F469501

General Info

Members Datasets Scaffolds Average Seq Length
616 248 1232 275

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10319266|Ga0065715_103192661
Length 302
Sequence MAADRGPGITTEHHAADEKGVLRPDSPLNLLPFVLYAAAVVVYAIHFAKRQPSVGRLATTFLLLGVLAHTFVIGMQTMEVRHVPFSNTSTAVSSFVWMLALSYLYLEVTTDERAMGVFIVPILVGLQAIPVLYPGVDYRDPVLDSPWFWVHVTSLLFAYATFALAAMLGLTYVLQFKEIKKKHLGYFYTRLPSLHVLDAMNSRAVAVGWLFLTIGVVVGIVWAAQALALSPNNSNLQAMSLQDPKVFIAVLTWAVYSFAMFARKTLGWTGRRAAWLSALGFVIVLLNLLPVSYFVTTSHTFQ

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
177 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
185 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
226 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 0
Rhizosphere 99.03
Stem 0
Stem Tuber 0
Unclassified 11.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10319266 3300005293 Bacteria 975
2 JGI25406J46586_10000685 3300003203 Bacteria 15749
3 JGI25406J46586_10028533 3300003203 Bacteria 2125
4 Ga0065704_10109354 3300005289 Unclassified 2005
5 Ga0065712_10004551 3300005290 Bacteria 6135
6 Ga0065712_10014577 3300005290 Bacteria 1568
7 Ga0065715_10038350 3300005293 Bacteria 1560
8 Ga0065715_10040723 3300005293 Bacteria 1502
9 Ga0065715_10199772 3300005293 Bacteria 1368
10 Ga0065707_10003557 3300005295 Bacteria 5009
11 Ga0065707_10090353 3300005295 Bacteria 4133
12 Ga0065707_10120983 3300005295 Unclassified 2121
13 Ga0065707_10146589 3300005295 Unclassified 1707
14 Ga0070676_10005873 3300005328 Bacteria 6553
15 Ga0070676_10026278 3300005328 Bacteria 3296
16 Ga0070676_10090193 3300005328 Bacteria 1876
17 Ga0070683_100204581 3300005329 Bacteria 1875
18 Ga0070690_100003187 3300005330 Bacteria 8948
19 Ga0070670_100000819 3300005331 Bacteria 24249
20 Ga0070670_100003566 3300005331 Bacteria 12942
21 Ga0070670_100004718 3300005331 Bacteria 11438
22 Ga0070670_100026389 3300005331 Bacteria 5000
23 Ga0070670_100064459 3300005331 Bacteria 3143
24 Ga0070677_10016045 3300005333 Bacteria 2662
25 Ga0070677_10071506 3300005333 Bacteria 1460
26 Ga0070677_10125236 3300005333 Bacteria 1166
27 Ga0068869_100002749 3300005334 Bacteria 10651
28 Ga0068869_100066403 3300005334 Bacteria 2657
29 Ga0068869_100204416 3300005334 Archaea 1559
30 Ga0068869_100319406 3300005334 Bacteria 1259
31 Ga0070666_10035439 3300005335 Bacteria 3309
32 Ga0070666_10068568 3300005335 Bacteria 2410
33 Ga0070666_10100045 3300005335 Bacteria 1997
34 Ga0070680_100095772 3300005336 Bacteria 2461
35 Ga0068868_100575638 3300005338 Unclassified 995
36 Ga0070689_100016177 3300005340 Bacteria 5456
37 Ga0070689_100064713 3300005340 Bacteria 2847
38 Ga0070691_10160088 3300005341 Bacteria 1160
39 Ga0070687_100072601 3300005343 Bacteria 1852
40 Ga0070687_100159969 3300005343 Bacteria 1330
41 Ga0070661_100182153 3300005344 Bacteria 1599
42 Ga0070661_100203611 3300005344 Bacteria 1513
43 Ga0070692_10038480 3300005345 Bacteria 2438
44 Ga0070668_100044665 3300005347 Unclassified 3399
45 Ga0070668_100087881 3300005347 Bacteria 2446
46 Ga0070669_100012135 3300005353 Bacteria 6115
47 Ga0070669_100027874 3300005353 Bacteria 4066
48 Ga0070669_100065566 3300005353 Bacteria 2675
49 Ga0070675_100005874 3300005354 Bacteria 9403
50 Ga0070675_100023934 3300005354 Bacteria 4887
51 Ga0070675_100047037 3300005354 Bacteria 3534
52 Ga0070675_100126637 3300005354 Bacteria 2173
53 Ga0070675_100143080 3300005354 Bacteria 2045
54 Ga0070675_100162155 3300005354 Bacteria 1923
55 Ga0070675_100166169 3300005354 Bacteria 1900
56 Ga0070675_100430164 3300005354 Bacteria 1181
57 Ga0070671_100009589 3300005355 Bacteria 7779
58 Ga0070671_100027528 3300005355 Bacteria 4679
59 Ga0070671_100077826 3300005355 Bacteria 2772
60 Ga0070674_100001990 3300005356 Bacteria 11187
61 Ga0070674_100014554 3300005356 Bacteria 4893
62 Ga0070674_100117431 3300005356 Bacteria 1964
63 Ga0070673_100008431 3300005364 Bacteria 6854
64 Ga0070673_100015932 3300005364 Bacteria 5296
65 Ga0070673_100017452 3300005364 Bacteria 5105
66 Ga0070673_100038401 3300005364 Bacteria 3656
67 Ga0070673_100043913 3300005364 Bacteria 3458
68 Ga0070673_100142277 3300005364 Bacteria 2025
69 Ga0070673_100223029 3300005364 Bacteria 1632
70 Ga0070673_100329486 3300005364 Bacteria 1350
71 Ga0070688_100019367 3300005365 Bacteria 3941
72 Ga0070688_100053563 3300005365 Bacteria 2524
73 Ga0070688_100058025 3300005365 Bacteria 2436
74 Ga0070659_100375534 3300005366 Bacteria 1197
75 Ga0070667_100085651 3300005367 Bacteria 2703
76 Ga0070701_10004347 3300005438 Bacteria 5724
77 Ga0070701_10010836 3300005438 Bacteria 4048
78 Ga0070701_10019430 3300005438 Bacteria 3209
79 Ga0070711_100025619 3300005439 Bacteria 3861
80 Ga0070705_100000166 3300005440 Bacteria 38328
81 Ga0070705_100153012 3300005440 Bacteria 1532
82 Ga0070705_100221620 3300005440 Bacteria 1310
83 Ga0070700_100003485 3300005441 Bacteria 8116
84 Ga0070694_100000901 3300005444 Bacteria 16782
85 Ga0070694_100009686 3300005444 Bacteria 5917
86 Ga0070694_100396740 3300005444 Bacteria 1079
87 Ga0070708_100261215 3300005445 Bacteria 1628
88 Ga0070678_100107417 3300005456 Unclassified 2177
89 Ga0070678_100226780 3300005456 Bacteria 1555
90 Ga0070678_100353096 3300005456 Bacteria 1265
91 Ga0070678_100354936 3300005456 Bacteria 1262
92 Ga0070662_100046883 3300005457 Unclassified 3106
93 Ga0070681_10001438 3300005458 Bacteria 20959
94 Ga0068867_100080641 3300005459 Bacteria 2451
95 Ga0068867_100194911 3300005459 Bacteria 1619
96 Ga0070685_10010067 3300005466 Unclassified 4905
97 Ga0070685_10027146 3300005466 Bacteria 3162
98 Ga0070706_100446901 3300005467 Bacteria 1203
99 Ga0070707_100016552 3300005468 Bacteria 6920
100 Ga0070698_100006504 3300005471 Bacteria 12673
101 Ga0070698_100063678 3300005471 Bacteria 3718
102 Ga0070698_100392502 3300005471 Bacteria 1321
103 Ga0070699_100000940 3300005518 Bacteria 27190
104 Ga0070699_100005549 3300005518 Bacteria 11060
105 Ga0070699_100009342 3300005518 Bacteria 8493
106 Ga0070699_100015825 3300005518 Bacteria 6475
107 Ga0070679_100137632 3300005530 Unclassified 2423
108 Ga0070697_100132524 3300005536 Bacteria 2091
109 Ga0070697_100221198 3300005536 Bacteria 1614
110 Ga0070697_100350087 3300005536 Bacteria 1276
111 Ga0070672_100015233 3300005543 Bacteria 5468
112 Ga0070672_100026827 3300005543 Bacteria 4292
113 Ga0070672_100107253 3300005543 Unclassified 2273
114 Ga0070672_100131730 3300005543 Bacteria 2056
115 Ga0070672_100191557 3300005543 Bacteria 1707
116 Ga0070686_100224803 3300005544 Bacteria 1358
117 Ga0070695_100000441 3300005545 Bacteria 21600
118 Ga0070695_100010029 3300005545 Bacteria 5650
119 Ga0070695_100047133 3300005545 Bacteria 2752
120 Ga0070695_100141106 3300005545 Bacteria 1671
121 Ga0070696_100000485 3300005546 Bacteria 25001
122 Ga0070696_100006763 3300005546 Bacteria 7656
123 Ga0070696_100035350 3300005546 Bacteria 3439
124 Ga0070665_100066038 3300005548 Bacteria 3629
125 Ga0070704_100001578 3300005549 Bacteria 12303
126 Ga0070704_100084181 3300005549 Bacteria 2350
127 Ga0070704_100118134 3300005549 Bacteria 2031
128 Ga0070704_100123081 3300005549 Bacteria 1996
129 Ga0070704_100237851 3300005549 Unclassified 1489
130 Ga0070664_100009651 3300005564 Bacteria 7828
131 Ga0070664_100013014 3300005564 Bacteria 6770
132 Ga0070664_100082132 3300005564 Bacteria 2778
133 Ga0070664_100245928 3300005564 Bacteria 1607
134 Ga0070664_100265205 3300005564 Bacteria 1546
135 Ga0068857_100447088 3300005577 Unclassified 1208
136 Ga0070702_100023410 3300005615 Unclassified 3282
137 Ga0070702_100054343 3300005615 Bacteria 2304
138 Ga0068859_100018328 3300005617 Bacteria 7038
139 Ga0068859_100134718 3300005617 Bacteria 2542
140 Ga0068859_100330362 3300005617 Bacteria 1619
141 Ga0068864_100039896 3300005618 Bacteria 4014
142 Ga0068864_100085861 3300005618 Bacteria 2768
143 Ga0068864_100097663 3300005618 Bacteria 2601
144 Ga0068864_100230554 3300005618 Bacteria 1712
145 Ga0068864_100299939 3300005618 Bacteria 1504
146 Ga0068866_10006036 3300005718 Bacteria 5041
147 Ga0068861_100004743 3300005719 Bacteria 9139
148 Ga0068851_10013709 3300005834 Bacteria 3838
149 Ga0068870_10019623 3300005840 Bacteria 3281
150 Ga0068870_10048462 3300005840 Bacteria 2237
151 Ga0068870_10053317 3300005840 Bacteria 2147
152 Ga0068870_10113520 3300005840 Bacteria 1550
153 Ga0068870_10116229 3300005840 Bacteria 1534
154 Ga0068863_100062374 3300005841 Bacteria 3525
155 Ga0068863_100064606 3300005841 Unclassified 3461
156 Ga0068858_100079981 3300005842 Unclassified 3037
157 Ga0068860_100015442 3300005843 Bacteria 7459
158 Ga0068860_100039685 3300005843 Bacteria 4503
159 Ga0068862_100000830 3300005844 Bacteria 30619
160 Ga0068862_100090152 3300005844 Bacteria 2668
161 Ga0068862_100360423 3300005844 Bacteria 1351
162 Ga0068862_100632321 3300005844 Bacteria 1031
163 Ga0081539_10000024 3300005985 Bacteria 354702
164 Ga0081539_10000228 3300005985 Bacteria 131823
165 Ga0081539_10144201 3300005985 Bacteria 1153
166 Ga0070715_10102906 3300006163 Bacteria 1335
167 Ga0075367_10166088 3300006178 Bacteria 1374
168 Ga0097621_100020470 3300006237 Bacteria 5098
169 Ga0097621_100063036 3300006237 Bacteria 3045
170 Ga0097621_100146964 3300006237 Bacteria 2019
171 Ga0068871_100157999 3300006358 Bacteria 1937
172 Ga0075428_100000575 3300006844 Bacteria 37520
173 Ga0075428_100001239 3300006844 Bacteria 27284
174 Ga0075428_100004257 3300006844 Bacteria 15746
175 Ga0075428_100013027 3300006844 Bacteria 9242
176 Ga0075428_100028511 3300006844 Bacteria 6177
177 Ga0075428_100110524 3300006844 Bacteria 2994
178 Ga0075430_100000443 3300006846 Bacteria 30826
179 Ga0075430_100011913 3300006846 Bacteria 7403
180 Ga0075430_100025956 3300006846 Bacteria 4986
181 Ga0075430_100038651 3300006846 Bacteria 4042
182 Ga0075430_100046913 3300006846 Unclassified 3648
183 Ga0075430_100054238 3300006846 Bacteria 3373
184 Ga0075430_100061600 3300006846 Bacteria 3153
185 Ga0075431_100006383 3300006847 Bacteria 11704
186 Ga0075431_100014769 3300006847 Bacteria 7906
187 Ga0075431_100028144 3300006847 Bacteria 5771
188 Ga0075431_100051692 3300006847 Bacteria 4237
189 Ga0075431_100089607 3300006847 Bacteria 3175
190 Ga0075433_10001107 3300006852 Bacteria 19455
191 Ga0075433_10002869 3300006852 Bacteria 13209
192 Ga0075433_10552967 3300006852 Unclassified 1012
193 Ga0075434_100006359 3300006871 Bacteria 10828
194 Ga0075434_100008470 3300006871 Bacteria 9566
195 Ga0075434_100015165 3300006871 Bacteria 7383
196 Ga0075434_100021899 3300006871 Bacteria 6221
197 Ga0075434_100145476 3300006871 Bacteria 2390
198 Ga0075434_100476378 3300006871 Unclassified 1269
199 Ga0075429_100015925 3300006880 Bacteria 6511
200 Ga0075429_100040454 3300006880 Bacteria 4059
201 Ga0075429_100141306 3300006880 Bacteria 2107
202 Ga0075429_100155158 3300006880 Unclassified 2005
203 Ga0075429_100183539 3300006880 Bacteria 1833
204 Ga0068865_100053027 3300006881 Bacteria 2813
205 Ga0068865_100197337 3300006881 Bacteria 1560
206 Ga0097620_100018328 3300006931 Bacteria 7038
207 Ga0097620_100134712 3300006931 Bacteria 2542
208 Ga0097620_100330382 3300006931 Bacteria 1619
209 Ga0075435_100008922 3300007076 Bacteria 7227
210 Ga0075435_100030812 3300007076 Bacteria 4221
211 Ga0075435_100042035 3300007076 Bacteria 3655
212 Ga0075435_100097934 3300007076 Bacteria 2428
213 Ga0075435_100199290 3300007076 Bacteria 1696
214 Ga0111539_10002473 3300009094 Bacteria 24507
215 Ga0111539_10002628 3300009094 Bacteria 23814
216 Ga0111539_10003133 3300009094 Bacteria 21884
217 Ga0111539_10006678 3300009094 Bacteria 14860
218 Ga0111539_10014731 3300009094 Bacteria 9754
219 Ga0111539_10014891 3300009094 Bacteria 9693
220 Ga0111539_10038294 3300009094 Bacteria 5784
221 Ga0111539_10062311 3300009094 Bacteria 4416
222 Ga0111539_10133675 3300009094 Bacteria 2904
223 Ga0111539_10141124 3300009094 Bacteria 2820
224 Ga0111539_10315579 3300009094 Bacteria 1819
225 Ga0111539_10428843 3300009094 Unclassified 1540
226 Ga0111539_10450226 3300009094 Bacteria 1499
227 Ga0105245_10830867 3300009098 Bacteria 963
228 Ga0114129_10001192 3300009147 Bacteria 34525
229 Ga0114129_10003620 3300009147 Bacteria 21735
230 Ga0114129_10009597 3300009147 Bacteria 13803
231 Ga0114129_10032027 3300009147 Bacteria 7432
232 Ga0114129_10033467 3300009147 Bacteria 7264
233 Ga0114129_10041883 3300009147 Bacteria 6448
234 Ga0114129_10053877 3300009147 Bacteria 5641
235 Ga0114129_10185861 3300009147 Unclassified 2824
236 Ga0114129_10249128 3300009147 Bacteria 2385
237 Ga0114129_10390088 3300009147 Bacteria 1837
238 Ga0114129_10889220 3300009147 Bacteria 1129
239 Ga0105243_10039456 3300009148 Bacteria 3680
240 Ga0105243_10277123 3300009148 Unclassified 1509
241 Ga0105243_10590854 3300009148 Unclassified 1067
242 Ga0105242_10431805 3300009176 Unclassified 1237
243 Ga0105248_10461715 3300009177 Bacteria 1431
244 Ga0105248_10542072 3300009177 Unclassified 1312
245 Ga0105238_10004828 3300009551 Bacteria 13339
246 Ga0105249_10002507 3300009553 Bacteria 15870
247 Ga0105249_10013872 3300009553 Bacteria 7122
248 Ga0105249_10420249 3300009553 Unclassified 1370
249 Ga0105246_10023687 3300011119 Bacteria 3976
250 Ga0157371_10092689 3300013102 Unclassified 2140
251 Ga0157374_10016677 3300013296 Bacteria 6462
252 Ga0157378_10340277 3300013297 Unclassified 1463
253 Ga0163162_10002177 3300013306 Bacteria 18385
254 Ga0163162_10063942 3300013306 Bacteria 3724
255 Ga0157375_10093097 3300013308 Bacteria 3079
256 Ga0157375_10202486 3300013308 Bacteria 2141
257 Ga0157375_10363097 3300013308 Bacteria 1614
258 Ga0157375_10393280 3300013308 Unclassified 1553
259 Ga0157375_10798153 3300013308 Unclassified 1093
260 Ga0163163_10002928 3300014325 Bacteria 14441
261 Ga0163163_10006980 3300014325 Bacteria 9923
262 Ga0163163_10051055 3300014325 Bacteria 4076
263 Ga0163163_10095187 3300014325 Bacteria 2997
264 Ga0157380_10027360 3300014326 Bacteria 4337
265 Ga0157380_10029039 3300014326 Unclassified 4225
266 Ga0157380_10038014 3300014326 Unclassified 3735
267 Ga0157380_10074504 3300014326 Bacteria 2756
268 Ga0157380_10212152 3300014326 Bacteria 1726
269 Ga0157377_10003109 3300014745 Bacteria 7467
270 Ga0157377_10110019 3300014745 Unclassified 1655
271 Ga0157379_10072759 3300014968 Bacteria 3076
272 Ga0163161_10354179 3300017792 Bacteria 1167
273 Ga0207697_10001259 3300025315 Bacteria 13903
274 Ga0207697_10044788 3300025315 Bacteria 1821
275 Ga0207653_10027914 3300025885 Bacteria 1813
276 Ga0207682_10009375 3300025893 Bacteria 3865
277 Ga0207682_10015234 3300025893 Bacteria 2993
278 Ga0207682_10115159 3300025893 Bacteria 1187
279 Ga0207682_10129189 3300025893 Bacteria 1127
280 Ga0207642_10002359 3300025899 Bacteria 5886
281 Ga0207688_10000413 3300025901 Bacteria 20074
282 Ga0207680_10025772 3300025903 Bacteria 3248
283 Ga0207680_10061328 3300025903 Bacteria 2293
284 Ga0207680_10118990 3300025903 Unclassified 1725
285 Ga0207680_10148135 3300025903 Bacteria 1562
286 Ga0207647_10099111 3300025904 Bacteria 1731
287 Ga0207645_10009831 3300025907 Bacteria 6595
288 Ga0207645_10018608 3300025907 Bacteria 4564
289 Ga0207645_10061212 3300025907 Bacteria 2404
290 Ga0207645_10239620 3300025907 Bacteria 1198
291 Ga0207643_10001360 3300025908 Bacteria 14114
292 Ga0207643_10006585 3300025908 Bacteria 6228
293 Ga0207643_10035356 3300025908 Bacteria 2801
294 Ga0207643_10054427 3300025908 Bacteria 2274
295 Ga0207643_10062238 3300025908 Bacteria 2132
296 Ga0207643_10140066 3300025908 Bacteria 1444
297 Ga0207684_10065429 3300025910 Bacteria 3087
298 Ga0207707_10033508 3300025912 Bacteria 4495
299 Ga0207660_10230080 3300025917 Bacteria 1457
300 Ga0207662_10002508 3300025918 Bacteria 9228
301 Ga0207662_10046255 3300025918 Bacteria 2574
302 Ga0207662_10063958 3300025918 Bacteria 2213
303 Ga0207662_10133389 3300025918 Bacteria 1568
304 Ga0207649_10049262 3300025920 Bacteria 2601
305 Ga0207649_10149275 3300025920 Bacteria 1608
306 Ga0207652_10115286 3300025921 Unclassified 2387
307 Ga0207646_10346013 3300025922 Bacteria 1343
308 Ga0207681_10000333 3300025923 Bacteria 33995
309 Ga0207681_10012381 3300025923 Bacteria 5264
310 Ga0207681_10059563 3300025923 Bacteria 2618
311 Ga0207694_10033943 3300025924 Bacteria 3911
312 Ga0207650_10001684 3300025925 Bacteria 15705
313 Ga0207650_10004606 3300025925 Bacteria 9433
314 Ga0207650_10013361 3300025925 Bacteria 5685
315 Ga0207650_10042169 3300025925 Bacteria 3347
316 Ga0207659_10004668 3300025926 Bacteria 8299
317 Ga0207659_10006819 3300025926 Bacteria 7021
318 Ga0207659_10010060 3300025926 Bacteria 5926
319 Ga0207659_10013963 3300025926 Bacteria 5167
320 Ga0207659_10023617 3300025926 Bacteria 4106
321 Ga0207659_10076174 3300025926 Unclassified 2465
322 Ga0207659_10098364 3300025926 Bacteria 2200
323 Ga0207659_10153685 3300025926 Bacteria 1799
324 Ga0207644_10007527 3300025931 Bacteria 7101
325 Ga0207644_10054349 3300025931 Bacteria 2884
326 Ga0207644_10057404 3300025931 Bacteria 2810
327 Ga0207644_10455769 3300025931 Bacteria 1051
328 Ga0207690_10388500 3300025932 Bacteria 1111
329 Ga0207706_10008207 3300025933 Bacteria 9633
330 Ga0207706_10013757 3300025933 Bacteria 7342
331 Ga0207706_10026093 3300025933 Bacteria 5230
332 Ga0207706_10069612 3300025933 Bacteria 3095
333 Ga0207706_10133842 3300025933 Bacteria 2180
334 Ga0207706_10180363 3300025933 Bacteria 1855
335 Ga0207709_10006035 3300025935 Bacteria 6825
336 Ga0207670_10040158 3300025936 Bacteria 3070
337 Ga0207670_10067266 3300025936 Bacteria 2465
338 Ga0207670_10121786 3300025936 Bacteria 1897
339 Ga0207669_10000457 3300025937 Bacteria 17831
340 Ga0207669_10131348 3300025937 Bacteria 1721
341 Ga0207669_10296877 3300025937 Bacteria 1226
342 Ga0207669_10509440 3300025937 Bacteria 964
343 Ga0207704_10011869 3300025938 Bacteria 4307
344 Ga0207704_10135576 3300025938 Bacteria 1713
345 Ga0207704_10156751 3300025938 Bacteria 1615
346 Ga0207665_10049587 3300025939 Bacteria 2822
347 Ga0207691_10000690 3300025940 Bacteria 33386
348 Ga0207691_10007079 3300025940 Bacteria 10824
349 Ga0207691_10010222 3300025940 Bacteria 9002
350 Ga0207691_10066195 3300025940 Bacteria 3269
351 Ga0207691_10098820 3300025940 Bacteria 2607
352 Ga0207691_10182308 3300025940 Bacteria 1834
353 Ga0207691_10204834 3300025940 Unclassified 1716
354 Ga0207691_10205030 3300025940 Unclassified 1715
355 Ga0207691_10239605 3300025940 Unclassified 1568
356 Ga0207689_10002798 3300025942 Bacteria 16109
357 Ga0207689_10048082 3300025942 Bacteria 3519
358 Ga0207689_10190035 3300025942 Bacteria 1694
359 Ga0207689_10359942 3300025942 Bacteria 1210
360 Ga0207679_10004449 3300025945 Bacteria 8732
361 Ga0207679_10043231 3300025945 Bacteria 3243
362 Ga0207679_10046373 3300025945 Bacteria 3150
363 Ga0207679_10502225 3300025945 Bacteria 1082
364 Ga0207651_10013699 3300025960 Bacteria 4651
365 Ga0207651_10015203 3300025960 Bacteria 4466
366 Ga0207651_10114683 3300025960 Bacteria 2030
367 Ga0207712_10014659 3300025961 Bacteria 5048
368 Ga0207712_10018957 3300025961 Bacteria 4489
369 Ga0207712_10050854 3300025961 Unclassified 2895
370 Ga0207668_10107895 3300025972 Bacteria 2083
371 Ga0207668_10259584 3300025972 Bacteria 1415
372 Ga0207658_10086147 3300025986 Bacteria 2422
373 Ga0207677_10221517 3300026023 Bacteria 1518
374 Ga0207703_10054615 3300026035 Unclassified 3249
375 Ga0207703_10056236 3300026035 Bacteria 3203
376 Ga0207703_10113133 3300026035 Bacteria 2319
377 Ga0207703_10201034 3300026035 Bacteria 1771
378 Ga0207678_10303198 3300026067 Unclassified 1373
379 Ga0207708_10011269 3300026075 Bacteria 6653
380 Ga0207708_10019042 3300026075 Bacteria 5169
381 Ga0207708_10056425 3300026075 Bacteria 2996
382 Ga0207708_10102998 3300026075 Bacteria 2211
383 Ga0207641_10063053 3300026088 Bacteria 3165
384 Ga0207641_10065227 3300026088 Bacteria 3114
385 Ga0207641_10185159 3300026088 Bacteria 1910
386 Ga0207648_10008023 3300026089 Bacteria 10289
387 Ga0207648_10015845 3300026089 Bacteria 6909
388 Ga0207676_10082042 3300026095 Bacteria 2621
389 Ga0207676_10098687 3300026095 Bacteria 2415
390 Ga0207676_10123267 3300026095 Bacteria 2189
391 Ga0207676_10160471 3300026095 Bacteria 1947
392 Ga0207676_10183275 3300026095 Bacteria 1835
393 Ga0207676_10432426 3300026095 Unclassified 1237
394 Ga0207674_10050580 3300026116 Bacteria 4244
395 Ga0207674_10062684 3300026116 Bacteria 3755
396 Ga0207674_10207273 3300026116 Bacteria 1910
397 Ga0207675_100006490 3300026118 Bacteria 11065
398 Ga0207675_100007571 3300026118 Bacteria 10259
399 Ga0207675_100170934 3300026118 Bacteria 2077
400 Ga0207675_100225276 3300026118 Bacteria 1807
401 Ga0207683_10034908 3300026121 Bacteria 4374
402 Ga0207683_10066789 3300026121 Bacteria 3172
403 Ga0207683_10130757 3300026121 Bacteria 2258
404 Ga0207683_10155941 3300026121 Unclassified 2062
405 Ga0207683_10257053 3300026121 Bacteria 1594
406 Ga0207683_10258953 3300026121 Bacteria 1588
407 Ga0207683_10303943 3300026121 Bacteria 1460
408 Ga0207683_10352401 3300026121 Bacteria 1351
409 Ga0207683_10679180 3300026121 Bacteria 954
410 Ga0209813_10029213 3300027866 Bacteria 1613
411 Ga0207428_10000089 3300027907 Bacteria 127333
412 Ga0207428_10003016 3300027907 Bacteria 16591
413 Ga0207428_10030932 3300027907 Bacteria 4422
414 Ga0207428_10040647 3300027907 Bacteria 3769
415 Ga0207428_10087995 3300027907 Bacteria 2416
416 Ga0207428_10325648 3300027907 Bacteria 1134
417 Ga0268266_10088569 3300028379 Bacteria 2709
418 Ga0268265_10000687 3300028380 Bacteria 33232
419 Ga0268265_10270631 3300028380 Bacteria 1515
420 Ga0268264_10035191 3300028381 Bacteria 4123
421 Ga0268264_10226189 3300028381 Bacteria 1725
422 Ga0265318_10054581 3300028577 Bacteria 1497
423 Ga0265332_10034753 3300031238 Bacteria 2190
424 Ga0265316_10152308 3300031344 Unclassified 1732
425 Ga0265314_10012738 3300031711 Bacteria 6835
426 Ga0265342_10108122 3300031712 Bacteria 1577
427 Ga0307405_10004477 3300031731 Bacteria 6608
428 Ga0307405_10117328 3300031731 Unclassified 1814
429 Ga0307413_10001169 3300031824 Bacteria 9655
430 Ga0307410_10001475 3300031852 Bacteria 10645
431 Ga0307406_10035244 3300031901 Bacteria 3076
432 Ga0307407_10108543 3300031903 Bacteria 1738
433 Ga0307412_10012733 3300031911 Bacteria 4908
434 Ga0307409_100006309 3300031995 Bacteria 6950
435 Ga0307409_100144637 3300031995 Bacteria 2054
436 Ga0307409_100260076 3300031995 Bacteria 1592
437 Ga0307416_100001068 3300032002 Bacteria 14633
438 Ga0307416_100304393 3300032002 Bacteria 1586
439 Ga0307416_100659012 3300032002 Bacteria 1132
440 Ga0307414_10009422 3300032004 Bacteria 5609
441 Ga0307411_10016823 3300032005 Bacteria 4148
442 Ga0307411_10072537 3300032005 Unclassified 2338
443 Ga0307411_10090452 3300032005 Bacteria 2135
444 Ga0307411_10269108 3300032005 Bacteria 1350
445 Ga0373948_0005274 3300034817 Unclassified 2088
446 Ga0373932_0005650 3300035112 Bacteria 2941
447 Ga0373936_0003306 3300035113 Bacteria 6047
448 Ga0373939_0057191 3300035114 Bacteria 1230
449 Ga0373953_0043342 3300035117 Bacteria 1796
450 Ga0373953_0049839 3300035117 Bacteria 1690
451 Ga0373956_0119244 3300035119 Unclassified 1232
452 Ga0373943_0005292 3300035170 Bacteria 5803
453 Ga0373931_0042755 3300035691 Bacteria 2384
454 Ga0373927_0168586 3300035695 Bacteria 1435
455 Ga0373933_0198510 3300035724 Bacteria 1283
456 Ga0373947_0005632 3300035725 Bacteria 7304
457 Ga0373947_0155758 3300035725 Bacteria 1475
458 Ga0373947_0164903 3300035725 Bacteria 1435
459 Ga0373937_0006221 3300036401 Bacteria 10289
460 Ga0373925_0049030 3300037068 Bacteria 3147
461 Ga0373925_0051458 3300037068 Unclassified 3075
462 Ga0373925_0184376 3300037068 Bacteria 1654
463 Ga0439439_0010624 3300041406 Unclassified 2204
464 Ga0439453_0014326 3300041408 Bacteria 1358
465 Ga0451853_1351024 3300041512 Bacteria 1416
466 Ga0451853_1735664 3300041512 Bacteria 1527
467 Ga0439450_004403 3300042008 Bacteria 2403
468 Ga0439455_0066987 3300042012 Unclassified 960
469 Ga0439435_0003630 3300042436 Bacteria 3233
470 Ga0439435_0076911 3300042436 Unclassified 996
471 Ga0439444_0006226 3300042437 Bacteria 1797
472 Ga0439460_0085427 3300042461 Bacteria 996
473 Ga0450916_001296 3300042530 Bacteria 2465
474 Ga0439440_0006975 3300042993 Bacteria 2288
475 Ga0439440_0022806 3300042993 Bacteria 1422
476 Ga0451576_0009290 3300045051 Bacteria 11421
477 Ga0451576_0079381 3300045051 Bacteria 3414
478 Ga0451576_0160053 3300045051 Bacteria 2349
479 Ga0451576_0161555 3300045051 Unclassified 2338
480 Ga0451576_0235538 3300045051 Bacteria 1912
481 Ga0451576_0277337 3300045051 Bacteria 1753
482 Ga0495580_0074177 3300046472 Bacteria 2375
483 Ga0495584_0006093 3300046491 Bacteria 6345
484 Ga0495584_0121641 3300046491 Bacteria 1322
485 Ga0495594_0023909 3300046499 Bacteria 3278
486 Ga0495607_0140544 3300046501 Unclassified 1246
487 Ga0495608_0007697 3300046511 Bacteria 7592
488 Ga0495628_0086164 3300046516 Bacteria 2436
489 Ga0495630_0003709 3300046517 Bacteria 10654
490 Ga0495644_0050329 3300046523 Bacteria 1564
491 Ga0495663_0020574 3300046525 Bacteria 1894
492 Ga0495663_0101634 3300046525 Bacteria 947
493 Ga0495642_0009855 3300046528 Unclassified 3660
494 Ga0495598_0005263 3300046537 Bacteria 2855
495 Ga0495598_0009687 3300046537 Bacteria 2286
496 Ga0495598_0030328 3300046537 Bacteria 1514
497 Ga0495598_0089547 3300046537 Bacteria 1001
498 Ga0495609_0107409 3300046538 Bacteria 1206
499 Ga0495621_0003215 3300046539 Bacteria 4486
500 Ga0495621_0037295 3300046539 Unclassified 1690
501 Ga0495621_0047167 3300046539 Bacteria 1531
502 Ga0495645_0165374 3300046543 Bacteria 1526
503 Ga0495633_0033251 3300046558 Bacteria 2487
504 Ga0495656_0004889 3300046615 Bacteria 4612
505 Ga0495656_0123002 3300046615 Bacteria 1227
506 Ga0495659_0005110 3300046664 Bacteria 4125
507 Ga0495659_0008314 3300046664 Bacteria 3303
508 Ga0495659_0013366 3300046664 Bacteria 2673
509 Ga0495659_0020614 3300046664 Bacteria 2216
510 Ga0495659_0044381 3300046664 Bacteria 1598
511 Ga0495588_0023928 3300046674 Bacteria 3030
512 Ga0495646_0102040 3300046680 Bacteria 1644
513 Ga0495658_0084103 3300046683 Bacteria 1873
514 Ga0495658_0163741 3300046683 Bacteria 1373
515 Ga0495669_0001378 3300046684 Bacteria 10024
516 Ga0495669_0087711 3300046684 Unclassified 1434
517 Ga0495613_0041407 3300046689 Bacteria 3411
518 Ga0495613_0220613 3300046689 Unclassified 1331
519 Ga0495600_0256188 3300046809 Bacteria 1112
520 Ga0495636_0033285 3300047318 Bacteria 2117
521 Ga0495636_0051713 3300047318 Bacteria 1722
522 Ga0495674_0011153 3300047319 Bacteria 8486
523 Ga0495684_0000048 3300047471 Bacteria 89243
524 Ga0495684_0108474 3300047471 Bacteria 2097
525 Ga0501033_0421585 3300049570 Unclassified 929
526 Ga0501036_0005855 3300049572 Bacteria 9956
527 Ga0501036_0249526 3300049572 Bacteria 1488
528 Ga0501039_0015755 3300049575 Bacteria 5786
529 Ga0501039_0021317 3300049575 Bacteria 4972
530 Ga0501041_0035219 3300049577 Bacteria 3033
531 Ga0501042_0153048 3300049578 Bacteria 1663
532 Ga0501042_0485431 3300049578 Unclassified 897
533 Ga0501046_0096019 3300049580 Bacteria 2277
534 Ga0501046_0214284 3300049580 Bacteria 1428
535 Ga0501048_0034296 3300049582 Bacteria 3663
536 Ga0501048_0048290 3300049582 Bacteria 3036
537 Ga0501068_0030381 3300049584 Bacteria 3205
538 Ga0501069_0213427 3300049585 Bacteria 1120
539 Ga0501072_0008591 3300049588 Bacteria 7747
540 Ga0501075_0012519 3300049591 Bacteria 6032
541 Ga0501075_0058293 3300049591 Bacteria 2908
542 Ga0501076_0009387 3300049592 Bacteria 7223
543 Ga0501249_025732 3300049679 Unclassified 1299
544 Ga0501225_0042816 3300049705 Bacteria 1251
545 Ga0501079_0070319 3300049741 Bacteria 2703
546 Ga0501081_0075162 3300049743 Bacteria 2358
547 Ga0501045_0028869 3300049824 Bacteria 4004
548 nmdc:mga00v17_141238_c1 3300050491 Bacteria 1544
549 nmdc:mga04h51_13933_c1 3300050495 Bacteria 2287
550 nmdc:mga05p37_101691_c1 3300050507 Bacteria 3539
551 nmdc:mga05p37_106254_c1 3300050507 Bacteria 3454
552 nmdc:mga05p37_125293_c1 3300050507 Bacteria 3155
553 nmdc:mga05p37_346549_c1 3300050507 Bacteria 1750
554 nmdc:mga05p37_51603_c1 3300050507 Bacteria 5057
555 nmdc:mga05p37_52580_c1 3300050507 Bacteria 5008
556 nmdc:mga05p37_526851_c1 3300050507 Bacteria 1350
557 nmdc:mga05p37_5994_c1 3300050507 Bacteria 14307
558 nmdc:mga05p37_628_c1 3300050507 Bacteria 39031
559 nmdc:mga09592_158966_c1 3300050508 Unclassified 1951
560 nmdc:mga09592_1788_c1 3300050508 Bacteria 17258
561 nmdc:mga09592_237624_c1 3300050508 Unclassified 1579
562 nmdc:mga09592_258457_c1 3300050508 Unclassified 1510
563 nmdc:mga09592_344006_c1 3300050508 Bacteria 1291
564 nmdc:mga09592_504845_c1 3300050508 Bacteria 1041
565 nmdc:mga09592_91965_c1 3300050508 Bacteria 2593
566 nmdc:mga0qj67_163722_c1 3300050509 Unclassified 1805
567 nmdc:mga0qj67_1720_c1 3300050509 Bacteria 15439
568 nmdc:mga0qj67_189019_c1 3300050509 Bacteria 1674
569 nmdc:mga0qj67_5253_c1 3300050509 Bacteria 9445
570 nmdc:mga0qj67_59246_c1 3300050509 Bacteria 3036
571 nmdc:mga0qj67_7115_c1 3300050509 Bacteria 8255
572 nmdc:mga0qj67_71486_c1 3300050509 Bacteria 2769
573 nmdc:mga06r32_24558_c1 3300050510 Bacteria 5597
574 nmdc:mga06r32_296232_c1 3300050510 Bacteria 1604
575 nmdc:mga06r32_7828_c1 3300050510 Bacteria 9604
576 nmdc:mga06r32_85141_c1 3300050510 Bacteria 3082
577 nmdc:mga08y16_135526_c1 3300050511 Bacteria 2559
578 nmdc:mga08y16_135_c1 3300050511 Bacteria 64253
579 nmdc:mga08y16_14531_c1 3300050511 Bacteria 8282
580 nmdc:mga08y16_149342_c1 3300050511 Bacteria 2429
581 nmdc:mga08y16_20146_c1 3300050511 Bacteria 7039
582 nmdc:mga08y16_20465_c1 3300050511 Bacteria 6985
583 nmdc:mga08y16_450_c1 3300050511 Bacteria 38202
584 nmdc:mga08y16_578533_c1 3300050511 Unclassified 1134
585 nmdc:mga08y16_744403_c1 3300050511 Bacteria 977
586 nmdc:mga08y16_9142_c1 3300050511 Bacteria 10400
587 nmdc:mga08y16_9868_c1 3300050511 Bacteria 10026
588 nmdc:mga0n895_122805_c1 3300050512 Bacteria 2619
589 nmdc:mga0n895_223661_c1 3300050512 Bacteria 1911
590 nmdc:mga0n895_2678_c1 3300050512 Unclassified 1609
591 nmdc:mga0n895_54464_c1 3300050512 Bacteria 3935
592 nmdc:mga0n895_5678_c1 3300050512 Bacteria 10458
593 nmdc:mga0n895_79766_c1 3300050512 Bacteria 3260
594 nmdc:mga0n895_98548_c1 3300050512 Bacteria 2930
595 nmdc:mga0rr50_152131_c1 3300050513 Bacteria 1871
596 nmdc:mga0rr50_192059_c1 3300050513 Bacteria 1674
597 nmdc:mga0rr50_23638_c1 3300050513 Bacteria 4242
598 nmdc:mga0rr50_36550_c1 3300050513 Bacteria 3538
599 nmdc:mga0rr50_52307_c1 3300050513 Bacteria 3035
600 nmdc:mga0a205_1162_c1 3300050515 Bacteria 21892
601 nmdc:mga0a205_1401_c1 3300050515 Bacteria 20412
602 nmdc:mga0a205_230749_c1 3300050515 Bacteria 1734
603 nmdc:mga0a205_47209_c1 3300050515 Bacteria 4155
604 nmdc:mga0a205_645493_c1 3300050515 Bacteria 910
605 nmdc:mga0a205_932_c1 3300050515 Bacteria 24152
606 Ga0495601_0011902 3300053077 Bacteria 5215
607 Ga0495601_0058026 3300053077 Bacteria 2452
608 Ga0495595_0030848 3300053084 Unclassified 2406
609 Ga0495619_0004485 3300053085 Bacteria 8916
610 Ga0501084_0016084 3300054114 Bacteria 6212
611 Ga0501084_0290589 3300054114 Bacteria 1381
612 Ga0590071_000054 3300059421 Bacteria 30441
613 Ga0590075_000029 3300059424 Bacteria 38953
614 Ga0590077_000036 3300059426 Bacteria 30851
615 Ga0501082_0178921 3300060353 Bacteria 1844
616 Ga0530510_0000360 3300061734 Bacteria 29492
617 Ga0065715_10319266
618 JGI25406J46586_10000685
619 JGI25406J46586_10028533
620 Ga0065704_10109354
621 Ga0065712_10004551
622 Ga0065712_10014577
623 Ga0065715_10038350
624 Ga0065715_10040723
625 Ga0065715_10199772
626 Ga0065707_10003557
627 Ga0065707_10090353
628 Ga0065707_10120983
629 Ga0065707_10146589
630 Ga0070676_10005873
631 Ga0070676_10026278
632 Ga0070676_10090193
633 Ga0070683_100204581
634 Ga0070690_100003187
635 Ga0070670_100000819
636 Ga0070670_100003566
637 Ga0070670_100004718
638 Ga0070670_100026389
639 Ga0070670_100064459
640 Ga0070677_10016045
641 Ga0070677_10071506
642 Ga0070677_10125236
643 Ga0068869_100002749
644 Ga0068869_100066403
645 Ga0068869_100204416
646 Ga0068869_100319406
647 Ga0070666_10035439
648 Ga0070666_10068568
649 Ga0070666_10100045
650 Ga0070680_100095772
651 Ga0068868_100575638
652 Ga0070689_100016177
653 Ga0070689_100064713
654 Ga0070691_10160088
655 Ga0070687_100072601
656 Ga0070687_100159969
657 Ga0070661_100182153
658 Ga0070661_100203611
659 Ga0070692_10038480
660 Ga0070668_100044665
661 Ga0070668_100087881
662 Ga0070669_100012135
663 Ga0070669_100027874
664 Ga0070669_100065566
665 Ga0070675_100005874
666 Ga0070675_100023934
667 Ga0070675_100047037
668 Ga0070675_100126637
669 Ga0070675_100143080
670 Ga0070675_100162155
671 Ga0070675_100166169
672 Ga0070675_100430164
673 Ga0070671_100009589
674 Ga0070671_100027528
675 Ga0070671_100077826
676 Ga0070674_100001990
677 Ga0070674_100014554
678 Ga0070674_100117431
679 Ga0070673_100008431
680 Ga0070673_100015932
681 Ga0070673_100017452
682 Ga0070673_100038401
683 Ga0070673_100043913
684 Ga0070673_100142277
685 Ga0070673_100223029
686 Ga0070673_100329486
687 Ga0070688_100019367
688 Ga0070688_100053563
689 Ga0070688_100058025
690 Ga0070659_100375534
691 Ga0070667_100085651
692 Ga0070701_10004347
693 Ga0070701_10010836
694 Ga0070701_10019430
695 Ga0070711_100025619
696 Ga0070705_100000166
697 Ga0070705_100153012
698 Ga0070705_100221620
699 Ga0070700_100003485
700 Ga0070694_100000901
701 Ga0070694_100009686
702 Ga0070694_100396740
703 Ga0070708_100261215
704 Ga0070678_100107417
705 Ga0070678_100226780
706 Ga0070678_100353096
707 Ga0070678_100354936
708 Ga0070662_100046883
709 Ga0070681_10001438
710 Ga0068867_100080641
711 Ga0068867_100194911
712 Ga0070685_10010067
713 Ga0070685_10027146
714 Ga0070706_100446901
715 Ga0070707_100016552
716 Ga0070698_100006504
717 Ga0070698_100063678
718 Ga0070698_100392502
719 Ga0070699_100000940
720 Ga0070699_100005549
721 Ga0070699_100009342
722 Ga0070699_100015825
723 Ga0070679_100137632
724 Ga0070697_100132524
725 Ga0070697_100221198
726 Ga0070697_100350087
727 Ga0070672_100015233
728 Ga0070672_100026827
729 Ga0070672_100107253
730 Ga0070672_100131730
731 Ga0070672_100191557
732 Ga0070686_100224803
733 Ga0070695_100000441
734 Ga0070695_100010029
735 Ga0070695_100047133
736 Ga0070695_100141106
737 Ga0070696_100000485
738 Ga0070696_100006763
739 Ga0070696_100035350
740 Ga0070665_100066038
741 Ga0070704_100001578
742 Ga0070704_100084181
743 Ga0070704_100118134
744 Ga0070704_100123081
745 Ga0070704_100237851
746 Ga0070664_100009651
747 Ga0070664_100013014
748 Ga0070664_100082132
749 Ga0070664_100245928
750 Ga0070664_100265205
751 Ga0068857_100447088
752 Ga0070702_100023410
753 Ga0070702_100054343
754 Ga0068859_100018328
755 Ga0068859_100134718
756 Ga0068859_100330362
757 Ga0068864_100039896
758 Ga0068864_100085861
759 Ga0068864_100097663
760 Ga0068864_100230554
761 Ga0068864_100299939
762 Ga0068866_10006036
763 Ga0068861_100004743
764 Ga0068851_10013709
765 Ga0068870_10019623
766 Ga0068870_10048462
767 Ga0068870_10053317
768 Ga0068870_10113520
769 Ga0068870_10116229
770 Ga0068863_100062374
771 Ga0068863_100064606
772 Ga0068858_100079981
773 Ga0068860_100015442
774 Ga0068860_100039685
775 Ga0068862_100000830
776 Ga0068862_100090152
777 Ga0068862_100360423
778 Ga0068862_100632321
779 Ga0081539_10000024
780 Ga0081539_10000228
781 Ga0081539_10144201
782 Ga0070715_10102906
783 Ga0075367_10166088
784 Ga0097621_100020470
785 Ga0097621_100063036
786 Ga0097621_100146964
787 Ga0068871_100157999
788 Ga0075428_100000575
789 Ga0075428_100001239
790 Ga0075428_100004257
791 Ga0075428_100013027
792 Ga0075428_100028511
793 Ga0075428_100110524
794 Ga0075430_100000443
795 Ga0075430_100011913
796 Ga0075430_100025956
797 Ga0075430_100038651
798 Ga0075430_100046913
799 Ga0075430_100054238
800 Ga0075430_100061600
801 Ga0075431_100006383
802 Ga0075431_100014769
803 Ga0075431_100028144
804 Ga0075431_100051692
805 Ga0075431_100089607
806 Ga0075433_10001107
807 Ga0075433_10002869
808 Ga0075433_10552967
809 Ga0075434_100006359
810 Ga0075434_100008470
811 Ga0075434_100015165
812 Ga0075434_100021899
813 Ga0075434_100145476
814 Ga0075434_100476378
815 Ga0075429_100015925
816 Ga0075429_100040454
817 Ga0075429_100141306
818 Ga0075429_100155158
819 Ga0075429_100183539
820 Ga0068865_100053027
821 Ga0068865_100197337
822 Ga0097620_100018328
823 Ga0097620_100134712
824 Ga0097620_100330382
825 Ga0075435_100008922
826 Ga0075435_100030812
827 Ga0075435_100042035
828 Ga0075435_100097934
829 Ga0075435_100199290
830 Ga0111539_10002473
831 Ga0111539_10002628
832 Ga0111539_10003133
833 Ga0111539_10006678
834 Ga0111539_10014731
835 Ga0111539_10014891
836 Ga0111539_10038294
837 Ga0111539_10062311
838 Ga0111539_10133675
839 Ga0111539_10141124
840 Ga0111539_10315579
841 Ga0111539_10428843
842 Ga0111539_10450226
843 Ga0105245_10830867
844 Ga0114129_10001192
845 Ga0114129_10003620
846 Ga0114129_10009597
847 Ga0114129_10032027
848 Ga0114129_10033467
849 Ga0114129_10041883
850 Ga0114129_10053877
851 Ga0114129_10185861
852 Ga0114129_10249128
853 Ga0114129_10390088
854 Ga0114129_10889220
855 Ga0105243_10039456
856 Ga0105243_10277123
857 Ga0105243_10590854
858 Ga0105242_10431805
859 Ga0105248_10461715
860 Ga0105248_10542072
861 Ga0105238_10004828
862 Ga0105249_10002507
863 Ga0105249_10013872
864 Ga0105249_10420249
865 Ga0105246_10023687
866 Ga0157371_10092689
867 Ga0157374_10016677
868 Ga0157378_10340277
869 Ga0163162_10002177
870 Ga0163162_10063942
871 Ga0157375_10093097
872 Ga0157375_10202486
873 Ga0157375_10363097
874 Ga0157375_10393280
875 Ga0157375_10798153
876 Ga0163163_10002928
877 Ga0163163_10006980
878 Ga0163163_10051055
879 Ga0163163_10095187
880 Ga0157380_10027360
881 Ga0157380_10029039
882 Ga0157380_10038014
883 Ga0157380_10074504
884 Ga0157380_10212152
885 Ga0157377_10003109
886 Ga0157377_10110019
887 Ga0157379_10072759
888 Ga0163161_10354179
889 Ga0207697_10001259
890 Ga0207697_10044788
891 Ga0207653_10027914
892 Ga0207682_10009375
893 Ga0207682_10015234
894 Ga0207682_10115159
895 Ga0207682_10129189
896 Ga0207642_10002359
897 Ga0207688_10000413
898 Ga0207680_10025772
899 Ga0207680_10061328
900 Ga0207680_10118990
901 Ga0207680_10148135
902 Ga0207647_10099111
903 Ga0207645_10009831
904 Ga0207645_10018608
905 Ga0207645_10061212
906 Ga0207645_10239620
907 Ga0207643_10001360
908 Ga0207643_10006585
909 Ga0207643_10035356
910 Ga0207643_10054427
911 Ga0207643_10062238
912 Ga0207643_10140066
913 Ga0207684_10065429
914 Ga0207707_10033508
915 Ga0207660_10230080
916 Ga0207662_10002508
917 Ga0207662_10046255
918 Ga0207662_10063958
919 Ga0207662_10133389
920 Ga0207649_10049262
921 Ga0207649_10149275
922 Ga0207652_10115286
923 Ga0207646_10346013
924 Ga0207681_10000333
925 Ga0207681_10012381
926 Ga0207681_10059563
927 Ga0207694_10033943
928 Ga0207650_10001684
929 Ga0207650_10004606
930 Ga0207650_10013361
931 Ga0207650_10042169
932 Ga0207659_10004668
933 Ga0207659_10006819
934 Ga0207659_10010060
935 Ga0207659_10013963
936 Ga0207659_10023617
937 Ga0207659_10076174
938 Ga0207659_10098364
939 Ga0207659_10153685
940 Ga0207644_10007527
941 Ga0207644_10054349
942 Ga0207644_10057404
943 Ga0207644_10455769
944 Ga0207690_10388500
945 Ga0207706_10008207
946 Ga0207706_10013757
947 Ga0207706_10026093
948 Ga0207706_10069612
949 Ga0207706_10133842
950 Ga0207706_10180363
951 Ga0207709_10006035
952 Ga0207670_10040158
953 Ga0207670_10067266
954 Ga0207670_10121786
955 Ga0207669_10000457
956 Ga0207669_10131348
957 Ga0207669_10296877
958 Ga0207669_10509440
959 Ga0207704_10011869
960 Ga0207704_10135576
961 Ga0207704_10156751
962 Ga0207665_10049587
963 Ga0207691_10000690
964 Ga0207691_10007079
965 Ga0207691_10010222
966 Ga0207691_10066195
967 Ga0207691_10098820
968 Ga0207691_10182308
969 Ga0207691_10204834
970 Ga0207691_10205030
971 Ga0207691_10239605
972 Ga0207689_10002798
973 Ga0207689_10048082
974 Ga0207689_10190035
975 Ga0207689_10359942
976 Ga0207679_10004449
977 Ga0207679_10043231
978 Ga0207679_10046373
979 Ga0207679_10502225
980 Ga0207651_10013699
981 Ga0207651_10015203
982 Ga0207651_10114683
983 Ga0207712_10014659
984 Ga0207712_10018957
985 Ga0207712_10050854
986 Ga0207668_10107895
987 Ga0207668_10259584
988 Ga0207658_10086147
989 Ga0207677_10221517
990 Ga0207703_10054615
991 Ga0207703_10056236
992 Ga0207703_10113133
993 Ga0207703_10201034
994 Ga0207678_10303198
995 Ga0207708_10011269
996 Ga0207708_10019042
997 Ga0207708_10056425
998 Ga0207708_10102998
999 Ga0207641_10063053
1000 Ga0207641_10065227
1001 Ga0207641_10185159
1002 Ga0207648_10008023
1003 Ga0207648_10015845
1004 Ga0207676_10082042
1005 Ga0207676_10098687
1006 Ga0207676_10123267
1007 Ga0207676_10160471
1008 Ga0207676_10183275
1009 Ga0207676_10432426
1010 Ga0207674_10050580
1011 Ga0207674_10062684
1012 Ga0207674_10207273
1013 Ga0207675_100006490
1014 Ga0207675_100007571
1015 Ga0207675_100170934
1016 Ga0207675_100225276
1017 Ga0207683_10034908
1018 Ga0207683_10066789
1019 Ga0207683_10130757
1020 Ga0207683_10155941
1021 Ga0207683_10257053
1022 Ga0207683_10258953
1023 Ga0207683_10303943
1024 Ga0207683_10352401
1025 Ga0207683_10679180
1026 Ga0209813_10029213
1027 Ga0207428_10000089
1028 Ga0207428_10003016
1029 Ga0207428_10030932
1030 Ga0207428_10040647
1031 Ga0207428_10087995
1032 Ga0207428_10325648
1033 Ga0268266_10088569
1034 Ga0268265_10000687
1035 Ga0268265_10270631
1036 Ga0268264_10035191
1037 Ga0268264_10226189
1038 Ga0265318_10054581
1039 Ga0265332_10034753
1040 Ga0265316_10152308
1041 Ga0265314_10012738
1042 Ga0265342_10108122
1043 Ga0307405_10004477
1044 Ga0307405_10117328
1045 Ga0307413_10001169
1046 Ga0307410_10001475
1047 Ga0307406_10035244
1048 Ga0307407_10108543
1049 Ga0307412_10012733
1050 Ga0307409_100006309
1051 Ga0307409_100144637
1052 Ga0307409_100260076
1053 Ga0307416_100001068
1054 Ga0307416_100304393
1055 Ga0307416_100659012
1056 Ga0307414_10009422
1057 Ga0307411_10016823
1058 Ga0307411_10072537
1059 Ga0307411_10090452
1060 Ga0307411_10269108
1061 Ga0373948_0005274
1062 Ga0373932_0005650
1063 Ga0373936_0003306
1064 Ga0373939_0057191
1065 Ga0373953_0043342
1066 Ga0373953_0049839
1067 Ga0373956_0119244
1068 Ga0373943_0005292
1069 Ga0373931_0042755
1070 Ga0373927_0168586
1071 Ga0373933_0198510
1072 Ga0373947_0005632
1073 Ga0373947_0155758
1074 Ga0373947_0164903
1075 Ga0373937_0006221
1076 Ga0373925_0049030
1077 Ga0373925_0051458
1078 Ga0373925_0184376
1079 Ga0439439_0010624
1080 Ga0439453_0014326
1081 Ga0451853_1351024
1082 Ga0451853_1735664
1083 Ga0439450_004403
1084 Ga0439455_0066987
1085 Ga0439435_0003630
1086 Ga0439435_0076911
1087 Ga0439444_0006226
1088 Ga0439460_0085427
1089 Ga0450916_001296
1090 Ga0439440_0006975
1091 Ga0439440_0022806
1092 Ga0451576_0009290
1093 Ga0451576_0079381
1094 Ga0451576_0160053
1095 Ga0451576_0161555
1096 Ga0451576_0235538
1097 Ga0451576_0277337
1098 Ga0495580_0074177
1099 Ga0495584_0006093
1100 Ga0495584_0121641
1101 Ga0495594_0023909
1102 Ga0495607_0140544
1103 Ga0495608_0007697
1104 Ga0495628_0086164
1105 Ga0495630_0003709
1106 Ga0495644_0050329
1107 Ga0495663_0020574
1108 Ga0495663_0101634
1109 Ga0495642_0009855
1110 Ga0495598_0005263
1111 Ga0495598_0009687
1112 Ga0495598_0030328
1113 Ga0495598_0089547
1114 Ga0495609_0107409
1115 Ga0495621_0003215
1116 Ga0495621_0037295
1117 Ga0495621_0047167
1118 Ga0495645_0165374
1119 Ga0495633_0033251
1120 Ga0495656_0004889
1121 Ga0495656_0123002
1122 Ga0495659_0005110
1123 Ga0495659_0008314
1124 Ga0495659_0013366
1125 Ga0495659_0020614
1126 Ga0495659_0044381
1127 Ga0495588_0023928
1128 Ga0495646_0102040
1129 Ga0495658_0084103
1130 Ga0495658_0163741
1131 Ga0495669_0001378
1132 Ga0495669_0087711
1133 Ga0495613_0041407
1134 Ga0495613_0220613
1135 Ga0495600_0256188
1136 Ga0495636_0033285
1137 Ga0495636_0051713
1138 Ga0495674_0011153
1139 Ga0495684_0000048
1140 Ga0495684_0108474
1141 Ga0501033_0421585
1142 Ga0501036_0005855
1143 Ga0501036_0249526
1144 Ga0501039_0015755
1145 Ga0501039_0021317
1146 Ga0501041_0035219
1147 Ga0501042_0153048
1148 Ga0501042_0485431
1149 Ga0501046_0096019
1150 Ga0501046_0214284
1151 Ga0501048_0034296
1152 Ga0501048_0048290
1153 Ga0501068_0030381
1154 Ga0501069_0213427
1155 Ga0501072_0008591
1156 Ga0501075_0012519
1157 Ga0501075_0058293
1158 Ga0501076_0009387
1159 Ga0501249_025732
1160 Ga0501225_0042816
1161 Ga0501079_0070319
1162 Ga0501081_0075162
1163 Ga0501045_0028869
1164 nmdc:mga00v17_141238_c1
1165 nmdc:mga04h51_13933_c1
1166 nmdc:mga05p37_101691_c1
1167 nmdc:mga05p37_106254_c1
1168 nmdc:mga05p37_125293_c1
1169 nmdc:mga05p37_346549_c1
1170 nmdc:mga05p37_51603_c1
1171 nmdc:mga05p37_52580_c1
1172 nmdc:mga05p37_526851_c1
1173 nmdc:mga05p37_5994_c1
1174 nmdc:mga05p37_628_c1
1175 nmdc:mga09592_158966_c1
1176 nmdc:mga09592_1788_c1
1177 nmdc:mga09592_237624_c1
1178 nmdc:mga09592_258457_c1
1179 nmdc:mga09592_344006_c1
1180 nmdc:mga09592_504845_c1
1181 nmdc:mga09592_91965_c1
1182 nmdc:mga0qj67_163722_c1
1183 nmdc:mga0qj67_1720_c1
1184 nmdc:mga0qj67_189019_c1
1185 nmdc:mga0qj67_5253_c1
1186 nmdc:mga0qj67_59246_c1
1187 nmdc:mga0qj67_7115_c1
1188 nmdc:mga0qj67_71486_c1
1189 nmdc:mga06r32_24558_c1
1190 nmdc:mga06r32_296232_c1
1191 nmdc:mga06r32_7828_c1
1192 nmdc:mga06r32_85141_c1
1193 nmdc:mga08y16_135526_c1
1194 nmdc:mga08y16_135_c1
1195 nmdc:mga08y16_14531_c1
1196 nmdc:mga08y16_149342_c1
1197 nmdc:mga08y16_20146_c1
1198 nmdc:mga08y16_20465_c1
1199 nmdc:mga08y16_450_c1
1200 nmdc:mga08y16_578533_c1
1201 nmdc:mga08y16_744403_c1
1202 nmdc:mga08y16_9142_c1
1203 nmdc:mga08y16_9868_c1
1204 nmdc:mga0n895_122805_c1
1205 nmdc:mga0n895_223661_c1
1206 nmdc:mga0n895_2678_c1
1207 nmdc:mga0n895_54464_c1
1208 nmdc:mga0n895_5678_c1
1209 nmdc:mga0n895_79766_c1
1210 nmdc:mga0n895_98548_c1
1211 nmdc:mga0rr50_152131_c1
1212 nmdc:mga0rr50_192059_c1
1213 nmdc:mga0rr50_23638_c1
1214 nmdc:mga0rr50_36550_c1
1215 nmdc:mga0rr50_52307_c1
1216 nmdc:mga0a205_1162_c1
1217 nmdc:mga0a205_1401_c1
1218 nmdc:mga0a205_230749_c1
1219 nmdc:mga0a205_47209_c1
1220 nmdc:mga0a205_645493_c1
1221 nmdc:mga0a205_932_c1
1222 Ga0495601_0011902
1223 Ga0495601_0058026
1224 Ga0495595_0030848
1225 Ga0495619_0004485
1226 Ga0501084_0016084
1227 Ga0501084_0290589
1228 Ga0590071_000054
1229 Ga0590075_000029
1230 Ga0590077_000036
1231 Ga0501082_0178921
1232 Ga0530510_0000360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

58

299

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s9y-assembly1.cif.gz_A helicobacter hepaticus ccsba open conformation 0.7539 5 268
7s9y-assembly1.cif.gz_A helicobacter hepaticus ccsba open conformation 0.7237 5 268
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.6674 2 256
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.6374 2 105
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.6305 2 256
ID Description Score Start End Superfamily
af_B1AYL1_1244_1360_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.7164 2 108 1.20.120.350
af_F1LQQ7_520_640_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6921 2 104 1.20.120.350
af_B1AYL1_1244_1360_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6599 2 108 1.20.120.350
af_Q4DM91_26_149_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6599 1 105 1.20.120.350
af_I1L2P4_316_459_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.6485 5 105 1.20.120.520
ID Description Score Start End GO Terms
AF-A0A382ILU2-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.974 1 171 GO:0016020
GO:0017004
GO:0020037
AF-A0A3D1IGU0-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.9692 2 270 GO:0016020
GO:0017004
GO:0020037
AF-A0A382ILU2-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.9684 1 171 GO:0016020
GO:0017004
GO:0020037
AF-A0A3N5Q2D6-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.9654 2 270 GO:0005886
GO:0017004
GO:0020037
AF-A0A352Z9B6-F1-model_v4 C-type cytochrome biogenesis protein CcsB 0.9593 2 171 GO:0005886
GO:0017004
GO:0020037

Map