F469457

General Info

Members Datasets Scaffolds Average Seq Length
615 232 1230 100

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_1763893|Ga0395905_1763893_24_353
Length 109
Sequence VASGYVAILTVELHFPEAASLKGKRHFVRSAKDNLRNRFGAAVAEVDHHDLWQRATLTVACVARSAHEAEELGDGAERWLASGDWVLVRCDRLLVSPDDESSPRSRSSL

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 1.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.97
Rhizosphere 90.24
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_1763893 3300037471 Bacteria 524
2 Ga0070658_10117259 3300005327 Bacteria 2210
3 Ga0070658_10556520 3300005327 Bacteria 993
4 Ga0070683_100033669 3300005329 Bacteria 4673
5 Ga0070683_100166393 3300005329 Bacteria 2092
6 Ga0070683_100446625 3300005329 Bacteria 1234
7 Ga0070683_100480981 3300005329 Unclassified 1186
8 Ga0070683_100483465 3300005329 Bacteria 1182
9 Ga0070683_101471767 3300005329 Bacteria 655
10 Ga0070680_100004608 3300005336 Bacteria 10359
11 Ga0070680_100042465 3300005336 Bacteria 3690
12 Ga0070680_100220819 3300005336 Bacteria 1600
13 Ga0070680_100635884 3300005336 Bacteria 917
14 Ga0070680_100984236 3300005336 Bacteria 728
15 Ga0070682_100699102 3300005337 Bacteria 813
16 Ga0070682_100860341 3300005337 Bacteria 742
17 Ga0068868_101900280 3300005338 Bacteria 564
18 Ga0070660_100009902 3300005339 Bacteria 6722
19 Ga0070660_100030865 3300005339 Bacteria 4021
20 Ga0070660_100081294 3300005339 Bacteria 2543
21 Ga0070660_100311169 3300005339 Unclassified 1292
22 Ga0070661_100016735 3300005344 Bacteria 5190
23 Ga0070661_100091534 3300005344 Bacteria 2253
24 Ga0070661_100212750 3300005344 Bacteria 1480
25 Ga0070661_100225751 3300005344 Unclassified 1438
26 Ga0070661_100293485 3300005344 Bacteria 1264
27 Ga0070661_100453278 3300005344 Bacteria 1021
28 Ga0070661_100665806 3300005344 Bacteria 846
29 Ga0070671_100034425 3300005355 Bacteria 4193
30 Ga0070674_100413307 3300005356 Bacteria 1105
31 Ga0070659_100045786 3300005366 Bacteria 3428
32 Ga0070659_100289537 3300005366 Bacteria 1364
33 Ga0070659_100844603 3300005366 Bacteria 798
34 Ga0070709_10133237 3300005434 Bacteria 1699
35 Ga0070709_10252940 3300005434 Bacteria 1270
36 Ga0070714_100203778 3300005435 Bacteria 1811
37 Ga0070714_100419339 3300005435 Unclassified 1268
38 Ga0070714_100745245 3300005435 Bacteria 947
39 Ga0070714_102233423 3300005435 Bacteria 533
40 Ga0070714_102264621 3300005435 Bacteria 529
41 Ga0070713_100123854 3300005436 Bacteria 2271
42 Ga0070713_100327100 3300005436 Bacteria 1417
43 Ga0070713_100336363 3300005436 Bacteria 1398
44 Ga0070713_100376634 3300005436 Bacteria 1321
45 Ga0070713_100441477 3300005436 Bacteria 1221
46 Ga0070713_102071263 3300005436 Unclassified 552
47 Ga0070710_10208520 3300005437 Bacteria 1238
48 Ga0070710_10680594 3300005437 Bacteria 724
49 Ga0070710_10734107 3300005437 Bacteria 700
50 Ga0070711_100158694 3300005439 Unclassified 1713
51 Ga0070711_100237831 3300005439 Bacteria 1423
52 Ga0070711_100610999 3300005439 Bacteria 910
53 Ga0070694_100156446 3300005444 Bacteria 1669
54 Ga0070694_100869092 3300005444 Bacteria 743
55 Ga0070708_100041394 3300005445 Bacteria 4039
56 Ga0070708_100760390 3300005445 Unclassified 911
57 Ga0070663_101896887 3300005455 Bacteria 535
58 Ga0070663_102024421 3300005455 Bacteria 518
59 Ga0070681_10002298 3300005458 Bacteria 17488
60 Ga0070681_10032887 3300005458 Bacteria 5206
61 Ga0070681_10057112 3300005458 Bacteria 3883
62 Ga0070681_10072429 3300005458 Bacteria 3408
63 Ga0070681_10252594 3300005458 Bacteria 1675
64 Ga0070681_10377917 3300005458 Unclassified 1327
65 Ga0070681_10496471 3300005458 Bacteria 1133
66 Ga0070681_10938449 3300005458 Bacteria 784
67 Ga0070706_100312089 3300005467 Bacteria 1467
68 Ga0070707_100465116 3300005468 Bacteria 1226
69 Ga0070699_100181989 3300005518 Bacteria 1865
70 Ga0070679_100027597 3300005530 Bacteria 5589
71 Ga0070679_100033861 3300005530 Bacteria 5059
72 Ga0070679_100052007 3300005530 Bacteria 4081
73 Ga0070679_100088497 3300005530 Bacteria 3084
74 Ga0070679_100139644 3300005530 Bacteria 2403
75 Ga0070679_100230097 3300005530 Bacteria 1813
76 Ga0070679_100337207 3300005530 Bacteria 1456
77 Ga0070679_100997200 3300005530 Bacteria 782
78 Ga0070679_101322118 3300005530 Bacteria 667
79 Ga0070684_100071253 3300005535 Bacteria 3059
80 Ga0070684_100256259 3300005535 Unclassified 1600
81 Ga0070684_100634970 3300005535 Bacteria 994
82 Ga0070684_101869529 3300005535 Bacteria 566
83 Ga0068853_100204962 3300005539 Bacteria 1796
84 Ga0068853_100442766 3300005539 Bacteria 1221
85 Ga0068853_101099431 3300005539 Bacteria 766
86 Ga0070696_100086784 3300005546 Bacteria 2222
87 Ga0070665_100144368 3300005548 Bacteria 2383
88 Ga0070665_100193220 3300005548 Bacteria 2036
89 Ga0070665_100743530 3300005548 Bacteria 994
90 Ga0068855_100005352 3300005563 Bacteria 15656
91 Ga0068855_100076377 3300005563 Bacteria 3888
92 Ga0068855_100108378 3300005563 Bacteria 3190
93 Ga0068855_100516077 3300005563 Bacteria 1297
94 Ga0068855_101176030 3300005563 Bacteria 798
95 Ga0068855_101895689 3300005563 Bacteria 604
96 Ga0068857_100025774 3300005577 Bacteria 5177
97 Ga0068857_100062159 3300005577 Bacteria 3319
98 Ga0068857_100226988 3300005577 Bacteria 1707
99 Ga0068857_102438558 3300005577 Bacteria 514
100 Ga0068854_101092670 3300005578 Bacteria 710
101 Ga0068854_101421448 3300005578 Bacteria 628
102 Ga0068856_100244868 3300005614 Unclassified 1808
103 Ga0068856_100317430 3300005614 Bacteria 1575
104 Ga0068856_100490452 3300005614 Bacteria 1249
105 Ga0068856_101517501 3300005614 Bacteria 684
106 Ga0068852_100332471 3300005616 Bacteria 1479
107 Ga0068852_100387838 3300005616 Bacteria 1371
108 Ga0081455_10119997 3300005937 Bacteria 2073
109 Ga0070717_10254818 3300006028 Bacteria 1551
110 Ga0070717_11017382 3300006028 Bacteria 755
111 Ga0070715_10034414 3300006163 Bacteria 2077
112 Ga0070716_100516846 3300006173 Bacteria 884
113 Ga0070712_100050393 3300006175 Bacteria 2896
114 Ga0070712_100156231 3300006175 Bacteria 1757
115 Ga0070712_100420954 3300006175 Bacteria 1107
116 Ga0097621_100759745 3300006237 Bacteria 896
117 Ga0075433_10537521 3300006852 Bacteria 1028
118 Ga0075434_100031031 3300006871 Bacteria 5267
119 Ga0075436_101460346 3300006914 Bacteria 519
120 Ga0075435_100012385 3300007076 Bacteria 6311
121 Ga0105240_10058319 3300009093 Bacteria 4820
122 Ga0105240_10689415 3300009093 Bacteria 1116
123 Ga0105240_11255580 3300009093 Bacteria 783
124 Ga0105245_11486130 3300009098 Bacteria 728
125 Ga0114129_12232996 3300009147 Unclassified 658
126 Ga0105243_10202123 3300009148 Bacteria 1743
127 Ga0105241_10218387 3300009174 Bacteria 1601
128 Ga0105241_10504720 3300009174 Bacteria 1079
129 Ga0105241_11565296 3300009174 Bacteria 636
130 Ga0105242_10105133 3300009176 Bacteria 2397
131 Ga0105242_12258738 3300009176 Bacteria 590
132 Ga0105237_10101828 3300009545 Bacteria 2864
133 Ga0105238_11638741 3300009551 Unclassified 674
134 Ga0105239_10184248 3300010375 Bacteria 2336
135 Ga0105239_10580333 3300010375 Unclassified 1278
136 Ga0105239_11908736 3300010375 Archaea 689
137 Ga0105246_11288298 3300011119 Unclassified 677
138 Ga0105246_12134643 3300011119 Bacteria 544
139 Ga0157371_11494192 3300013102 Bacteria 527
140 Ga0157370_10016647 3300013104 Bacteria 7439
141 Ga0157370_10155563 3300013104 Bacteria 2127
142 Ga0157370_10348308 3300013104 Bacteria 1365
143 Ga0157370_10385930 3300013104 Bacteria 1290
144 Ga0157370_10888439 3300013104 Bacteria 809
145 Ga0157369_10344225 3300013105 Unclassified 1549
146 Ga0157369_10608942 3300013105 Bacteria 1127
147 Ga0157369_11297595 3300013105 Bacteria 742
148 Ga0157374_10072506 3300013296 Bacteria 3249
149 Ga0157374_11625794 3300013296 Bacteria 670
150 Ga0157378_11232651 3300013297 Bacteria 788
151 Ga0157372_10166553 3300013307 Bacteria 2549
152 Ga0157372_10228400 3300013307 Bacteria 2157
153 Ga0157372_10342725 3300013307 Bacteria 1741
154 Ga0157372_10342958 3300013307 Unclassified 1740
155 Ga0157372_10731617 3300013307 Bacteria 1151
156 Ga0157372_10827407 3300013307 Bacteria 1075
157 Ga0157372_10989447 3300013307 Bacteria 974
158 Ga0157372_11422709 3300013307 Bacteria 799
159 Ga0157375_10741173 3300013308 Bacteria 1134
160 Ga0163163_12359453 3300014325 Bacteria 591
161 Ga0182008_10076994 3300014497 Bacteria 1641
162 Ga0182008_10366446 3300014497 Bacteria 767
163 Ga0182008_10376216 3300014497 Bacteria 758
164 Ga0197907_11073875 3300020069 Bacteria 5132
165 Ga0206356_10625028 3300020070 Bacteria 4042
166 Ga0206356_10777811 3300020070 Bacteria 2172
167 Ga0206356_11595904 3300020070 Bacteria 531
168 Ga0206356_11602287 3300020070 Bacteria 822
169 Ga0206356_11870710 3300020070 Bacteria 1438
170 Ga0206354_10137113 3300020081 Bacteria 6399
171 Ga0206354_11392751 3300020081 Bacteria 536
172 Ga0206353_10676125 3300020082 Bacteria 1181
173 Ga0206353_11658859 3300020082 Bacteria 2174
174 Ga0206353_11717398 3300020082 Bacteria 3542
175 Ga0206353_11788903 3300020082 Bacteria 6607
176 Ga0213875_10285365 3300021388 Bacteria 780
177 Ga0207692_10389183 3300025898 Bacteria 867
178 Ga0207685_10141266 3300025905 Bacteria 1080
179 Ga0207699_10113367 3300025906 Bacteria 1742
180 Ga0207699_10401221 3300025906 Bacteria 977
181 Ga0207699_10530981 3300025906 Bacteria 852
182 Ga0207705_10005937 3300025909 Bacteria 9083
183 Ga0207705_10124189 3300025909 Bacteria 1917
184 Ga0207705_10305331 3300025909 Bacteria 1221
185 Ga0207684_10647131 3300025910 Bacteria 901
186 Ga0207707_10011475 3300025912 Bacteria 7716
187 Ga0207707_10015031 3300025912 Bacteria 6739
188 Ga0207707_10145540 3300025912 Bacteria 2071
189 Ga0207707_10227914 3300025912 Bacteria 1621
190 Ga0207707_10616917 3300025912 Bacteria 917
191 Ga0207707_10701672 3300025912 Bacteria 849
192 Ga0207707_10722175 3300025912 Bacteria 835
193 Ga0207695_10050970 3300025913 Bacteria 4350
194 Ga0207695_10239987 3300025913 Bacteria 1714
195 Ga0207695_10629827 3300025913 Bacteria 954
196 Ga0207671_10013119 3300025914 Bacteria 6619
197 Ga0207693_10015488 3300025915 Bacteria 6117
198 Ga0207693_10045609 3300025915 Bacteria 3444
199 Ga0207663_10107151 3300025916 Bacteria 1890
200 Ga0207663_10772853 3300025916 Unclassified 764
201 Ga0207663_11145537 3300025916 Bacteria 626
202 Ga0207663_11286113 3300025916 Bacteria 589
203 Ga0207660_10013947 3300025917 Bacteria 5274
204 Ga0207660_10061195 3300025917 Bacteria 2709
205 Ga0207660_10089016 3300025917 Bacteria 2284
206 Ga0207660_10307183 3300025917 Bacteria 1264
207 Ga0207660_11295910 3300025917 Bacteria 592
208 Ga0207660_11692301 3300025917 Bacteria 509
209 Ga0207657_10009013 3300025919 Bacteria 10078
210 Ga0207657_10014652 3300025919 Bacteria 7640
211 Ga0207657_10031059 3300025919 Bacteria 4843
212 Ga0207657_10033954 3300025919 Bacteria 4594
213 Ga0207657_10100224 3300025919 Bacteria 2405
214 Ga0207657_10288080 3300025919 Bacteria 1303
215 Ga0207657_10551042 3300025919 Bacteria 902
216 Ga0207649_10119841 3300025920 Bacteria 1772
217 Ga0207649_10121976 3300025920 Bacteria 1758
218 Ga0207649_10608862 3300025920 Bacteria 841
219 Ga0207649_10654785 3300025920 Bacteria 812
220 Ga0207649_11295798 3300025920 Bacteria 576
221 Ga0207652_10005877 3300025921 Bacteria 9933
222 Ga0207652_10008538 3300025921 Bacteria 8245
223 Ga0207652_10073788 3300025921 Bacteria 2969
224 Ga0207652_10124816 3300025921 Bacteria 2292
225 Ga0207652_10179992 3300025921 Bacteria 1899
226 Ga0207652_10289051 3300025921 Bacteria 1479
227 Ga0207652_10410979 3300025921 Bacteria 1221
228 Ga0207652_10734090 3300025921 Bacteria 880
229 Ga0207646_10556034 3300025922 Bacteria 1031
230 Ga0207694_10812772 3300025924 Bacteria 790
231 Ga0207700_10196094 3300025928 Bacteria 1699
232 Ga0207700_10259658 3300025928 Bacteria 1487
233 Ga0207700_10558313 3300025928 Bacteria 1017
234 Ga0207700_10801061 3300025928 Bacteria 843
235 Ga0207700_11500622 3300025928 Unclassified 598
236 Ga0207664_10293732 3300025929 Bacteria 1428
237 Ga0207664_10406358 3300025929 Bacteria 1212
238 Ga0207664_10490049 3300025929 Bacteria 1100
239 Ga0207664_10624190 3300025929 Bacteria 968
240 Ga0207664_10717691 3300025929 Bacteria 899
241 Ga0207664_11576278 3300025929 Bacteria 579
242 Ga0207644_10069118 3300025931 Bacteria 2578
243 Ga0207690_10201368 3300025932 Bacteria 1512
244 Ga0207690_10328264 3300025932 Bacteria 1204
245 Ga0207690_10440470 3300025932 Bacteria 1046
246 Ga0207690_10979571 3300025932 Bacteria 703
247 Ga0207686_10080722 3300025934 Bacteria 2121
248 Ga0207709_10073452 3300025935 Bacteria 2179
249 Ga0207669_10921687 3300025937 Bacteria 731
250 Ga0207665_10045679 3300025939 Bacteria 2933
251 Ga0207661_10142347 3300025944 Bacteria 2065
252 Ga0207661_10263682 3300025944 Bacteria 1535
253 Ga0207661_10331931 3300025944 Bacteria 1369
254 Ga0207661_10354534 3300025944 Unclassified 1324
255 Ga0207667_10041679 3300025949 Bacteria 4881
256 Ga0207667_10098857 3300025949 Bacteria 3010
257 Ga0207667_10312397 3300025949 Bacteria 1605
258 Ga0207667_10476146 3300025949 Bacteria 1268
259 Ga0207640_10401267 3300025981 Bacteria 1117
260 Ga0207640_10479863 3300025981 Bacteria 1031
261 Ga0207640_10991598 3300025981 Bacteria 738
262 Ga0207640_11514817 3300025981 Bacteria 603
263 Ga0207658_11479264 3300025986 Unclassified 621
264 Ga0207639_10087371 3300026041 Bacteria 2485
265 Ga0207639_11144080 3300026041 Bacteria 730
266 Ga0207702_10316248 3300026078 Bacteria 1486
267 Ga0207702_10379260 3300026078 Bacteria 1359
268 Ga0207702_10970894 3300026078 Bacteria 843
269 Ga0207674_10013651 3300026116 Bacteria 8996
270 Ga0207674_10037337 3300026116 Bacteria 5053
271 Ga0207674_10094979 3300026116 Bacteria 2968
272 Ga0207698_10104095 3300026142 Bacteria 2361
273 Ga0207698_10896912 3300026142 Bacteria 894
274 Ga0268266_10146450 3300028379 Bacteria 2124
275 Ga0268266_10505624 3300028379 Bacteria 1154
276 Ga0268266_10721910 3300028379 Bacteria 961
277 Ga0265326_10072201 3300028558 Bacteria 976
278 Ga0265326_10097103 3300028558 Bacteria 836
279 Ga0265326_10114909 3300028558 Bacteria 765
280 Ga0265319_1022754 3300028563 Bacteria 2278
281 Ga0265334_10015414 3300028573 Bacteria 3175
282 Ga0265318_10024360 3300028577 Bacteria 2400
283 Ga0265318_10036713 3300028577 Bacteria 1879
284 Ga0265318_10194747 3300028577 Bacteria 741
285 Ga0265318_10302164 3300028577 Unclassified 584
286 Ga0265318_10325976 3300028577 Bacteria 560
287 Ga0265322_10084994 3300028654 Bacteria 898
288 Ga0265336_10107485 3300028666 Bacteria 831
289 Ga0265338_10145828 3300028800 Bacteria 1846
290 Ga0265338_10352568 3300028800 Bacteria 1058
291 Ga0265330_10322773 3300031235 Unclassified 651
292 Ga0265320_10164677 3300031240 Unclassified 997
293 Ga0265320_10255561 3300031240 Bacteria 777
294 Ga0265325_10084041 3300031241 Bacteria 1578
295 Ga0265329_10005422 3300031242 Bacteria 5155
296 Ga0265340_10071594 3300031247 Bacteria 1643
297 Ga0265340_10271343 3300031247 Bacteria 754
298 Ga0265339_10042291 3300031249 Bacteria 2523
299 Ga0265331_10525850 3300031250 Bacteria 533
300 Ga0265327_10020347 3300031251 Bacteria 4047
301 Ga0265327_10217616 3300031251 Bacteria 860
302 Ga0265316_10006791 3300031344 Bacteria 10883
303 Ga0265313_10015119 3300031595 Bacteria 4517
304 Ga0265313_10409746 3300031595 Bacteria 531
305 Ga0265313_10417362 3300031595 Bacteria 525
306 Ga0265314_10083176 3300031711 Bacteria 2105
307 Ga0265342_10216198 3300031712 Bacteria 1034
308 Ga0373926_0445888 3300035083 Bacteria 513
309 Ga0373934_0124656 3300035086 Bacteria 1049
310 Ga0373944_0004983 3300035089 Bacteria 3484
311 Ga0373936_0006891 3300035113 Bacteria 4276
312 Ga0373936_0036976 3300035113 Bacteria 1948
313 Ga0373945_0004972 3300035116 Bacteria 4237
314 Ga0373945_0023953 3300035116 Bacteria 2112
315 Ga0373943_0000948 3300035170 Bacteria 12836
316 Ga0373943_0002379 3300035170 Bacteria 8526
317 Ga0373946_0005491 3300035171 Bacteria 4575
318 Ga0373946_0009343 3300035171 Bacteria 3610
319 Ga0373935_0078557 3300035692 Bacteria 2141
320 Ga0373935_1246958 3300035692 Bacteria 555
321 Ga0373927_0098774 3300035695 Bacteria 1898
322 Ga0373947_0004316 3300035725 Bacteria 8354
323 Ga0373947_0042584 3300035725 Bacteria 2710
324 Ga0373937_0022248 3300036401 Bacteria 5698
325 Ga0373925_0002209 3300037068 Bacteria 15801
326 Ga0373925_0003468 3300037068 Bacteria 12198
327 Ga0395899_0020351 3300037312 Bacteria 5032
328 Ga0395899_0353746 3300037312 Bacteria 982
329 Ga0395900_0038676 3300037418 Bacteria 4918
330 Ga0395900_0114403 3300037418 Bacteria 2769
331 Ga0395900_0334727 3300037418 Bacteria 1491
332 Ga0395900_0553667 3300037418 Bacteria 1094
333 Ga0395900_0738965 3300037418 Unclassified 915
334 Ga0395898_0001107 3300037466 Bacteria 41584
335 Ga0395898_0018107 3300037466 Bacteria 7188
336 Ga0395898_0143032 3300037466 Bacteria 2290
337 Ga0395898_0409590 3300037466 Bacteria 1292
338 Ga0395898_0530888 3300037466 Bacteria 1118
339 Ga0395898_0587186 3300037466 Bacteria 1057
340 Ga0395898_0641807 3300037466 Bacteria 1004
341 Ga0395898_1825804 3300037466 Bacteria 529
342 Ga0395905_0038167 3300037471 Bacteria 4506
343 Ga0395905_0054118 3300037471 Bacteria 3756
344 Ga0395905_0170816 3300037471 Bacteria 2042
345 Ga0395905_1538912 3300037471 Bacteria 570
346 Ga0436364_0487198 3300037853 Bacteria 1890
347 Ga0395901_0008954 3300038443 Bacteria 10136
348 Ga0395901_0025400 3300038443 Bacteria 6081
349 Ga0395901_0049034 3300038443 Bacteria 4386
350 Ga0395901_0055882 3300038443 Bacteria 4106
351 Ga0395901_0113834 3300038443 Bacteria 2841
352 Ga0395901_0140984 3300038443 Bacteria 2533
353 Ga0395901_0575086 3300038443 Bacteria 1139
354 Ga0436365_0051096 3300039437 Bacteria 2379
355 Ga0436365_0339077 3300039437 Bacteria 873
356 Ga0436365_0363511 3300039437 Bacteria 550
357 Ga0436365_1398328 3300039437 Bacteria 913
358 Ga0436363_0607730 3300039450 Bacteria 959
359 Ga0436363_0836012 3300039450 Bacteria 779
360 Ga0451853_0501066 3300041512 Unclassified 831
361 Ga0451853_1171360 3300041512 Bacteria 752
362 Ga0451853_3214315 3300041512 Bacteria 1177
363 Ga0439448_0155872 3300042005 Bacteria 793
364 Ga0466969_0391819 3300044656 Bacteria 630
365 Ga0466972_0053661 3300044658 Bacteria 1941
366 Ga0466966_0016811 3300044684 Bacteria 4833
367 Ga0466966_0022126 3300044684 Bacteria 4174
368 Ga0466966_0094871 3300044684 Bacteria 1849
369 Ga0466966_0310582 3300044684 Bacteria 947
370 Ga0466966_0345570 3300044684 Bacteria 894
371 Ga0466961_0002757 3300044693 Bacteria 10933
372 Ga0466961_0090783 3300044693 Bacteria 1929
373 Ga0466961_0186453 3300044693 Bacteria 1287
374 Ga0466961_0590800 3300044693 Bacteria 668
375 Ga0466963_0000487 3300044694 Bacteria 18499
376 Ga0466963_0004277 3300044694 Bacteria 8287
377 Ga0466963_0016853 3300044694 Bacteria 4549
378 Ga0466963_0018778 3300044694 Bacteria 4328
379 Ga0466963_0056356 3300044694 Bacteria 2615
380 Ga0466963_0104879 3300044694 Bacteria 1937
381 Ga0466963_0210970 3300044694 Bacteria 1359
382 Ga0466963_0307339 3300044694 Bacteria 1115
383 Ga0466963_0380949 3300044694 Bacteria 994
384 Ga0466963_0584524 3300044694 Bacteria 789
385 Ga0466963_1255871 3300044694 Bacteria 520
386 Ga0466964_0022497 3300044706 Bacteria 2446
387 Ga0466964_0042204 3300044706 Bacteria 1847
388 Ga0466971_0009936 3300044719 Bacteria 4157
389 Ga0466971_0059448 3300044719 Bacteria 1726
390 Ga0466971_0069650 3300044719 Bacteria 1596
391 Ga0466968_0199206 3300044735 Bacteria 937
392 Ga0466968_0271785 3300044735 Bacteria 809
393 Ga0466968_0337601 3300044735 Bacteria 730
394 Ga0466970_0193162 3300044765 Bacteria 1132
395 Ga0466970_0328670 3300044765 Bacteria 865
396 Ga0466970_0380457 3300044765 Bacteria 803
397 Ga0466957_0014196 3300044842 Bacteria 4636
398 Ga0466957_0025109 3300044842 Bacteria 3530
399 Ga0466957_0044836 3300044842 Bacteria 2681
400 Ga0466957_0194522 3300044842 Bacteria 1330
401 Ga0466957_0461431 3300044842 Bacteria 876
402 Ga0466957_0904286 3300044842 Bacteria 631
403 Ga0466957_0952459 3300044842 Bacteria 615
404 Ga0466960_0713352 3300044901 Unclassified 602
405 Ga0466960_0868216 3300044901 Bacteria 549
406 Ga0466960_1017737 3300044901 Bacteria 509
407 Ga0466959_0017099 3300045049 Bacteria 5311
408 Ga0466959_0022425 3300045049 Bacteria 4668
409 Ga0466959_0084957 3300045049 Bacteria 2278
410 Ga0466959_0249591 3300045049 Bacteria 1224
411 Ga0466959_0415157 3300045049 Bacteria 914
412 Ga0466958_0001591 3300045836 Bacteria 10906
413 Ga0466958_0050316 3300045836 Bacteria 2523
414 Ga0466958_0054812 3300045836 Bacteria 2418
415 Ga0466958_0057134 3300045836 Bacteria 2371
416 Ga0466958_0095184 3300045836 Bacteria 1846
417 Ga0466967_0003721 3300045976 Bacteria 10050
418 Ga0466967_0006973 3300045976 Bacteria 8086
419 Ga0466967_0007599 3300045976 Bacteria 7838
420 Ga0466967_0059291 3300045976 Bacteria 3387
421 Ga0466967_0074080 3300045976 Bacteria 3056
422 Ga0466967_0080040 3300045976 Bacteria 2947
423 Ga0466967_0177435 3300045976 Bacteria 2007
424 Ga0466967_0200169 3300045976 Bacteria 1891
425 Ga0466967_0333247 3300045976 Bacteria 1466
426 Ga0466967_0370309 3300045976 Bacteria 1389
427 Ga0466967_0402336 3300045976 Bacteria 1332
428 Ga0466967_0409025 3300045976 Archaea 1321
429 Ga0466967_0666431 3300045976 Bacteria 1029
430 Ga0466967_1023521 3300045976 Bacteria 822
431 Ga0466967_1053021 3300045976 Bacteria 810
432 Ga0466967_1347530 3300045976 Bacteria 711
433 Ga0466967_2113028 3300045976 Bacteria 559
434 Ga0495629_0011581 3300046459 Bacteria 6404
435 Ga0495629_0155815 3300046459 Bacteria 1587
436 Ga0495629_0448770 3300046459 Bacteria 873
437 Ga0495641_0004370 3300046461 Bacteria 10016
438 Ga0495641_0060332 3300046461 Bacteria 1714
439 Ga0495651_0031561 3300046462 Bacteria 4131
440 Ga0495651_0059077 3300046462 Bacteria 2941
441 Ga0495651_0358026 3300046462 Bacteria 962
442 Ga0495653_0023008 3300046463 Bacteria 5039
443 Ga0495653_0227738 3300046463 Unclassified 1249
444 Ga0495653_0486204 3300046463 Unclassified 771
445 Ga0495653_0691595 3300046463 Unclassified 620
446 Ga0495580_0759052 3300046472 Unclassified 631
447 Ga0495582_0000040 3300046473 Bacteria 66496
448 Ga0495582_0500485 3300046473 Unclassified 702
449 Ga0495639_0021449 3300046475 Bacteria 2828
450 Ga0495639_0083208 3300046475 Bacteria 1493
451 Ga0495662_0005440 3300046476 Bacteria 6376
452 Ga0495662_0460008 3300046476 Bacteria 624
453 Ga0495664_0238967 3300046477 Unclassified 1099
454 Ga0495664_0425453 3300046477 Bacteria 796
455 Ga0495594_0166353 3300046499 Bacteria 1254
456 Ga0495594_0170660 3300046499 Bacteria 1237
457 Ga0495608_0020944 3300046511 Bacteria 4491
458 Ga0495608_0087024 3300046511 Bacteria 2024
459 Ga0495608_0320641 3300046511 Bacteria 957
460 Ga0495618_0030531 3300046514 Bacteria 3366
461 Ga0495618_0057284 3300046514 Bacteria 2467
462 Ga0495628_0027655 3300046516 Bacteria 4612
463 Ga0495628_0099461 3300046516 Bacteria 2246
464 Ga0495628_0326913 3300046516 Bacteria 1131
465 Ga0495628_0975628 3300046516 Bacteria 584
466 Ga0495630_0050229 3300046517 Bacteria 3121
467 Ga0495630_0085977 3300046517 Bacteria 2374
468 Ga0495630_0139750 3300046517 Bacteria 1841
469 Ga0495630_0269092 3300046517 Unclassified 1302
470 Ga0495666_0148724 3300046526 Unclassified 1090
471 Ga0495666_0151560 3300046526 Unclassified 1078
472 Ga0495652_0018324 3300046529 Bacteria 6244
473 Ga0495652_0081364 3300046529 Bacteria 2671
474 Ga0495652_0380713 3300046529 Bacteria 1004
475 Ga0495665_0001332 3300046531 Bacteria 13180
476 Ga0495665_0070214 3300046531 Bacteria 1846
477 Ga0495665_0104180 3300046531 Bacteria 1489
478 Ga0495640_0012742 3300046533 Bacteria 6419
479 Ga0495640_0040719 3300046533 Bacteria 3252
480 Ga0495586_0835541 3300046535 Unclassified 531
481 Ga0495587_0207388 3300046536 Bacteria 1107
482 Ga0495645_0099483 3300046543 Bacteria 2069
483 Ga0495645_0111605 3300046543 Bacteria 1934
484 Ga0495667_0046190 3300046559 Bacteria 2880
485 Ga0495667_0050597 3300046559 Bacteria 2742
486 Ga0495667_0131939 3300046559 Bacteria 1611
487 Ga0495667_0545770 3300046559 Unclassified 724
488 Ga0495634_0023628 3300046642 Bacteria 4318
489 Ga0495634_0068681 3300046642 Bacteria 2340
490 Ga0495634_0338473 3300046642 Bacteria 903
491 Ga0495635_0007101 3300046663 Bacteria 7831
492 Ga0495635_0148063 3300046663 Bacteria 1598
493 Ga0495635_0589439 3300046663 Bacteria 726
494 Ga0495635_0831678 3300046663 Bacteria 594
495 Ga0495657_0018056 3300046675 Bacteria 5112
496 Ga0495657_0148829 3300046675 Bacteria 1455
497 Ga0495599_0029145 3300046678 Bacteria 3460
498 Ga0495599_0068685 3300046678 Bacteria 2212
499 Ga0495623_0053086 3300046679 Bacteria 2560
500 Ga0495646_0338722 3300046680 Unclassified 789
501 Ga0495647_0009242 3300046681 Bacteria 3333
502 Ga0495658_0012210 3300046683 Bacteria 4342
503 Ga0495658_0013860 3300046683 Bacteria 4109
504 Ga0495613_0001753 3300046689 Bacteria 16515
505 Ga0495613_0017257 3300046689 Bacteria 5379
506 Ga0495613_0181007 3300046689 Bacteria 1493
507 Ga0495613_0464926 3300046689 Bacteria 856
508 Ga0495624_0008110 3300046690 Bacteria 7352
509 Ga0495624_0177191 3300046690 Bacteria 1300
510 Ga0495624_0564690 3300046690 Bacteria 679
511 Ga0495600_0029074 3300046809 Bacteria 3578
512 Ga0495600_0273763 3300046809 Bacteria 1070
513 Ga0495581_0051217 3300047315 Bacteria 2384
514 Ga0495581_0058465 3300047315 Bacteria 2227
515 Ga0495604_0030951 3300047317 Bacteria 4246
516 Ga0495604_0051210 3300047317 Bacteria 3202
517 Ga0495604_0150480 3300047317 Bacteria 1654
518 Ga0495604_0834219 3300047317 Bacteria 579
519 Ga0495674_0000944 3300047319 Bacteria 27747
520 Ga0495674_0491457 3300047319 Bacteria 982
521 Ga0495674_0699524 3300047319 Unclassified 795
522 Ga0495676_0002583 3300047321 Bacteria 16138
523 Ga0495676_0726196 3300047321 Unclassified 642
524 Ga0495680_0000491 3300047322 Bacteria 44586
525 Ga0495680_0033094 3300047322 Bacteria 4189
526 Ga0495680_0222644 3300047322 Bacteria 1346
527 Ga0495680_0455837 3300047322 Bacteria 874
528 Ga0495675_0238619 3300047444 Unclassified 1095
529 Ga0495684_0015354 3300047471 Bacteria 5893
530 Ga0495684_0034251 3300047471 Bacteria 3897
531 Ga0495684_0161542 3300047471 Bacteria 1670
532 Ga0495593_0017268 3300047673 Bacteria 4061
533 Ga0495593_0643496 3300047673 Bacteria 532
534 Ga0495602_0055750 3300048088 Bacteria 3479
535 Ga0495602_1001491 3300048088 Unclassified 551
536 Ga0495614_0012901 3300048089 Bacteria 3664
537 Ga0496100_0011860 3300048903 Bacteria 4975
538 Ga0496100_0019682 3300048903 Bacteria 4032
539 Ga0496100_0122452 3300048903 Bacteria 1821
540 Ga0496100_0138030 3300048903 Bacteria 1725
541 Ga0496101_0002875 3300048904 Bacteria 10590
542 Ga0496101_0006382 3300048904 Bacteria 7588
543 Ga0496101_0022767 3300048904 Bacteria 4317
544 Ga0496101_0062992 3300048904 Bacteria 2698
545 Ga0496101_0565455 3300048904 Bacteria 899
546 Ga0496102_0441205 3300048905 Bacteria 1222
547 Ga0496102_0451225 3300048905 Bacteria 1206
548 Ga0496102_0492063 3300048905 Bacteria 1148
549 Ga0496102_1446058 3300048905 Unclassified 606
550 Ga0496103_0067736 3300048906 Bacteria 2230
551 Ga0496103_0266331 3300048906 Bacteria 1102
552 Ga0496104_0003577 3300048907 Bacteria 13415
553 Ga0496104_0094065 3300048907 Bacteria 2867
554 Ga0496105_0014421 3300048908 Bacteria 6291
555 Ga0496105_0038700 3300048908 Bacteria 3929
556 Ga0496106_0005708 3300048909 Bacteria 9207
557 Ga0496106_0028289 3300048909 Bacteria 4175
558 Ga0496107_0002187 3300048910 Bacteria 12564
559 Ga0496107_0011455 3300048910 Bacteria 6178
560 Ga0496107_0028089 3300048910 Bacteria 3997
561 Ga0496107_0571850 3300048910 Bacteria 836
562 Ga0496108_0030770 3300048911 Bacteria 4448
563 Ga0496109_0004651 3300048912 Bacteria 11458
564 Ga0496110_0005481 3300048913 Bacteria 9950
565 Ga0496111_0145059 3300048914 Unclassified 1760
566 Ga0496112_0009752 3300048915 Bacteria 8669
567 Ga0496112_0098840 3300048915 Bacteria 2888
568 Ga0496112_0271956 3300048915 Bacteria 1642
569 Ga0496112_0380791 3300048915 Bacteria 1352
570 Ga0496112_0417175 3300048915 Bacteria 1281
571 Ga0496112_0483599 3300048915 Bacteria 1174
572 Ga0496113_0161889 3300048916 Bacteria 1769
573 Ga0496114_0001055 3300048917 Bacteria 20710
574 Ga0496114_0017212 3300048917 Bacteria 5831
575 Ga0496114_0057692 3300048917 Bacteria 3241
576 Ga0496114_0119045 3300048917 Bacteria 2270
577 Ga0496114_0248673 3300048917 Bacteria 1564
578 Ga0496114_0968823 3300048917 Bacteria 733
579 Ga0496115_0000632 3300048918 Bacteria 26543
580 Ga0496115_0001930 3300048918 Bacteria 14798
581 Ga0496115_0036370 3300048918 Bacteria 3898
582 Ga0496115_0049606 3300048918 Bacteria 3361
583 Ga0496115_0124846 3300048918 Bacteria 2120
584 Ga0496115_0130654 3300048918 Bacteria 2070
585 Ga0496115_1281613 3300048918 Bacteria 547
586 Ga0501046_0148681 3300049580 Bacteria 1768
587 Ga0501067_0362294 3300049583 Bacteria 808
588 Ga0501067_0476646 3300049583 Bacteria 697
589 Ga0501068_0431217 3300049584 Bacteria 852
590 Ga0501069_0003463 3300049585 Bacteria 8122
591 Ga0501070_0047761 3300049586 Bacteria 3556
592 Ga0501074_0038200 3300049590 Bacteria 3479
593 Ga0501079_0121798 3300049741 Bacteria 2029
594 Ga0501080_0329992 3300049742 Bacteria 1380
595 Ga0501080_0350079 3300049742 Bacteria 1334
596 Ga0501035_0663802 3300049822 Bacteria 844
597 Ga0501044_0936620 3300049823 Unclassified 740
598 nmdc:mga0n895_196339_c1 3300050512 Bacteria 2049
599 nmdc:mga0rr50_206224_c1 3300050513 Bacteria 1618
600 nmdc:mga0a205_65652_c1 3300050515 Bacteria 3506
601 Ga0495601_0144136 3300053077 Bacteria 1554
602 Ga0495612_0095270 3300053078 Bacteria 1264
603 Ga0495612_0106445 3300053078 Bacteria 1197
604 Ga0495612_0235098 3300053078 Bacteria 813
605 Ga0495655_0064812 3300053083 Bacteria 1006
606 Ga0495595_0027542 3300053084 Bacteria 2533
607 Ga0495595_0249528 3300053084 Bacteria 888
608 Ga0495595_0728738 3300053084 Unclassified 508
609 Ga0495619_0006179 3300053085 Bacteria 7590
610 Ga0495619_0012401 3300053085 Bacteria 5367
611 Ga0495619_0072021 3300053085 Bacteria 2313
612 Ga0495619_0341857 3300053085 Bacteria 1035
613 Ga0466962_0005130 3300061719 Bacteria 6300
614 Ga0466962_0021310 3300061719 Bacteria 3113
615 Ga0466962_0118948 3300061719 Bacteria 1274
616 Ga0395905_1763893
617 Ga0070658_10117259
618 Ga0070658_10556520
619 Ga0070683_100033669
620 Ga0070683_100166393
621 Ga0070683_100446625
622 Ga0070683_100480981
623 Ga0070683_100483465
624 Ga0070683_101471767
625 Ga0070680_100004608
626 Ga0070680_100042465
627 Ga0070680_100220819
628 Ga0070680_100635884
629 Ga0070680_100984236
630 Ga0070682_100699102
631 Ga0070682_100860341
632 Ga0068868_101900280
633 Ga0070660_100009902
634 Ga0070660_100030865
635 Ga0070660_100081294
636 Ga0070660_100311169
637 Ga0070661_100016735
638 Ga0070661_100091534
639 Ga0070661_100212750
640 Ga0070661_100225751
641 Ga0070661_100293485
642 Ga0070661_100453278
643 Ga0070661_100665806
644 Ga0070671_100034425
645 Ga0070674_100413307
646 Ga0070659_100045786
647 Ga0070659_100289537
648 Ga0070659_100844603
649 Ga0070709_10133237
650 Ga0070709_10252940
651 Ga0070714_100203778
652 Ga0070714_100419339
653 Ga0070714_100745245
654 Ga0070714_102233423
655 Ga0070714_102264621
656 Ga0070713_100123854
657 Ga0070713_100327100
658 Ga0070713_100336363
659 Ga0070713_100376634
660 Ga0070713_100441477
661 Ga0070713_102071263
662 Ga0070710_10208520
663 Ga0070710_10680594
664 Ga0070710_10734107
665 Ga0070711_100158694
666 Ga0070711_100237831
667 Ga0070711_100610999
668 Ga0070694_100156446
669 Ga0070694_100869092
670 Ga0070708_100041394
671 Ga0070708_100760390
672 Ga0070663_101896887
673 Ga0070663_102024421
674 Ga0070681_10002298
675 Ga0070681_10032887
676 Ga0070681_10057112
677 Ga0070681_10072429
678 Ga0070681_10252594
679 Ga0070681_10377917
680 Ga0070681_10496471
681 Ga0070681_10938449
682 Ga0070706_100312089
683 Ga0070707_100465116
684 Ga0070699_100181989
685 Ga0070679_100027597
686 Ga0070679_100033861
687 Ga0070679_100052007
688 Ga0070679_100088497
689 Ga0070679_100139644
690 Ga0070679_100230097
691 Ga0070679_100337207
692 Ga0070679_100997200
693 Ga0070679_101322118
694 Ga0070684_100071253
695 Ga0070684_100256259
696 Ga0070684_100634970
697 Ga0070684_101869529
698 Ga0068853_100204962
699 Ga0068853_100442766
700 Ga0068853_101099431
701 Ga0070696_100086784
702 Ga0070665_100144368
703 Ga0070665_100193220
704 Ga0070665_100743530
705 Ga0068855_100005352
706 Ga0068855_100076377
707 Ga0068855_100108378
708 Ga0068855_100516077
709 Ga0068855_101176030
710 Ga0068855_101895689
711 Ga0068857_100025774
712 Ga0068857_100062159
713 Ga0068857_100226988
714 Ga0068857_102438558
715 Ga0068854_101092670
716 Ga0068854_101421448
717 Ga0068856_100244868
718 Ga0068856_100317430
719 Ga0068856_100490452
720 Ga0068856_101517501
721 Ga0068852_100332471
722 Ga0068852_100387838
723 Ga0081455_10119997
724 Ga0070717_10254818
725 Ga0070717_11017382
726 Ga0070715_10034414
727 Ga0070716_100516846
728 Ga0070712_100050393
729 Ga0070712_100156231
730 Ga0070712_100420954
731 Ga0097621_100759745
732 Ga0075433_10537521
733 Ga0075434_100031031
734 Ga0075436_101460346
735 Ga0075435_100012385
736 Ga0105240_10058319
737 Ga0105240_10689415
738 Ga0105240_11255580
739 Ga0105245_11486130
740 Ga0114129_12232996
741 Ga0105243_10202123
742 Ga0105241_10218387
743 Ga0105241_10504720
744 Ga0105241_11565296
745 Ga0105242_10105133
746 Ga0105242_12258738
747 Ga0105237_10101828
748 Ga0105238_11638741
749 Ga0105239_10184248
750 Ga0105239_10580333
751 Ga0105239_11908736
752 Ga0105246_11288298
753 Ga0105246_12134643
754 Ga0157371_11494192
755 Ga0157370_10016647
756 Ga0157370_10155563
757 Ga0157370_10348308
758 Ga0157370_10385930
759 Ga0157370_10888439
760 Ga0157369_10344225
761 Ga0157369_10608942
762 Ga0157369_11297595
763 Ga0157374_10072506
764 Ga0157374_11625794
765 Ga0157378_11232651
766 Ga0157372_10166553
767 Ga0157372_10228400
768 Ga0157372_10342725
769 Ga0157372_10342958
770 Ga0157372_10731617
771 Ga0157372_10827407
772 Ga0157372_10989447
773 Ga0157372_11422709
774 Ga0157375_10741173
775 Ga0163163_12359453
776 Ga0182008_10076994
777 Ga0182008_10366446
778 Ga0182008_10376216
779 Ga0197907_11073875
780 Ga0206356_10625028
781 Ga0206356_10777811
782 Ga0206356_11595904
783 Ga0206356_11602287
784 Ga0206356_11870710
785 Ga0206354_10137113
786 Ga0206354_11392751
787 Ga0206353_10676125
788 Ga0206353_11658859
789 Ga0206353_11717398
790 Ga0206353_11788903
791 Ga0213875_10285365
792 Ga0207692_10389183
793 Ga0207685_10141266
794 Ga0207699_10113367
795 Ga0207699_10401221
796 Ga0207699_10530981
797 Ga0207705_10005937
798 Ga0207705_10124189
799 Ga0207705_10305331
800 Ga0207684_10647131
801 Ga0207707_10011475
802 Ga0207707_10015031
803 Ga0207707_10145540
804 Ga0207707_10227914
805 Ga0207707_10616917
806 Ga0207707_10701672
807 Ga0207707_10722175
808 Ga0207695_10050970
809 Ga0207695_10239987
810 Ga0207695_10629827
811 Ga0207671_10013119
812 Ga0207693_10015488
813 Ga0207693_10045609
814 Ga0207663_10107151
815 Ga0207663_10772853
816 Ga0207663_11145537
817 Ga0207663_11286113
818 Ga0207660_10013947
819 Ga0207660_10061195
820 Ga0207660_10089016
821 Ga0207660_10307183
822 Ga0207660_11295910
823 Ga0207660_11692301
824 Ga0207657_10009013
825 Ga0207657_10014652
826 Ga0207657_10031059
827 Ga0207657_10033954
828 Ga0207657_10100224
829 Ga0207657_10288080
830 Ga0207657_10551042
831 Ga0207649_10119841
832 Ga0207649_10121976
833 Ga0207649_10608862
834 Ga0207649_10654785
835 Ga0207649_11295798
836 Ga0207652_10005877
837 Ga0207652_10008538
838 Ga0207652_10073788
839 Ga0207652_10124816
840 Ga0207652_10179992
841 Ga0207652_10289051
842 Ga0207652_10410979
843 Ga0207652_10734090
844 Ga0207646_10556034
845 Ga0207694_10812772
846 Ga0207700_10196094
847 Ga0207700_10259658
848 Ga0207700_10558313
849 Ga0207700_10801061
850 Ga0207700_11500622
851 Ga0207664_10293732
852 Ga0207664_10406358
853 Ga0207664_10490049
854 Ga0207664_10624190
855 Ga0207664_10717691
856 Ga0207664_11576278
857 Ga0207644_10069118
858 Ga0207690_10201368
859 Ga0207690_10328264
860 Ga0207690_10440470
861 Ga0207690_10979571
862 Ga0207686_10080722
863 Ga0207709_10073452
864 Ga0207669_10921687
865 Ga0207665_10045679
866 Ga0207661_10142347
867 Ga0207661_10263682
868 Ga0207661_10331931
869 Ga0207661_10354534
870 Ga0207667_10041679
871 Ga0207667_10098857
872 Ga0207667_10312397
873 Ga0207667_10476146
874 Ga0207640_10401267
875 Ga0207640_10479863
876 Ga0207640_10991598
877 Ga0207640_11514817
878 Ga0207658_11479264
879 Ga0207639_10087371
880 Ga0207639_11144080
881 Ga0207702_10316248
882 Ga0207702_10379260
883 Ga0207702_10970894
884 Ga0207674_10013651
885 Ga0207674_10037337
886 Ga0207674_10094979
887 Ga0207698_10104095
888 Ga0207698_10896912
889 Ga0268266_10146450
890 Ga0268266_10505624
891 Ga0268266_10721910
892 Ga0265326_10072201
893 Ga0265326_10097103
894 Ga0265326_10114909
895 Ga0265319_1022754
896 Ga0265334_10015414
897 Ga0265318_10024360
898 Ga0265318_10036713
899 Ga0265318_10194747
900 Ga0265318_10302164
901 Ga0265318_10325976
902 Ga0265322_10084994
903 Ga0265336_10107485
904 Ga0265338_10145828
905 Ga0265338_10352568
906 Ga0265330_10322773
907 Ga0265320_10164677
908 Ga0265320_10255561
909 Ga0265325_10084041
910 Ga0265329_10005422
911 Ga0265340_10071594
912 Ga0265340_10271343
913 Ga0265339_10042291
914 Ga0265331_10525850
915 Ga0265327_10020347
916 Ga0265327_10217616
917 Ga0265316_10006791
918 Ga0265313_10015119
919 Ga0265313_10409746
920 Ga0265313_10417362
921 Ga0265314_10083176
922 Ga0265342_10216198
923 Ga0373926_0445888
924 Ga0373934_0124656
925 Ga0373944_0004983
926 Ga0373936_0006891
927 Ga0373936_0036976
928 Ga0373945_0004972
929 Ga0373945_0023953
930 Ga0373943_0000948
931 Ga0373943_0002379
932 Ga0373946_0005491
933 Ga0373946_0009343
934 Ga0373935_0078557
935 Ga0373935_1246958
936 Ga0373927_0098774
937 Ga0373947_0004316
938 Ga0373947_0042584
939 Ga0373937_0022248
940 Ga0373925_0002209
941 Ga0373925_0003468
942 Ga0395899_0020351
943 Ga0395899_0353746
944 Ga0395900_0038676
945 Ga0395900_0114403
946 Ga0395900_0334727
947 Ga0395900_0553667
948 Ga0395900_0738965
949 Ga0395898_0001107
950 Ga0395898_0018107
951 Ga0395898_0143032
952 Ga0395898_0409590
953 Ga0395898_0530888
954 Ga0395898_0587186
955 Ga0395898_0641807
956 Ga0395898_1825804
957 Ga0395905_0038167
958 Ga0395905_0054118
959 Ga0395905_0170816
960 Ga0395905_1538912
961 Ga0436364_0487198
962 Ga0395901_0008954
963 Ga0395901_0025400
964 Ga0395901_0049034
965 Ga0395901_0055882
966 Ga0395901_0113834
967 Ga0395901_0140984
968 Ga0395901_0575086
969 Ga0436365_0051096
970 Ga0436365_0339077
971 Ga0436365_0363511
972 Ga0436365_1398328
973 Ga0436363_0607730
974 Ga0436363_0836012
975 Ga0451853_0501066
976 Ga0451853_1171360
977 Ga0451853_3214315
978 Ga0439448_0155872
979 Ga0466969_0391819
980 Ga0466972_0053661
981 Ga0466966_0016811
982 Ga0466966_0022126
983 Ga0466966_0094871
984 Ga0466966_0310582
985 Ga0466966_0345570
986 Ga0466961_0002757
987 Ga0466961_0090783
988 Ga0466961_0186453
989 Ga0466961_0590800
990 Ga0466963_0000487
991 Ga0466963_0004277
992 Ga0466963_0016853
993 Ga0466963_0018778
994 Ga0466963_0056356
995 Ga0466963_0104879
996 Ga0466963_0210970
997 Ga0466963_0307339
998 Ga0466963_0380949
999 Ga0466963_0584524
1000 Ga0466963_1255871
1001 Ga0466964_0022497
1002 Ga0466964_0042204
1003 Ga0466971_0009936
1004 Ga0466971_0059448
1005 Ga0466971_0069650
1006 Ga0466968_0199206
1007 Ga0466968_0271785
1008 Ga0466968_0337601
1009 Ga0466970_0193162
1010 Ga0466970_0328670
1011 Ga0466970_0380457
1012 Ga0466957_0014196
1013 Ga0466957_0025109
1014 Ga0466957_0044836
1015 Ga0466957_0194522
1016 Ga0466957_0461431
1017 Ga0466957_0904286
1018 Ga0466957_0952459
1019 Ga0466960_0713352
1020 Ga0466960_0868216
1021 Ga0466960_1017737
1022 Ga0466959_0017099
1023 Ga0466959_0022425
1024 Ga0466959_0084957
1025 Ga0466959_0249591
1026 Ga0466959_0415157
1027 Ga0466958_0001591
1028 Ga0466958_0050316
1029 Ga0466958_0054812
1030 Ga0466958_0057134
1031 Ga0466958_0095184
1032 Ga0466967_0003721
1033 Ga0466967_0006973
1034 Ga0466967_0007599
1035 Ga0466967_0059291
1036 Ga0466967_0074080
1037 Ga0466967_0080040
1038 Ga0466967_0177435
1039 Ga0466967_0200169
1040 Ga0466967_0333247
1041 Ga0466967_0370309
1042 Ga0466967_0402336
1043 Ga0466967_0409025
1044 Ga0466967_0666431
1045 Ga0466967_1023521
1046 Ga0466967_1053021
1047 Ga0466967_1347530
1048 Ga0466967_2113028
1049 Ga0495629_0011581
1050 Ga0495629_0155815
1051 Ga0495629_0448770
1052 Ga0495641_0004370
1053 Ga0495641_0060332
1054 Ga0495651_0031561
1055 Ga0495651_0059077
1056 Ga0495651_0358026
1057 Ga0495653_0023008
1058 Ga0495653_0227738
1059 Ga0495653_0486204
1060 Ga0495653_0691595
1061 Ga0495580_0759052
1062 Ga0495582_0000040
1063 Ga0495582_0500485
1064 Ga0495639_0021449
1065 Ga0495639_0083208
1066 Ga0495662_0005440
1067 Ga0495662_0460008
1068 Ga0495664_0238967
1069 Ga0495664_0425453
1070 Ga0495594_0166353
1071 Ga0495594_0170660
1072 Ga0495608_0020944
1073 Ga0495608_0087024
1074 Ga0495608_0320641
1075 Ga0495618_0030531
1076 Ga0495618_0057284
1077 Ga0495628_0027655
1078 Ga0495628_0099461
1079 Ga0495628_0326913
1080 Ga0495628_0975628
1081 Ga0495630_0050229
1082 Ga0495630_0085977
1083 Ga0495630_0139750
1084 Ga0495630_0269092
1085 Ga0495666_0148724
1086 Ga0495666_0151560
1087 Ga0495652_0018324
1088 Ga0495652_0081364
1089 Ga0495652_0380713
1090 Ga0495665_0001332
1091 Ga0495665_0070214
1092 Ga0495665_0104180
1093 Ga0495640_0012742
1094 Ga0495640_0040719
1095 Ga0495586_0835541
1096 Ga0495587_0207388
1097 Ga0495645_0099483
1098 Ga0495645_0111605
1099 Ga0495667_0046190
1100 Ga0495667_0050597
1101 Ga0495667_0131939
1102 Ga0495667_0545770
1103 Ga0495634_0023628
1104 Ga0495634_0068681
1105 Ga0495634_0338473
1106 Ga0495635_0007101
1107 Ga0495635_0148063
1108 Ga0495635_0589439
1109 Ga0495635_0831678
1110 Ga0495657_0018056
1111 Ga0495657_0148829
1112 Ga0495599_0029145
1113 Ga0495599_0068685
1114 Ga0495623_0053086
1115 Ga0495646_0338722
1116 Ga0495647_0009242
1117 Ga0495658_0012210
1118 Ga0495658_0013860
1119 Ga0495613_0001753
1120 Ga0495613_0017257
1121 Ga0495613_0181007
1122 Ga0495613_0464926
1123 Ga0495624_0008110
1124 Ga0495624_0177191
1125 Ga0495624_0564690
1126 Ga0495600_0029074
1127 Ga0495600_0273763
1128 Ga0495581_0051217
1129 Ga0495581_0058465
1130 Ga0495604_0030951
1131 Ga0495604_0051210
1132 Ga0495604_0150480
1133 Ga0495604_0834219
1134 Ga0495674_0000944
1135 Ga0495674_0491457
1136 Ga0495674_0699524
1137 Ga0495676_0002583
1138 Ga0495676_0726196
1139 Ga0495680_0000491
1140 Ga0495680_0033094
1141 Ga0495680_0222644
1142 Ga0495680_0455837
1143 Ga0495675_0238619
1144 Ga0495684_0015354
1145 Ga0495684_0034251
1146 Ga0495684_0161542
1147 Ga0495593_0017268
1148 Ga0495593_0643496
1149 Ga0495602_0055750
1150 Ga0495602_1001491
1151 Ga0495614_0012901
1152 Ga0496100_0011860
1153 Ga0496100_0019682
1154 Ga0496100_0122452
1155 Ga0496100_0138030
1156 Ga0496101_0002875
1157 Ga0496101_0006382
1158 Ga0496101_0022767
1159 Ga0496101_0062992
1160 Ga0496101_0565455
1161 Ga0496102_0441205
1162 Ga0496102_0451225
1163 Ga0496102_0492063
1164 Ga0496102_1446058
1165 Ga0496103_0067736
1166 Ga0496103_0266331
1167 Ga0496104_0003577
1168 Ga0496104_0094065
1169 Ga0496105_0014421
1170 Ga0496105_0038700
1171 Ga0496106_0005708
1172 Ga0496106_0028289
1173 Ga0496107_0002187
1174 Ga0496107_0011455
1175 Ga0496107_0028089
1176 Ga0496107_0571850
1177 Ga0496108_0030770
1178 Ga0496109_0004651
1179 Ga0496110_0005481
1180 Ga0496111_0145059
1181 Ga0496112_0009752
1182 Ga0496112_0098840
1183 Ga0496112_0271956
1184 Ga0496112_0380791
1185 Ga0496112_0417175
1186 Ga0496112_0483599
1187 Ga0496113_0161889
1188 Ga0496114_0001055
1189 Ga0496114_0017212
1190 Ga0496114_0057692
1191 Ga0496114_0119045
1192 Ga0496114_0248673
1193 Ga0496114_0968823
1194 Ga0496115_0000632
1195 Ga0496115_0001930
1196 Ga0496115_0036370
1197 Ga0496115_0049606
1198 Ga0496115_0124846
1199 Ga0496115_0130654
1200 Ga0496115_1281613
1201 Ga0501046_0148681
1202 Ga0501067_0362294
1203 Ga0501067_0476646
1204 Ga0501068_0431217
1205 Ga0501069_0003463
1206 Ga0501070_0047761
1207 Ga0501074_0038200
1208 Ga0501079_0121798
1209 Ga0501080_0329992
1210 Ga0501080_0350079
1211 Ga0501035_0663802
1212 Ga0501044_0936620
1213 nmdc:mga0n895_196339_c1
1214 nmdc:mga0rr50_206224_c1
1215 nmdc:mga0a205_65652_c1
1216 Ga0495601_0144136
1217 Ga0495612_0095270
1218 Ga0495612_0106445
1219 Ga0495612_0235098
1220 Ga0495655_0064812
1221 Ga0495595_0027542
1222 Ga0495595_0249528
1223 Ga0495595_0728738
1224 Ga0495619_0006179
1225 Ga0495619_0012401
1226 Ga0495619_0072021
1227 Ga0495619_0341857
1228 Ga0466962_0005130
1229 Ga0466962_0021310
1230 Ga0466962_0118948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04456

DUF503

Protein of unknown function (DUF503)

6

91

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.9112 4 95
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.8508 4 95
7bfe-assembly1.cif.gz_E circular permutant of ribosomal protein s6, p54-55 truncated, l21a mutant. 0.7329 7 93
3lgh-assembly1.cif.gz_A crystal structure of nikr from helicobacter pylori with variable ni site coordination 0.7208 4 96
3zzp-assembly1.cif.gz_A circular permutant of ribosomal protein s6, lacking edge strand beta- 2 of wild-type s6. 0.7165 8 82
ID Description Score Start End Superfamily
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9438 5 98 3.30.70.1120
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.916 5 98 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9112 4 95 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.8508 4 95 3.30.70.1120
af_A0A0R0J8S6_5_286_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7202 7 61 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A538BH63-F1-model_v4 DUF503 family protein 0.9732 4 99
AF-A0A538I7C6-F1-model_v4 DUF503 domain-containing protein 0.9714 4 95
AF-A0A2D5BT16-F1-model_v4 DUF503 domain-containing protein 0.9701 5 95
AF-A0A538K267-F1-model_v4 DUF503 domain-containing protein 0.9696 9 98
AF-A0A538EQJ8-F1-model_v4 DUF503 domain-containing protein 0.9608 1 98

Map