |
| 375 | 3300025937 | Ga0207669_10384579 | Ga0207669_103845793 | 69 |
| 376 | 3300025938 | Ga0207704_10167186 | Ga0207704_101671862 | 69 |
| 377 | 3300025938 | Ga0207704_10461732 | Ga0207704_104617323 | 69 |
| 378 | 3300025940 | Ga0207691_10001753 | Ga0207691_1000175319 | 69 |
| 379 | 3300025940 | Ga0207691_10252954 | Ga0207691_102529543 | 69 |
| 380 | 3300025941 | Ga0207711_10000107 | Ga0207711_1000010764 | 69 |
| 381 | 3300025941 | Ga0207711_11219179 | Ga0207711_112191792 | 69 |
| 382 | 3300025960 | Ga0207651_10052252 | Ga0207651_100522522 | 69 |
| 383 | 3300025960 | Ga0207651_10079999 | Ga0207651_100799993 | 69 |
| 384 | 3300025960 | Ga0207651_11265125 | Ga0207651_112651252 | 69 |
| 385 | 3300025961 | Ga0207712_11772201 | Ga0207712_117722012 | 69 |
| 386 | 3300025972 | Ga0207668_10070880 | Ga0207668_100708805 | 69 |
| 387 | 3300025981 | Ga0207640_11124791 | Ga0207640_111247912 | 69 |
| 388 | 3300025986 | Ga0207658_10031446 | Ga0207658_100314465 | 69 |
| 389 | 3300025986 | Ga0207658_10047802 | Ga0207658_100478022 | 69 |
| 390 | 3300026023 | Ga0207677_10008220 | Ga0207677_100082204 | 69 |
| 391 | 3300026035 | Ga0207703_10004399 | Ga0207703_100043999 | 69 |
| 392 | 3300026041 | Ga0207639_11921681 | Ga0207639_119216812 | 69 |
| 393 | 3300026067 | Ga0207678_10141216 | Ga0207678_101412164 | 69 |
| 394 | 3300026075 | Ga0207708_10199069 | Ga0207708_101990692 | 69 |
| 395 | 3300026089 | Ga0207648_10065123 | Ga0207648_100651232 | 69 |
| 396 | 3300026089 | Ga0207648_11029895 | Ga0207648_110298952 | 69 |
| 397 | 3300026095 | Ga0207676_10094063 | Ga0207676_100940633 | 69 |
| 398 | 3300026095 | Ga0207676_12025886 | Ga0207676_120258862 | 69 |
| 399 | 3300026116 | Ga0207674_10877294 | Ga0207674_108772942 | 69 |
| 400 | 3300026118 | Ga0207675_100024020 | Ga0207675_1000240205 | 69 |
| 401 | 3300026121 | Ga0207683_10008349 | Ga0207683_1000834910 | 69 |
| 402 | 3300027111 | Ga0209281_1021783 | Ga0209281_10217833 | 69 |
| 403 | 3300027876 | Ga0209974_10266698 | Ga0209974_102666981 | 69 |
| 404 | 3300027907 | Ga0207428_10139810 | Ga0207428_101398102 | 69 |
| 405 | 3300028379 | Ga0268266_10016545 | Ga0268266_100165456 | 69 |
| 406 | 3300028379 | Ga0268266_10525311 | Ga0268266_105253113 | 69 |
| 407 | 3300028379 | Ga0268266_11023623 | Ga0268266_110236232 | 69 |
| 408 | 3300028380 | Ga0268265_10087728 | Ga0268265_100877284 | 69 |
| 409 | 3300028381 | Ga0268264_11120569 | Ga0268264_111205692 | 69 |
| 410 | 3300031239 | Ga0265328_10001954 | Ga0265328_100019546 | 69 |
| 411 | 3300031456 | Ga0307513_10000014 | Ga0307513_10000014211 | 69 |
| 412 | 3300031731 | Ga0307405_10107421 | Ga0307405_101074213 | 69 |
| 413 | 3300031852 | Ga0307410_11390335 | Ga0307410_113903351 | 69 |
| 414 | 3300031901 | Ga0307406_11110239 | Ga0307406_111102392 | 69 |
| 415 | 3300031911 | Ga0307412_10259764 | Ga0307412_102597641 | 69 |
| 416 | 3300031995 | Ga0307409_101057136 | Ga0307409_1010571361 | 69 |
| 417 | 3300032004 | Ga0307414_10754459 | Ga0307414_107544592 | 69 |
| 418 | 3300032126 | Ga0307415_100524567 | Ga0307415_1005245673 | 69 |
| 419 | 3300035241 | Ga0373961_0177790 | Ga0373961_0177790_463_678 | 69 |
| 420 | 3300037418 | Ga0395900_0759295 | Ga0395900_0759295_490_711 | 69 |
| 421 | 3300037471 | Ga0395905_0000533 | Ga0395905_0000533_24064_24285 | 69 |
| 422 | 3300037471 | Ga0395905_1043357 | Ga0395905_1043357_448_684 | 69 |
| 423 | 3300039093 | Ga0400489_22869 | Ga0400489_22869_4163_4387 | 69 |
| 424 | 3300041441 | Ga0451787_156676 | Ga0451787_156676_121_336 | 69 |
| 425 | 3300041443 | Ga0451789_0070028 | Ga0451789_0070028_55_270 | 69 |
| 426 | 3300041451 | Ga0451791_0699446 | Ga0451791_0699446_931_1146 | 69 |
| 427 | 3300041459 | Ga0451800_0019961 | Ga0451800_0019961_684_899 | 69 |
| 428 | 3300041460 | Ga0451802_0720684 | Ga0451802_0720684_463_684 | 69 |
| 429 | 3300041486 | Ga0451807_0059270 | Ga0451807_0059270_927_1142 | 69 |
| 430 | 3300041505 | Ga0451849_0779932 | Ga0451849_0779932_667_882 | 69 |
| 431 | 3300042007 | Ga0439449_0157779 | Ga0439449_0157779_163_393 | 69 |
| 432 | 3300042120 | Ga0450917_030607 | Ga0450917_030607_35_253 | 69 |
| 433 | 3300044693 | Ga0466961_0332552 | Ga0466961_0332552_423_644 | 69 |
| 434 | 3300044694 | Ga0466963_0889100 | Ga0466963_0889100_90_326 | 69 |
| 435 | 3300045976 | Ga0466967_1812719 | Ga0466967_1812719_243_479 | 69 |
| 436 | 3300046501 | Ga0495607_0000003 | Ga0495607_0000003_200820_201041 | 69 |
| 437 | 3300046507 | Ga0495606_0215568 | Ga0495606_0215568_126_341 | 69 |
| 438 | 3300046519 | Ga0495632_0390732 | Ga0495632_0390732_88_303 | 69 |
| 439 | 3300046525 | Ga0495663_0221647 | Ga0495663_0221647_204_419 | 69 |
| 440 | 3300046530 | Ga0495654_0288107 | Ga0495654_0288107_47_262 | 69 |
| 441 | 3300046542 | Ga0495597_0012259 | Ga0495597_0012259_968_1186 | 69 |
| 442 | 3300046616 | Ga0495668_0038259 | Ga0495668_0038259_2131_2346 | 69 |
| 443 | 3300046684 | Ga0495669_0004896 | Ga0495669_0004896_4869_5084 | 69 |
| 444 | 3300046684 | Ga0495669_0302960 | Ga0495669_0302960_450_668 | 69 |
| 445 | 3300046691 | Ga0495670_0786185 | Ga0495670_0786185_256_471 | 69 |
| 446 | 3300047472 | Ga0495686_0503579 | Ga0495686_0503579_186_401 | 69 |
| 447 | 3300048908 | Ga0496105_0198280 | Ga0496105_0198280_465_692 | 69 |
| 448 | 3300048909 | Ga0496106_0331918 | Ga0496106_0331918_474_695 | 69 |
| 449 | 3300048915 | Ga0496112_0152910 | Ga0496112_0152910_1321_1536 | 69 |
| 450 | 3300048916 | Ga0496113_0028066 | Ga0496113_0028066_1997_2224 | 69 |
| 451 | 3300048918 | Ga0496115_0000160 | Ga0496115_0000160_48585_48812 | 69 |
| 452 | 3300048919 | Ga0496116_0202881 | Ga0496116_0202881_404_625 | 69 |
| 453 | 3300048921 | Ga0496118_0009856 | Ga0496118_0009856_616_837 | 69 |
| 454 | 3300048924 | Ga0496121_0000264 | Ga0496121_0000264_66980_67201 | 69 |
| 455 | 3300048924 | Ga0496121_0464999 | Ga0496121_0464999_15_236 | 69 |
| 456 | 3300048925 | Ga0496122_0231167 | Ga0496122_0231167_291_512 | 69 |
| 457 | 3300048925 | Ga0496122_0428377 | Ga0496122_0428377_348_569 | 69 |
| 458 | 3300048926 | Ga0496123_0135608 | Ga0496123_0135608_1047_1268 | 69 |
| 459 | 3300049579 | Ga0501043_0001152 | Ga0501043_0001152_15356_15574 | 69 |
| 460 | 3300049585 | Ga0501069_0702256 | Ga0501069_0702256_54_272 | 69 |
| 461 | 3300049589 | Ga0501073_0260859 | Ga0501073_0260859_696_911 | 69 |
| 462 | 3300050490 | nmdc:mga03n38_292748_c1 | nmdc:mga03n38_292748_c1_303_518 | 69 |
| 463 | 3300050509 | nmdc:mga0qj67_1400586_c1 | nmdc:mga0qj67_1400586_c1_161_391 | 69 |
| 464 | 3300050511 | nmdc:mga08y16_125312_c1 | nmdc:mga08y16_125312_c1_1357_1575 | 69 |
| 465 | 3300053083 | Ga0495655_0001722 | Ga0495655_0001722_217_432 | 69 |
| 466 | 3300053088 | Ga0500644_0004238 | Ga0500644_0004238_1768_1983 | 69 |
| 467 | 3300053091 | Ga0500647_0072947 | Ga0500647_0072947_1053_1301 | 69 |
| 468 | 3300053093 | Ga0500651_0001739 | Ga0500651_0001739_3894_4109 | 69 |
| 469 | 3300053117 | Ga0500593_000922 | Ga0500593_000922_4878_5093 | 69 |
| 470 | 3300053129 | Ga0500628_001023 | Ga0500628_001023_3732_3947 | 69 |
| 471 | 3300053146 | Ga0500588_0433279 | Ga0500588_0433279_189_404 | 69 |
| 472 | 3300053151 | Ga0500604_0034442 | Ga0500604_0034442_395_610 | 69 |
| 473 | 3300053177 | Ga0500636_0434683 | Ga0500636_0434683_82_330 | 69 |
| 474 | 3300053730 | Ga0500645_000100 | Ga0500645_000100_59142_59357 | 69 |
| 475 | 3300055283 | Ga0500661_019605 | Ga0500661_019605_925_1140 | 69 |
| 476 | 3300005262 | Ga0065165_1000569 | Ga0065165_100056928 | 70 |
| 477 | 3300005327 | Ga0070658_10164698 | Ga0070658_101646983 | 70 |
| 478 | 3300005339 | Ga0070660_100612903 | Ga0070660_1006129031 | 70 |
| 479 | 3300005344 | Ga0070661_100047387 | Ga0070661_1000473873 | 70 |
| 480 | 3300005436 | Ga0070713_100895053 | Ga0070713_1008950532 | 70 |
| 481 | 3300005455 | Ga0070663_100235080 | Ga0070663_1002350803 | 70 |
| 482 | 3300005547 | Ga0070693_101010653 | Ga0070693_1010106531 | 70 |
| 483 | 3300005564 | Ga0070664_102166141 | Ga0070664_1021661411 | 70 |
| 484 | 3300005614 | Ga0068856_100889481 | Ga0068856_1008894813 | 70 |
| 485 | 3300005616 | Ga0068852_100486070 | Ga0068852_1004860701 | 70 |
| 486 | 3300005834 | Ga0068851_11102655 | Ga0068851_111026552 | 70 |
| 487 | 3300013105 | Ga0157369_10129097 | Ga0157369_101290973 | 70 |
| 488 | 3300013296 | Ga0157374_10306050 | Ga0157374_103060503 | 70 |
| 489 | 3300025321 | Ga0207656_10702563 | Ga0207656_107025632 | 70 |
| 490 | 3300025909 | Ga0207705_11401951 | Ga0207705_114019512 | 70 |
| 491 | 3300025919 | Ga0207657_10028736 | Ga0207657_100287365 | 70 |
| 492 | 3300025920 | Ga0207649_10050602 | Ga0207649_100506023 | 70 |
| 493 | 3300025929 | Ga0207664_10274257 | Ga0207664_102742572 | 70 |
| 494 | 3300026067 | Ga0207678_10261609 | Ga0207678_102616093 | 70 |
| 495 | 3300026078 | Ga0207702_10063649 | Ga0207702_100636493 | 70 |
| 496 | 3300026142 | Ga0207698_10042738 | Ga0207698_100427383 | 70 |
| 497 | 3300035170 | Ga0373943_0020237 | Ga0373943_0020237_2699_2944 | 70 |
| 498 | 3300035171 | Ga0373946_0320038 | Ga0373946_0320038_227_472 | 70 |
| 499 | 3300035692 | Ga0373935_1245088 | Ga0373935_1245088_67_312 | 70 |
| 500 | 3300035725 | Ga0373947_0223874 | Ga0373947_0223874_181_426 | 70 |
| 501 | 3300045976 | Ga0466967_0408933 | Ga0466967_0408933_137_394 | 70 |
| 502 | 3300001904 | JGI24736J21556_1051727 | JGI24736J21556_10517272 | 71 |
| 503 | 3300001989 | JGI24739J22299_10036301 | JGI24739J22299_100363013 | 71 |
| 504 | 3300001990 | JGI24737J22298_10128711 | JGI24737J22298_101287111 | 71 |
| 505 | 3300001991 | JGI24743J22301_10126232 | JGI24743J22301_101262321 | 71 |
| 506 | 3300005327 | Ga0070658_10006118 | Ga0070658_100061189 | 71 |
| 507 | 3300005328 | Ga0070676_10063840 | Ga0070676_100638403 | 71 |
| 508 | 3300005328 | Ga0070676_10815380 | Ga0070676_108153802 | 71 |
| 509 | 3300005330 | Ga0070690_100032003 | Ga0070690_1000320033 | 71 |
| 510 | 3300005330 | Ga0070690_100319354 | Ga0070690_1003193541 | 71 |
| 511 | 3300005331 | Ga0070670_100317916 | Ga0070670_1003179163 | 71 |
| 512 | 3300005335 | Ga0070666_10020041 | Ga0070666_100200411 | 71 |
| 513 | 3300005338 | Ga0068868_100003120 | Ga0068868_10000312012 | 71 |
| 514 | 3300005338 | Ga0068868_100137392 | Ga0068868_1001373921 | 71 |
| 515 | 3300005339 | Ga0070660_100734251 | Ga0070660_1007342512 | 71 |
| 516 | 3300005343 | Ga0070687_100995491 | Ga0070687_1009954911 | 71 |
| 517 | 3300005344 | Ga0070661_100546550 | Ga0070661_1005465502 | 71 |
| 518 | 3300005355 | Ga0070671_100089982 | Ga0070671_1000899822 | 71 |
| 519 | 3300005356 | Ga0070674_100116069 | Ga0070674_1001160693 | 71 |
| 520 | 3300005364 | Ga0070673_100005923 | Ga0070673_1000059234 | 71 |
| 521 | 3300005367 | Ga0070667_100204861 | Ga0070667_1002048613 | 71 |
| 522 | 3300005367 | Ga0070667_100514127 | Ga0070667_1005141271 | 71 |
| 523 | 3300005456 | Ga0070678_100026605 | Ga0070678_1000266055 | 71 |
| 524 | 3300005457 | Ga0070662_100002319 | Ga0070662_1000023197 | 71 |
| 525 | 3300005457 | Ga0070662_100973906 | Ga0070662_1009739062 | 71 |
| 526 | 3300005459 | Ga0068867_100024829 | Ga0068867_1000248293 | 71 |
| 527 | 3300005543 | Ga0070672_100159845 | Ga0070672_1001598453 | 71 |
| 528 | 3300005548 | Ga0070665_100072277 | Ga0070665_1000722774 | 71 |
| 529 | 3300005563 | Ga0068855_100612987 | Ga0068855_1006129873 | 71 |
| 530 | 3300005578 | Ga0068854_100827416 | Ga0068854_1008274161 | 71 |
| 531 | 3300005614 | Ga0068856_100041790 | Ga0068856_1000417904 | 71 |
| 532 | 3300005616 | Ga0068852_100027385 | Ga0068852_1000273852 | 71 |
| 533 | 3300005617 | Ga0068859_100035149 | Ga0068859_1000351492 | 71 |
| 534 | 3300005618 | Ga0068864_100058476 | Ga0068864_1000584761 | 71 |
| 535 | 3300005618 | Ga0068864_100351974 | Ga0068864_1003519742 | 71 |
| 536 | 3300005719 | Ga0068861_102110048 | Ga0068861_1021100481 | 71 |
| 537 | 3300005841 | Ga0068863_100022253 | Ga0068863_1000222533 | 71 |
| 538 | 3300005842 | Ga0068858_100089669 | Ga0068858_1000896694 | 71 |
| 539 | 3300005843 | Ga0068860_100166753 | Ga0068860_1001667533 | 71 |
| 540 | 3300006237 | Ga0097621_100271850 | Ga0097621_1002718503 | 71 |
| 541 | 3300006358 | Ga0068871_100054690 | Ga0068871_1000546903 | 71 |
| 542 | 3300006881 | Ga0068865_100023365 | Ga0068865_1000233651 | 71 |
| 543 | 3300006931 | Ga0097620_100035149 | Ga0097620_1000351492 | 71 |
| 544 | 3300009093 | Ga0105240_11960216 | Ga0105240_119602161 | 71 |
| 545 | 3300009098 | Ga0105245_10029216 | Ga0105245_100292164 | 71 |
| 546 | 3300009101 | Ga0105247_10042611 | Ga0105247_100426111 | 71 |
| 547 | 3300009174 | Ga0105241_10109722 | Ga0105241_101097222 | 71 |
| 548 | 3300009176 | Ga0105242_10173509 | Ga0105242_101735094 | 71 |
| 549 | 3300009177 | Ga0105248_10171293 | Ga0105248_101712932 | 71 |
| 550 | 3300009177 | Ga0105248_11433382 | Ga0105248_114333822 | 71 |
| 551 | 3300009551 | Ga0105238_10010489 | Ga0105238_1001048912 | 71 |
| 552 | 3300010375 | Ga0105239_13090962 | Ga0105239_130909622 | 71 |
| 553 | 3300011119 | Ga0105246_10440689 | Ga0105246_104406892 | 71 |
| 554 | 3300013102 | Ga0157371_10017862 | Ga0157371_100178624 | 71 |
| 555 | 3300013105 | Ga0157369_10079417 | Ga0157369_100794173 | 71 |
| 556 | 3300013296 | Ga0157374_10154744 | Ga0157374_101547443 | 71 |
| 557 | 3300013296 | Ga0157374_10228049 | Ga0157374_102280491 | 71 |
| 558 | 3300013297 | Ga0157378_10060761 | Ga0157378_100607612 | 71 |
| 559 | 3300013297 | Ga0157378_10989859 | Ga0157378_109898592 | 71 |
| 560 | 3300013297 | Ga0157378_12374387 | Ga0157378_123743872 | 71 |
| 561 | 3300013306 | Ga0163162_10309432 | Ga0163162_103094321 | 71 |
| 562 | 3300013306 | Ga0163162_11881307 | Ga0163162_118813072 | 71 |
| 563 | 3300013308 | Ga0157375_10071528 | Ga0157375_100715283 | 71 |
| 564 | 3300014325 | Ga0163163_10042167 | Ga0163163_100421673 | 71 |
| 565 | 3300014745 | Ga0157377_10011511 | Ga0157377_100115116 | 71 |
| 566 | 3300014968 | Ga0157379_10037397 | Ga0157379_100373973 | 71 |
| 567 | 3300014969 | Ga0157376_10266483 | Ga0157376_102664833 | 71 |
| 568 | 3300015265 | Ga0182005_1139568 | Ga0182005_11395681 | 71 |
| 569 | 3300025315 | Ga0207697_10313158 | Ga0207697_103131582 | 71 |
| 570 | 3300025321 | Ga0207656_10021329 | Ga0207656_100213294 | 71 |
| 571 | 3300025904 | Ga0207647_10001683 | Ga0207647_100016833 | 71 |
| 572 | 3300025904 | Ga0207647_10092516 | Ga0207647_100925162 | 71 |
| 573 | 3300025907 | Ga0207645_10993268 | Ga0207645_109932682 | 71 |
| 574 | 3300025908 | Ga0207643_10200001 | Ga0207643_102000012 | 71 |
| 575 | 3300025909 | Ga0207705_10919818 | Ga0207705_109198182 | 71 |
| 576 | 3300025920 | Ga0207649_10572418 | Ga0207649_105724182 | 71 |
| 577 | 3300025924 | Ga0207694_11758669 | Ga0207694_117586692 | 71 |
| 578 | 3300025927 | Ga0207687_10013818 | Ga0207687_100138184 | 71 |
| 579 | 3300025927 | Ga0207687_10833225 | Ga0207687_108332252 | 71 |
| 580 | 3300025931 | Ga0207644_10000230 | Ga0207644_1000023019 | 71 |
| 581 | 3300025934 | Ga0207686_10108982 | Ga0207686_101089824 | 71 |
| 582 | 3300025937 | Ga0207669_11762892 | Ga0207669_117628922 | 71 |
| 583 | 3300025938 | Ga0207704_10032281 | Ga0207704_100322814 | 71 |
| 584 | 3300025940 | Ga0207691_10012591 | Ga0207691_100125915 | 71 |
| 585 | 3300025941 | Ga0207711_10002164 | Ga0207711_100021644 | 71 |
| 586 | 3300025941 | Ga0207711_10033835 | Ga0207711_100338351 | 71 |
| 587 | 3300025960 | Ga0207651_10001783 | Ga0207651_100017834 | 71 |
| 588 | 3300025981 | Ga0207640_10299463 | Ga0207640_102994632 | 71 |
| 589 | 3300025986 | Ga0207658_12137349 | Ga0207658_121373492 | 71 |
| 590 | 3300026023 | Ga0207677_10004992 | Ga0207677_100049922 | 71 |
| 591 | 3300026023 | Ga0207677_10021663 | Ga0207677_100216635 | 71 |
| 592 | 3300026035 | Ga0207703_10041032 | Ga0207703_100410325 | 71 |
| 593 | 3300026035 | Ga0207703_12200841 | Ga0207703_122008412 | 71 |
| 594 | 3300026088 | Ga0207641_10004516 | Ga0207641_100045169 | 71 |
| 595 | 3300026089 | Ga0207648_10027513 | Ga0207648_100275134 | 71 |
| 596 | 3300026095 | Ga0207676_10421976 | Ga0207676_104219762 | 71 |
| 597 | 3300026095 | Ga0207676_12011526 | Ga0207676_120115262 | 71 |
| 598 | 3300026121 | Ga0207683_10010591 | Ga0207683_100105914 | 71 |
| 599 | 3300026142 | Ga0207698_10059107 | Ga0207698_100591072 | 71 |
| 600 | 3300028379 | Ga0268266_11314845 | Ga0268266_113148453 | 71 |
| 601 | 3300028381 | Ga0268264_10971196 | Ga0268264_109711962 | 71 |
| 602 | 3300035121 | Ga0373960_0123907 | Ga0373960_0123907_552_788 | 71 |
| 603 | 3300035691 | Ga0373931_0148761 | Ga0373931_0148761_452_688 | 71 |
| 604 | 3300035692 | Ga0373935_0091061 | Ga0373935_0091061_1487_1714 | 71 |
| 605 | 3300048903 | Ga0496100_0001736 | Ga0496100_0001736_5879_6115 | 71 |
| 606 | 3300048904 | Ga0496101_0000533 | Ga0496101_0000533_17048_17284 | 71 |
| 607 | 3300048907 | Ga0496104_0387831 | Ga0496104_0387831_238_474 | 71 |
| 608 | 3300048908 | Ga0496105_0022052 | Ga0496105_0022052_2496_2732 | 71 |
| 609 | 3300048910 | Ga0496107_0032591 | Ga0496107_0032591_3174_3410 | 71 |
| 610 | 3300048911 | Ga0496108_0001094 | Ga0496108_0001094_5209_5445 | 71 |
| 611 | 3300048912 | Ga0496109_0188515 | Ga0496109_0188515_992_1228 | 71 |
| 612 | 3300048913 | Ga0496110_0000347 | Ga0496110_0000347_13868_14104 | 71 |
| 613 | 3300048914 | Ga0496111_0005235 | Ga0496111_0005235_710_946 | 71 |
| 614 | 3300048915 | Ga0496112_0001900 | Ga0496112_0001900_5209_5445 | 71 |
| 615 | 3300048917 | Ga0496114_0431851 | Ga0496114_0431851_167_403 | 71 |
| 616 | 3300049582 | Ga0501048_1015270 | Ga0501048_1015270_207_524 | 71 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bs3-assembly1.cif.gz_A-2 | crystal structure of a putative dna-binding protein from bacteroides fragilis | 0.9366 | 3 | 64 |
| 3bs3-assembly1.cif.gz_A-2 | crystal structure of a putative dna-binding protein from bacteroides fragilis | 0.9084 | 3 | 64 |
| 3f51-assembly1.cif.gz_A | crystal structure of the clp gene regulator clgr from corynebacterium glutamicum | 0.8968 | 6 | 61 |
| 3kxa-assembly2.cif.gz_D | crystal structure of ngo0477 from neisseria gonorrhoeae | 0.894 | 10 | 61 |
| 2xj3-assembly1.cif.gz_B | high resolution structure of the t55c mutant of cylr2. | 0.8933 | 4 | 67 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f51A00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8968 | 6 | 61 | 1.10.260.40 |
| 3f51C00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8886 | 6 | 61 | 1.10.260.40 |
| 3f52E00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8807 | 6 | 61 | 1.10.260.40 |
| 2axuB01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8747 | 7 | 61 | 1.10.260.40 |
| 3zkcB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8738 | 6 | 60 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U4QB68-F1-model_v4 | XRE family transcriptional regulator | 0.9873 | 3 | 68 |
GO:0003677
GO:0016020 |
| AF-A0A1W9IL55-F1-model_v4 | deleted | 0.9867 | 1 | 68 |
|
| AF-A0A2E7F2W9-F1-model_v4 | Cro/Cl family transcriptional regulator | 0.9795 | 3 | 66 |
GO:0003677
|
| AF-A0A1I1SD26-F1-model_v4 | Putative transcriptional regulator | 0.9783 | 1 | 67 |
GO:0003677
|
| AF-A0A5C1B701-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9764 | 1 | 68 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar