F469423
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 615 | 332 | 573 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300005547|Ga0070693_100019375|Ga0070693_1000193752 |
| Length | 373 |
| Sequence | VALGEGKPTSLTLYSGNTAGRSTHPTYNSESHKLAKPSIVRYSFQLARKIRTMRRSPTQSPFDLPSRMSFESMKELHERKDRLEFNKLQKRLRRLTGSAIVDYNMIEDGDKVMVCLSGGKDSYTMLDILMSLQKTAPITFELVAVNMDQKQPGFPEHILPAYLEQVGVPYHIIERDTYSIVKEVIPEGKTTCGLCSRLRRGTLYGFADEIGATKIALGHHRDDIIETLFLNMFFGGKLKAMPPKLLADDKRNIVIRPLSYCAEEDIAHFAELKGFPIIPCNLCGSQENLQRQVVKDMLQVWEQKYPGRTETIFSAIRNVQPSQLADLNLFNFVNLETNKGAAAEDLDTDACGITPLASRTDNAVQYVDVLDLH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 2 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 3 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 4 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 5 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 6 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 7 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 8 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 9 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 10 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 11 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 12 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 13 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 14 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 15 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 16 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 17 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 18 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 19 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 20 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 21 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 22 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 23 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 24 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 25 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 26 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 27 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 28 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 29 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 30 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 31 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 32 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 33 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 34 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 35 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 36 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 37 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 38 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 39 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 40 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 41 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 42 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 43 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 44 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 45 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 46 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 47 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 48 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 49 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 50 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 51 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 52 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 70 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 73 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 123 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 181 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 182 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 201 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 204 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 205 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 206 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 207 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 208 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 209 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 210 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 211 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 212 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 303 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 304 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 307 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 313 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 314 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 320 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 327 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 328 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 329 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 331 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 332 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.17 |
| Metatranscriptomes | 0 |
| Isolates | 6.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.41 |
| Nodule | 0.33 |
| Rhizoplane | 1.95 |
| Rhizosphere | 76.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000030 | 3300002704 | Bacteria | 114492 |
| 2 | JGI25156J39149_1000162 | 3300002705 | Bacteria | 49240 |
| 3 | JGI25162J39368_1004105 | 3300002737 | Bacteria | 3605 |
| 4 | JGI25154J39366_1000056 | 3300002738 | Bacteria | 114494 |
| 5 | JGI25154J39366_1001554 | 3300002738 | Bacteria | 7954 |
| 6 | JGI25157J39369_1000498 | 3300002741 | Bacteria | 24228 |
| 7 | JGI25159J45721_1010443 | 3300002987 | Bacteria | 2362 |
| 8 | JGI25153J46596_10004468 | 3300003215 | Bacteria | 7539 |
| 9 | rootH2_10070928 | 3300003320 | Bacteria | 6285 |
| 10 | rootH1_10012258 | 3300003323 | Bacteria | 148276 |
| 11 | rootH1_10115272 | 3300003323 | Bacteria | 9279 |
| 12 | JGI25160J50197_1014774 | 3300003354 | Bacteria | 2595 |
| 13 | JGI25161J50226_1000863 | 3300003374 | Bacteria | 11197 |
| 14 | Ga0055532_1000059 | 3300003758 | Bacteria | 152948 |
| 15 | Ga0055532_1000359 | 3300003758 | Bacteria | 24174 |
| 16 | Ga0055525_1000031 | 3300003759 | Bacteria | 314909 |
| 17 | Ga0055525_1000236 | 3300003759 | Bacteria | 57698 |
| 18 | Ga0055525_1000243 | 3300003759 | Bacteria | 55208 |
| 19 | Ga0055527_1000070 | 3300003760 | Bacteria | 85704 |
| 20 | Ga0055535_1000117 | 3300003761 | Bacteria | 85705 |
| 21 | Ga0055535_1014228 | 3300003761 | Bacteria | 1150 |
| 22 | Ga0055542_1000156 | 3300003762 | Bacteria | 85704 |
| 23 | Ga0055529_1000353 | 3300003763 | Bacteria | 50427 |
| 24 | Ga0055526_1000030 | 3300003771 | Bacteria | 143833 |
| 25 | Ga0055526_1007526 | 3300003771 | Bacteria | 5635 |
| 26 | Ga0055524_1005727 | 3300003775 | Bacteria | 5503 |
| 27 | Ga0055524_1015863 | 3300003775 | Bacteria | 2728 |
| 28 | Ga0055524_1031271 | 3300003775 | Bacteria | 1534 |
| 29 | Ga0055534_1003949 | 3300003784 | Bacteria | 4472 |
| 30 | Ga0055534_1011314 | 3300003784 | Bacteria | 1821 |
| 31 | Ga0055528_1015918 | 3300003790 | Bacteria | 2688 |
| 32 | Ga0055528_1031448 | 3300003790 | Bacteria | 1381 |
| 33 | Ga0055531_10000001 | 3300003794 | Bacteria | 543586 |
| 34 | Ga0055531_10014922 | 3300003794 | Bacteria | 3465 |
| 35 | Ga0065165_1000772 | 3300005262 | Bacteria | 43168 |
| 36 | Ga0065714_10127593 | 3300005288 | Bacteria | 1280 |
| 37 | Ga0065715_10022803 | 3300005293 | Bacteria | 1911 |
| 38 | Ga0070676_10137126 | 3300005328 | Bacteria | 1553 |
| 39 | Ga0070690_100016167 | 3300005330 | Bacteria | 4464 |
| 40 | Ga0070670_100000001 | 3300005331 | Bacteria | 728788 |
| 41 | Ga0070670_100021572 | 3300005331 | Bacteria | 5539 |
| 42 | Ga0070670_100220619 | 3300005331 | Bacteria | 1649 |
| 43 | Ga0070670_100430360 | 3300005331 | Bacteria | 1167 |
| 44 | Ga0068869_100003613 | 3300005334 | Bacteria | 9492 |
| 45 | Ga0070666_10000989 | 3300005335 | Bacteria | 17380 |
| 46 | Ga0070666_10367400 | 3300005335 | Bacteria | 1031 |
| 47 | Ga0070682_100155467 | 3300005337 | Bacteria | 1574 |
| 48 | Ga0068868_100065307 | 3300005338 | Bacteria | 2891 |
| 49 | Ga0070660_100160137 | 3300005339 | Bacteria | 1813 |
| 50 | Ga0070687_100019808 | 3300005343 | Bacteria | 3137 |
| 51 | Ga0070668_100000210 | 3300005347 | Bacteria | 38311 |
| 52 | Ga0070669_100012030 | 3300005353 | Bacteria | 6140 |
| 53 | Ga0070675_100043763 | 3300005354 | Bacteria | 3660 |
| 54 | Ga0070674_100001560 | 3300005356 | Bacteria | 12278 |
| 55 | Ga0070667_100000294 | 3300005367 | Bacteria | 56218 |
| 56 | Ga0070667_100000331 | 3300005367 | Bacteria | 52620 |
| 57 | Ga0070662_100001733 | 3300005457 | Bacteria | 13422 |
| 58 | Ga0070662_100297798 | 3300005457 | Bacteria | 1310 |
| 59 | Ga0068867_100001702 | 3300005459 | Bacteria | 15330 |
| 60 | Ga0070685_10000049 | 3300005466 | Bacteria | 72567 |
| 61 | Ga0068853_100140174 | 3300005539 | Bacteria | 2170 |
| 62 | Ga0070672_100000286 | 3300005543 | Bacteria | 28584 |
| 63 | Ga0070672_100041120 | 3300005543 | Bacteria | 3552 |
| 64 | Ga0070693_100019375 | 3300005547 | Bacteria | 3565 |
| 65 | Ga0070665_100005658 | 3300005548 | Bacteria | 12848 |
| 66 | Ga0068855_100145221 | 3300005563 | Bacteria | 2701 |
| 67 | Ga0070664_100058792 | 3300005564 | Bacteria | 3270 |
| 68 | Ga0070664_100076556 | 3300005564 | Bacteria | 2875 |
| 69 | Ga0070664_100145962 | 3300005564 | Bacteria | 2086 |
| 70 | Ga0068854_100000287 | 3300005578 | Bacteria | 33813 |
| 71 | Ga0068852_100055576 | 3300005616 | Bacteria | 3417 |
| 72 | Ga0068852_100163918 | 3300005616 | Bacteria | 2078 |
| 73 | Ga0068859_100008427 | 3300005617 | Bacteria | 10441 |
| 74 | Ga0068859_100042640 | 3300005617 | Bacteria | 4558 |
| 75 | Ga0068864_100000012 | 3300005618 | Bacteria | 335070 |
| 76 | Ga0068864_100061979 | 3300005618 | Bacteria | 3239 |
| 77 | Ga0068861_100002282 | 3300005719 | Bacteria | 12446 |
| 78 | Ga0068863_100000638 | 3300005841 | Bacteria | 35489 |
| 79 | Ga0068863_100579341 | 3300005841 | Bacteria | 1110 |
| 80 | Ga0068858_100000623 | 3300005842 | Bacteria | 36873 |
| 81 | Ga0068860_100000600 | 3300005843 | Bacteria | 43032 |
| 82 | Ga0068860_100001020 | 3300005843 | Bacteria | 30989 |
| 83 | Ga0068860_100315844 | 3300005843 | Bacteria | 1533 |
| 84 | Ga0068862_100013761 | 3300005844 | Bacteria | 6705 |
| 85 | Ga0068862_100413696 | 3300005844 | Bacteria | 1264 |
| 86 | Ga0075432_10063753 | 3300006058 | Bacteria | 1316 |
| 87 | Ga0097621_100094490 | 3300006237 | Bacteria | 2507 |
| 88 | Ga0068865_100003535 | 3300006881 | Bacteria | 9372 |
| 89 | Ga0097620_100008426 | 3300006931 | Bacteria | 10441 |
| 90 | Ga0097620_100042638 | 3300006931 | Bacteria | 4558 |
| 91 | Ga0105251_10037296 | 3300009011 | Bacteria | 2386 |
| 92 | Ga0105244_10001189 | 3300009036 | Bacteria | 21505 |
| 93 | Ga0105250_10000004 | 3300009092 | Bacteria | 438653 |
| 94 | Ga0105240_10000344 | 3300009093 | Bacteria | 87083 |
| 95 | Ga0105245_10004988 | 3300009098 | Bacteria | 11668 |
| 96 | Ga0105243_10010278 | 3300009148 | Bacteria | 7113 |
| 97 | Ga0105243_10197363 | 3300009148 | Bacteria | 1762 |
| 98 | Ga0105248_10006169 | 3300009177 | Bacteria | 13140 |
| 99 | Ga0105248_10146359 | 3300009177 | Bacteria | 2666 |
| 100 | Ga0105238_10030435 | 3300009551 | Bacteria | 5495 |
| 101 | Ga0157373_10067347 | 3300013100 | Bacteria | 2532 |
| 102 | Ga0157370_10257097 | 3300013104 | Bacteria | 1614 |
| 103 | Ga0163162_10000701 | 3300013306 | Bacteria | 30951 |
| 104 | Ga0157372_10049628 | 3300013307 | Bacteria | 4667 |
| 105 | Ga0157372_10176004 | 3300013307 | Bacteria | 2476 |
| 106 | Ga0157375_10002767 | 3300013308 | Bacteria | 15170 |
| 107 | Ga0157375_10026291 | 3300013308 | Bacteria | 5421 |
| 108 | Ga0163163_10000162 | 3300014325 | Bacteria | 69827 |
| 109 | Ga0157380_10000472 | 3300014326 | Bacteria | 24494 |
| 110 | Ga0182008_10010622 | 3300014497 | Bacteria | 4925 |
| 111 | Ga0182008_10026551 | 3300014497 | Bacteria | 2937 |
| 112 | Ga0157379_10000208 | 3300014968 | Bacteria | 45395 |
| 113 | Ga0157379_10001128 | 3300014968 | Bacteria | 21831 |
| 114 | Ga0157379_10203142 | 3300014968 | Bacteria | 1792 |
| 115 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 116 | Ga0182007_10000470 | 3300015262 | Bacteria | 24392 |
| 117 | Ga0163161_10023274 | 3300017792 | Bacteria | 4370 |
| 118 | Ga0213872_10000091 | 3300021361 | Bacteria | 83723 |
| 119 | Ga0213872_10000373 | 3300021361 | Bacteria | 37639 |
| 120 | Ga0213872_10000561 | 3300021361 | Bacteria | 28726 |
| 121 | Ga0213872_10039696 | 3300021361 | Bacteria | 2148 |
| 122 | Ga0209435_100032 | 3300025206 | Bacteria | 153068 |
| 123 | Ga0209147_100109 | 3300025229 | Bacteria | 153068 |
| 124 | Ga0209563_100044 | 3300025230 | Bacteria | 396812 |
| 125 | Ga0209437_100260 | 3300025233 | Bacteria | 82215 |
| 126 | Ga0209437_112209 | 3300025233 | Bacteria | 1261 |
| 127 | Ga0209258_100595 | 3300025242 | Bacteria | 29751 |
| 128 | Ga0207425_1000009 | 3300025245 | Bacteria | 593135 |
| 129 | Ga0207425_1000408 | 3300025245 | Bacteria | 28971 |
| 130 | Ga0209646_1000113 | 3300025246 | Bacteria | 153068 |
| 131 | Ga0209646_1000613 | 3300025246 | Bacteria | 13729 |
| 132 | Ga0209026_1000102 | 3300025250 | Bacteria | 153068 |
| 133 | Ga0209759_1000104 | 3300025256 | Bacteria | 153068 |
| 134 | Ga0209129_1000061 | 3300025258 | Bacteria | 246061 |
| 135 | Ga0209129_1008102 | 3300025258 | Bacteria | 2983 |
| 136 | Ga0209565_1000684 | 3300025263 | Bacteria | 21085 |
| 137 | Ga0209565_1000730 | 3300025263 | Bacteria | 19659 |
| 138 | Ga0209455_1005597 | 3300025272 | Bacteria | 3852 |
| 139 | Ga0209673_1026903 | 3300025273 | Bacteria | 1880 |
| 140 | Ga0209675_1004599 | 3300025291 | Bacteria | 6075 |
| 141 | Ga0209675_1007804 | 3300025291 | Bacteria | 4033 |
| 142 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 143 | Ga0209564_1005690 | 3300025295 | Bacteria | 6992 |
| 144 | Ga0209564_1028784 | 3300025295 | Bacteria | 1765 |
| 145 | Ga0209758_1000101 | 3300025297 | Bacteria | 225913 |
| 146 | Ga0209050_1000805 | 3300025298 | Bacteria | 44138 |
| 147 | Ga0209050_1022530 | 3300025298 | Bacteria | 2254 |
| 148 | Ga0209256_1000910 | 3300025299 | Bacteria | 36259 |
| 149 | Ga0209256_1001504 | 3300025299 | Bacteria | 23632 |
| 150 | Ga0209256_1002911 | 3300025299 | Bacteria | 12900 |
| 151 | Ga0207426_1002734 | 3300025302 | Bacteria | 10704 |
| 152 | Ga0209051_1009294 | 3300025303 | Bacteria | 5080 |
| 153 | Ga0209257_1000033 | 3300025304 | Bacteria | 671006 |
| 154 | Ga0209257_1000556 | 3300025304 | Bacteria | 63959 |
| 155 | Ga0209257_1001235 | 3300025304 | Bacteria | 31746 |
| 156 | Ga0209257_1001266 | 3300025304 | Bacteria | 31042 |
| 157 | Ga0207655_1002972 | 3300025728 | Bacteria | 13016 |
| 158 | Ga0207688_10149732 | 3300025901 | Bacteria | 1378 |
| 159 | Ga0207680_10001583 | 3300025903 | Bacteria | 10729 |
| 160 | Ga0207680_10009956 | 3300025903 | Bacteria | 4738 |
| 161 | Ga0207647_10000014 | 3300025904 | Bacteria | 143525 |
| 162 | Ga0207645_10022783 | 3300025907 | Bacteria | 4072 |
| 163 | Ga0207645_10031602 | 3300025907 | Bacteria | 3406 |
| 164 | Ga0207705_10045627 | 3300025909 | Bacteria | 3149 |
| 165 | Ga0207695_10012277 | 3300025913 | Bacteria | 10288 |
| 166 | Ga0207695_10040526 | 3300025913 | Bacteria | 4991 |
| 167 | Ga0207662_10035309 | 3300025918 | Bacteria | 2920 |
| 168 | Ga0207657_10014527 | 3300025919 | Bacteria | 7678 |
| 169 | Ga0207681_10004051 | 3300025923 | Bacteria | 9091 |
| 170 | Ga0207681_10072070 | 3300025923 | Bacteria | 2411 |
| 171 | Ga0207694_10013637 | 3300025924 | Bacteria | 6125 |
| 172 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 173 | Ga0207650_10286988 | 3300025925 | Bacteria | 1341 |
| 174 | Ga0207659_10030922 | 3300025926 | Bacteria | 3661 |
| 175 | Ga0207659_10181085 | 3300025926 | Bacteria | 1669 |
| 176 | Ga0207687_10025555 | 3300025927 | Bacteria | 3952 |
| 177 | Ga0207644_10000065 | 3300025931 | Bacteria | 76549 |
| 178 | Ga0207644_10000378 | 3300025931 | Bacteria | 29004 |
| 179 | Ga0207706_10016222 | 3300025933 | Bacteria | 6731 |
| 180 | Ga0207709_10121229 | 3300025935 | Bacteria | 1766 |
| 181 | Ga0207669_10003679 | 3300025937 | Bacteria | 6663 |
| 182 | Ga0207669_10010197 | 3300025937 | Bacteria | 4515 |
| 183 | Ga0207691_10002401 | 3300025940 | Bacteria | 18333 |
| 184 | Ga0207691_10045422 | 3300025940 | Bacteria | 4038 |
| 185 | Ga0207711_10010530 | 3300025941 | Bacteria | 7684 |
| 186 | Ga0207711_10214006 | 3300025941 | Bacteria | 1761 |
| 187 | Ga0207689_10005498 | 3300025942 | Bacteria | 11332 |
| 188 | Ga0207679_10118722 | 3300025945 | Bacteria | 2101 |
| 189 | Ga0207667_10000432 | 3300025949 | Bacteria | 56395 |
| 190 | Ga0207667_10219657 | 3300025949 | Bacteria | 1947 |
| 191 | Ga0207640_10000208 | 3300025981 | Bacteria | 41443 |
| 192 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 193 | Ga0207677_10042166 | 3300026023 | Bacteria | 3024 |
| 194 | Ga0207703_10003715 | 3300026035 | Bacteria | 12703 |
| 195 | Ga0207703_10541088 | 3300026035 | Bacteria | 1097 |
| 196 | Ga0207639_10116028 | 3300026041 | Bacteria | 2191 |
| 197 | Ga0207708_10026433 | 3300026075 | Bacteria | 4392 |
| 198 | Ga0207641_10017145 | 3300026088 | Bacteria | 5924 |
| 199 | Ga0207641_10017204 | 3300026088 | Bacteria | 5915 |
| 200 | Ga0207648_10024782 | 3300026089 | Bacteria | 5352 |
| 201 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 202 | Ga0207676_10003147 | 3300026095 | Bacteria | 11783 |
| 203 | Ga0207676_10023903 | 3300026095 | Bacteria | 4516 |
| 204 | Ga0207675_100016016 | 3300026118 | Bacteria | 6999 |
| 205 | Ga0207698_10002844 | 3300026142 | Bacteria | 10350 |
| 206 | Ga0207698_10021747 | 3300026142 | Bacteria | 4442 |
| 207 | Ga0207698_10163203 | 3300026142 | Bacteria | 1952 |
| 208 | Ga0268264_10000061 | 3300028381 | Bacteria | 303123 |
| 209 | Ga0268264_10004393 | 3300028381 | Bacteria | 12027 |
| 210 | Ga0268264_10308958 | 3300028381 | Bacteria | 1491 |
| 211 | Ga0307515_10249686 | 3300028794 | Bacteria | 1529 |
| 212 | Ga0316178_1016907 | 3300030735 | Bacteria | 2459 |
| 213 | Ga0316180_1121954 | 3300030736 | Bacteria | 1189 |
| 214 | Ga0265328_10008548 | 3300031239 | Bacteria | 4215 |
| 215 | Ga0265331_10007271 | 3300031250 | Bacteria | 6421 |
| 216 | Ga0265327_10000042 | 3300031251 | Bacteria | 287487 |
| 217 | Ga0307408_100000037 | 3300031548 | Bacteria | 187096 |
| 218 | Ga0307408_100032545 | 3300031548 | Bacteria | 3636 |
| 219 | Ga0307408_100048855 | 3300031548 | Bacteria | 3036 |
| 220 | Ga0265313_10001064 | 3300031595 | Bacteria | 26581 |
| 221 | Ga0316575_10001369 | 3300031665 | Bacteria | 7832 |
| 222 | Ga0265314_10068838 | 3300031711 | Bacteria | 2378 |
| 223 | Ga0307405_10126359 | 3300031731 | Bacteria | 1759 |
| 224 | Ga0307518_10067586 | 3300031838 | Bacteria | 2591 |
| 225 | Ga0307416_100547308 | 3300032002 | Bacteria | 1230 |
| 226 | Ga0307414_10032262 | 3300032004 | Bacteria | 3446 |
| 227 | Ga0307414_10082205 | 3300032004 | Bacteria | 2361 |
| 228 | Ga0307411_10002442 | 3300032005 | Bacteria | 8217 |
| 229 | Ga0307411_10224467 | 3300032005 | Bacteria | 1460 |
| 230 | Ga0307411_10423334 | 3300032005 | Bacteria | 1107 |
| 231 | Ga0373927_0063641 | 3300035695 | Bacteria | 2386 |
| 232 | Ga0316584_0064297 | 3300036712 | Bacteria | 2747 |
| 233 | Ga0395900_0000239 | 3300037418 | Bacteria | 86321 |
| 234 | Ga0395900_0194521 | 3300037418 | Bacteria | 2055 |
| 235 | Ga0395905_0001707 | 3300037471 | Bacteria | 25805 |
| 236 | Ga0395901_0134832 | 3300038443 | Bacteria | 2595 |
| 237 | Ga0436361_0470837 | 3300039447 | Bacteria | 7008 |
| 238 | Ga0436361_0580915 | 3300039447 | Bacteria | 36900 |
| 239 | Ga0436361_0714431 | 3300039447 | Bacteria | 79592 |
| 240 | Ga0436361_0784860 | 3300039447 | Bacteria | 8881 |
| 241 | Ga0439466_0002133 | 3300041411 | Bacteria | 7751 |
| 242 | Ga0451843_1208912 | 3300041509 | Bacteria | 2229 |
| 243 | Ga0451853_1912378 | 3300041512 | Bacteria | 3478 |
| 244 | Ga0439449_0005032 | 3300042007 | Bacteria | 5082 |
| 245 | Ga0439451_002517 | 3300042009 | Bacteria | 3724 |
| 246 | Ga0439454_015276 | 3300042011 | Bacteria | 1074 |
| 247 | Ga0450890_001083 | 3300042127 | Bacteria | 3969 |
| 248 | Ga0450891_000393 | 3300042129 | Bacteria | 4559 |
| 249 | Ga0450892_000695 | 3300042130 | Bacteria | 3779 |
| 250 | Ga0450904_000068 | 3300042139 | Bacteria | 23099 |
| 251 | Ga0450889_000316 | 3300042144 | Bacteria | 5368 |
| 252 | Ga0450893_0006564 | 3300042532 | Bacteria | 1882 |
| 253 | Ga0466972_0003231 | 3300044658 | Bacteria | 8088 |
| 254 | Ga0466965_0017161 | 3300044683 | Bacteria | 3456 |
| 255 | Ga0466966_0028359 | 3300044684 | Bacteria | 3647 |
| 256 | Ga0466968_0001184 | 3300044735 | Bacteria | 9230 |
| 257 | Ga0466957_0030284 | 3300044842 | Bacteria | 3230 |
| 258 | Ga0451576_0230832 | 3300045051 | Bacteria | 1933 |
| 259 | Ga0466958_0090233 | 3300045836 | Bacteria | 1896 |
| 260 | Ga0495617_000157 | 3300046452 | Bacteria | 43264 |
| 261 | Ga0495617_001215 | 3300046452 | Bacteria | 11606 |
| 262 | Ga0495627_029274 | 3300046453 | Bacteria | 1753 |
| 263 | Ga0495603_0025604 | 3300046455 | Bacteria | 3568 |
| 264 | Ga0495590_0000118 | 3300046457 | Bacteria | 47657 |
| 265 | Ga0495590_0001148 | 3300046457 | Bacteria | 11581 |
| 266 | Ga0495591_000214 | 3300046458 | Bacteria | 58417 |
| 267 | Ga0495591_021977 | 3300046458 | Bacteria | 2070 |
| 268 | Ga0495629_0040624 | 3300046459 | Bacteria | 3272 |
| 269 | Ga0495629_0242586 | 3300046459 | Bacteria | 1240 |
| 270 | Ga0495638_0000064 | 3300046460 | Bacteria | 180807 |
| 271 | Ga0495638_0000408 | 3300046460 | Bacteria | 52490 |
| 272 | Ga0495638_0013405 | 3300046460 | Bacteria | 5581 |
| 273 | Ga0495653_0006181 | 3300046463 | Bacteria | 9824 |
| 274 | Ga0495650_0000084 | 3300046471 | Bacteria | 235690 |
| 275 | Ga0495650_0000257 | 3300046471 | Bacteria | 102881 |
| 276 | Ga0495650_0000283 | 3300046471 | Bacteria | 96503 |
| 277 | Ga0495580_0012124 | 3300046472 | Bacteria | 6631 |
| 278 | Ga0495582_0005956 | 3300046473 | Bacteria | 6796 |
| 279 | Ga0495605_0000125 | 3300046474 | Bacteria | 101414 |
| 280 | Ga0495605_0000873 | 3300046474 | Bacteria | 20838 |
| 281 | Ga0495605_0001968 | 3300046474 | Bacteria | 13017 |
| 282 | Ga0495605_0020160 | 3300046474 | Bacteria | 3546 |
| 283 | Ga0495584_0000482 | 3300046491 | Bacteria | 27407 |
| 284 | Ga0495584_0000609 | 3300046491 | Bacteria | 23950 |
| 285 | Ga0495584_0001576 | 3300046491 | Bacteria | 13473 |
| 286 | Ga0495584_0001940 | 3300046491 | Bacteria | 11897 |
| 287 | Ga0495584_0006265 | 3300046491 | Bacteria | 6240 |
| 288 | Ga0495584_0012735 | 3300046491 | Bacteria | 4292 |
| 289 | Ga0495584_0021745 | 3300046491 | Bacteria | 3257 |
| 290 | Ga0495584_0091770 | 3300046491 | Bacteria | 1531 |
| 291 | Ga0495585_0000352 | 3300046492 | Bacteria | 44459 |
| 292 | Ga0495585_0000404 | 3300046492 | Bacteria | 41829 |
| 293 | Ga0495585_0000524 | 3300046492 | Bacteria | 36254 |
| 294 | Ga0495585_0001486 | 3300046492 | Bacteria | 18318 |
| 295 | Ga0495585_0001735 | 3300046492 | Bacteria | 16596 |
| 296 | Ga0495585_0041147 | 3300046492 | Bacteria | 2592 |
| 297 | Ga0495585_0052286 | 3300046492 | Bacteria | 2261 |
| 298 | Ga0495596_0001436 | 3300046500 | Bacteria | 13648 |
| 299 | Ga0495596_0022085 | 3300046500 | Bacteria | 2592 |
| 300 | Ga0495596_0030896 | 3300046500 | Bacteria | 2142 |
| 301 | Ga0495607_0001141 | 3300046501 | Bacteria | 24051 |
| 302 | Ga0495607_0038470 | 3300046501 | Bacteria | 2865 |
| 303 | Ga0495607_0042076 | 3300046501 | Bacteria | 2710 |
| 304 | Ga0495607_0064355 | 3300046501 | Bacteria | 2071 |
| 305 | Ga0495583_0000137 | 3300046506 | Bacteria | 123815 |
| 306 | Ga0495583_0000231 | 3300046506 | Bacteria | 93091 |
| 307 | Ga0495583_0001074 | 3300046506 | Bacteria | 30538 |
| 308 | Ga0495583_0001094 | 3300046506 | Bacteria | 29993 |
| 309 | Ga0495606_0000400 | 3300046507 | Bacteria | 73341 |
| 310 | Ga0495606_0000703 | 3300046507 | Bacteria | 51821 |
| 311 | Ga0495606_0007181 | 3300046507 | Bacteria | 10052 |
| 312 | Ga0495606_0027360 | 3300046507 | Bacteria | 4046 |
| 313 | Ga0495606_0063243 | 3300046507 | Bacteria | 2359 |
| 314 | Ga0495606_0223765 | 3300046507 | Bacteria | 1058 |
| 315 | Ga0495610_0000027 | 3300046512 | Bacteria | 275273 |
| 316 | Ga0495610_0001351 | 3300046512 | Bacteria | 21769 |
| 317 | Ga0495610_0001490 | 3300046512 | Bacteria | 20605 |
| 318 | Ga0495610_0006573 | 3300046512 | Bacteria | 7952 |
| 319 | Ga0495610_0006638 | 3300046512 | Bacteria | 7897 |
| 320 | Ga0495610_0049988 | 3300046512 | Bacteria | 2043 |
| 321 | Ga0495616_0000072 | 3300046513 | Bacteria | 87767 |
| 322 | Ga0495616_0000106 | 3300046513 | Bacteria | 72335 |
| 323 | Ga0495616_0000324 | 3300046513 | Bacteria | 38102 |
| 324 | Ga0495616_0002097 | 3300046513 | Bacteria | 13399 |
| 325 | Ga0495616_0021450 | 3300046513 | Bacteria | 3498 |
| 326 | Ga0495616_0024185 | 3300046513 | Bacteria | 3260 |
| 327 | Ga0495616_0031076 | 3300046513 | Bacteria | 2800 |
| 328 | Ga0495616_0055243 | 3300046513 | Bacteria | 1966 |
| 329 | Ga0495616_0073418 | 3300046513 | Bacteria | 1650 |
| 330 | Ga0495620_0000055 | 3300046515 | Bacteria | 99544 |
| 331 | Ga0495620_0004824 | 3300046515 | Bacteria | 7580 |
| 332 | Ga0495630_0249248 | 3300046517 | Bacteria | 1357 |
| 333 | Ga0495631_0000349 | 3300046518 | Bacteria | 31928 |
| 334 | Ga0495631_0000452 | 3300046518 | Bacteria | 27992 |
| 335 | Ga0495631_0003687 | 3300046518 | Bacteria | 8354 |
| 336 | Ga0495632_0000025 | 3300046519 | Bacteria | 176815 |
| 337 | Ga0495632_0000342 | 3300046519 | Bacteria | 44311 |
| 338 | Ga0495632_0000566 | 3300046519 | Bacteria | 34383 |
| 339 | Ga0495632_0022704 | 3300046519 | Bacteria | 3359 |
| 340 | Ga0495632_0059315 | 3300046519 | Bacteria | 1862 |
| 341 | Ga0495637_0000003 | 3300046520 | Bacteria | 623293 |
| 342 | Ga0495637_0000240 | 3300046520 | Bacteria | 42746 |
| 343 | Ga0495643_0000471 | 3300046522 | Bacteria | 51325 |
| 344 | Ga0495643_0000906 | 3300046522 | Bacteria | 31248 |
| 345 | Ga0495643_0003125 | 3300046522 | Bacteria | 12363 |
| 346 | Ga0495643_0019321 | 3300046522 | Bacteria | 3944 |
| 347 | Ga0495643_0105764 | 3300046522 | Bacteria | 1436 |
| 348 | Ga0495644_0000471 | 3300046523 | Bacteria | 17417 |
| 349 | Ga0495644_0010246 | 3300046523 | Bacteria | 3611 |
| 350 | Ga0495644_0045983 | 3300046523 | Bacteria | 1640 |
| 351 | Ga0495648_0000134 | 3300046524 | Bacteria | 87750 |
| 352 | Ga0495648_0004553 | 3300046524 | Bacteria | 11811 |
| 353 | Ga0495648_0007917 | 3300046524 | Bacteria | 8431 |
| 354 | Ga0495648_0010909 | 3300046524 | Bacteria | 6891 |
| 355 | Ga0495648_0011923 | 3300046524 | Bacteria | 6520 |
| 356 | Ga0495648_0012043 | 3300046524 | Bacteria | 6479 |
| 357 | Ga0495648_0016240 | 3300046524 | Bacteria | 5371 |
| 358 | Ga0495648_0020374 | 3300046524 | Bacteria | 4625 |
| 359 | Ga0495648_0118645 | 3300046524 | Bacteria | 1426 |
| 360 | Ga0495666_0003104 | 3300046526 | Bacteria | 8348 |
| 361 | Ga0495642_0001010 | 3300046528 | Bacteria | 13058 |
| 362 | Ga0495642_0001769 | 3300046528 | Bacteria | 9314 |
| 363 | Ga0495642_0007579 | 3300046528 | Bacteria | 4158 |
| 364 | Ga0495642_0026741 | 3300046528 | Bacteria | 2293 |
| 365 | Ga0495642_0045659 | 3300046528 | Bacteria | 1790 |
| 366 | Ga0495654_0000131 | 3300046530 | Bacteria | 80339 |
| 367 | Ga0495654_0001328 | 3300046530 | Bacteria | 17257 |
| 368 | Ga0495654_0013625 | 3300046530 | Bacteria | 4347 |
| 369 | Ga0495654_0018546 | 3300046530 | Bacteria | 3644 |
| 370 | Ga0495654_0068243 | 3300046530 | Bacteria | 1690 |
| 371 | Ga0495665_0006428 | 3300046531 | Bacteria | 6344 |
| 372 | Ga0495640_0126903 | 3300046533 | Bacteria | 1654 |
| 373 | Ga0495586_0015424 | 3300046535 | Bacteria | 4065 |
| 374 | Ga0495587_0025778 | 3300046536 | Bacteria | 3591 |
| 375 | Ga0495587_0051136 | 3300046536 | Bacteria | 2443 |
| 376 | Ga0495587_0093565 | 3300046536 | Bacteria | 1735 |
| 377 | Ga0495609_0000412 | 3300046538 | Bacteria | 35828 |
| 378 | Ga0495609_0000616 | 3300046538 | Bacteria | 27691 |
| 379 | Ga0495609_0003721 | 3300046538 | Bacteria | 8614 |
| 380 | Ga0495609_0004228 | 3300046538 | Bacteria | 7935 |
| 381 | Ga0495609_0014613 | 3300046538 | Bacteria | 3687 |
| 382 | Ga0495597_0000340 | 3300046542 | Bacteria | 41815 |
| 383 | Ga0495597_0000415 | 3300046542 | Bacteria | 36751 |
| 384 | Ga0495622_0013885 | 3300046557 | Bacteria | 3736 |
| 385 | Ga0495622_0023471 | 3300046557 | Bacteria | 2876 |
| 386 | Ga0495622_0043043 | 3300046557 | Bacteria | 2099 |
| 387 | Ga0495622_0093385 | 3300046557 | Bacteria | 1381 |
| 388 | Ga0495633_0000134 | 3300046558 | Bacteria | 98658 |
| 389 | Ga0495633_0000535 | 3300046558 | Bacteria | 37893 |
| 390 | Ga0495633_0000552 | 3300046558 | Bacteria | 36892 |
| 391 | Ga0495633_0001267 | 3300046558 | Bacteria | 20125 |
| 392 | Ga0495633_0004214 | 3300046558 | Bacteria | 9212 |
| 393 | Ga0495633_0005435 | 3300046558 | Bacteria | 7782 |
| 394 | Ga0495633_0011104 | 3300046558 | Bacteria | 4882 |
| 395 | Ga0495633_0026584 | 3300046558 | Bacteria | 2838 |
| 396 | Ga0495656_0002559 | 3300046615 | Bacteria | 6064 |
| 397 | Ga0495656_0040510 | 3300046615 | Bacteria | 1942 |
| 398 | Ga0495656_0053480 | 3300046615 | Bacteria | 1735 |
| 399 | Ga0495656_0078422 | 3300046615 | Bacteria | 1484 |
| 400 | Ga0495668_0001212 | 3300046616 | Bacteria | 26091 |
| 401 | Ga0495668_0002631 | 3300046616 | Bacteria | 14437 |
| 402 | Ga0495634_0001509 | 3300046642 | Bacteria | 20601 |
| 403 | Ga0495611_0000370 | 3300046648 | Bacteria | 28963 |
| 404 | Ga0495611_0001926 | 3300046648 | Bacteria | 9864 |
| 405 | Ga0495611_0013636 | 3300046648 | Bacteria | 3462 |
| 406 | Ga0495611_0017119 | 3300046648 | Bacteria | 3098 |
| 407 | Ga0495611_0072063 | 3300046648 | Bacteria | 1580 |
| 408 | Ga0495611_0104947 | 3300046648 | Bacteria | 1314 |
| 409 | Ga0495625_0001523 | 3300046660 | Bacteria | 27723 |
| 410 | Ga0495625_0002248 | 3300046660 | Bacteria | 21255 |
| 411 | Ga0495625_0016339 | 3300046660 | Bacteria | 5844 |
| 412 | Ga0495625_0024430 | 3300046660 | Bacteria | 4599 |
| 413 | Ga0495625_0050583 | 3300046660 | Bacteria | 2981 |
| 414 | Ga0495625_0051383 | 3300046660 | Bacteria | 2955 |
| 415 | Ga0495625_0074471 | 3300046660 | Bacteria | 2378 |
| 416 | Ga0495659_0000131 | 3300046664 | Bacteria | 32964 |
| 417 | Ga0495659_0003174 | 3300046664 | Bacteria | 5272 |
| 418 | Ga0495659_0004375 | 3300046664 | Bacteria | 4444 |
| 419 | Ga0495659_0011325 | 3300046664 | Bacteria | 2873 |
| 420 | Ga0495661_0002371 | 3300046665 | Bacteria | 14535 |
| 421 | Ga0495661_0005799 | 3300046665 | Bacteria | 8730 |
| 422 | Ga0495661_0022463 | 3300046665 | Bacteria | 4104 |
| 423 | Ga0495661_0041137 | 3300046665 | Bacteria | 2861 |
| 424 | Ga0495661_0047176 | 3300046665 | Bacteria | 2624 |
| 425 | Ga0495588_0066309 | 3300046674 | Bacteria | 1873 |
| 426 | Ga0495588_0113477 | 3300046674 | Bacteria | 1427 |
| 427 | Ga0495646_0055444 | 3300046680 | Bacteria | 2380 |
| 428 | Ga0495647_0018327 | 3300046681 | Bacteria | 2491 |
| 429 | Ga0495669_0002501 | 3300046684 | Bacteria | 7502 |
| 430 | Ga0495670_0001054 | 3300046691 | Bacteria | 13359 |
| 431 | Ga0495670_0005293 | 3300046691 | Bacteria | 6348 |
| 432 | Ga0495670_0017049 | 3300046691 | Bacteria | 3571 |
| 433 | Ga0495671_0000106 | 3300046692 | Bacteria | 74947 |
| 434 | Ga0495671_0000424 | 3300046692 | Bacteria | 33646 |
| 435 | Ga0495671_0001030 | 3300046692 | Bacteria | 19398 |
| 436 | Ga0495671_0002928 | 3300046692 | Bacteria | 10643 |
| 437 | Ga0495671_0005258 | 3300046692 | Bacteria | 7601 |
| 438 | Ga0495671_0016501 | 3300046692 | Bacteria | 3942 |
| 439 | Ga0495671_0017036 | 3300046692 | Bacteria | 3871 |
| 440 | Ga0495671_0026566 | 3300046692 | Bacteria | 3000 |
| 441 | Ga0495649_0002046 | 3300046694 | Bacteria | 14554 |
| 442 | Ga0495649_0023389 | 3300046694 | Bacteria | 3453 |
| 443 | Ga0495649_0024212 | 3300046694 | Bacteria | 3386 |
| 444 | Ga0495589_0000287 | 3300046794 | Bacteria | 40912 |
| 445 | Ga0495589_0002781 | 3300046794 | Bacteria | 9683 |
| 446 | Ga0495589_0004277 | 3300046794 | Bacteria | 7633 |
| 447 | Ga0495589_0004564 | 3300046794 | Bacteria | 7358 |
| 448 | Ga0495600_0021038 | 3300046809 | Bacteria | 4175 |
| 449 | Ga0495660_0005163 | 3300046810 | Bacteria | 7848 |
| 450 | Ga0495660_0007612 | 3300046810 | Bacteria | 6360 |
| 451 | Ga0495660_0007977 | 3300046810 | Bacteria | 6219 |
| 452 | Ga0495660_0036277 | 3300046810 | Bacteria | 2750 |
| 453 | Ga0495660_0064503 | 3300046810 | Bacteria | 1957 |
| 454 | Ga0495660_0084426 | 3300046810 | Bacteria | 1660 |
| 455 | Ga0495581_0034695 | 3300047315 | Bacteria | 2918 |
| 456 | Ga0495604_0019809 | 3300047317 | Bacteria | 5381 |
| 457 | Ga0495636_0000144 | 3300047318 | Bacteria | 28781 |
| 458 | Ga0495636_0010710 | 3300047318 | Bacteria | 3625 |
| 459 | Ga0495636_0016357 | 3300047318 | Bacteria | 2962 |
| 460 | Ga0495636_0032030 | 3300047318 | Bacteria | 2155 |
| 461 | Ga0495636_0033363 | 3300047318 | Bacteria | 2114 |
| 462 | Ga0495674_0028570 | 3300047319 | Bacteria | 5082 |
| 463 | Ga0495672_0000088 | 3300047320 | Bacteria | 153860 |
| 464 | Ga0495672_0000399 | 3300047320 | Bacteria | 52911 |
| 465 | Ga0495672_0000678 | 3300047320 | Bacteria | 37915 |
| 466 | Ga0495672_0000786 | 3300047320 | Bacteria | 34407 |
| 467 | Ga0495672_0000973 | 3300047320 | Bacteria | 29705 |
| 468 | Ga0495672_0126256 | 3300047320 | Bacteria | 1352 |
| 469 | Ga0495676_0000097 | 3300047321 | Bacteria | 65781 |
| 470 | Ga0495676_0069415 | 3300047321 | Bacteria | 2719 |
| 471 | Ga0495676_0090820 | 3300047321 | Bacteria | 2284 |
| 472 | Ga0495680_0022418 | 3300047322 | Bacteria | 5262 |
| 473 | Ga0495683_0000336 | 3300047323 | Bacteria | 39214 |
| 474 | Ga0495683_0001078 | 3300047323 | Bacteria | 18893 |
| 475 | Ga0495683_0011104 | 3300047323 | Bacteria | 4748 |
| 476 | Ga0495683_0011328 | 3300047323 | Bacteria | 4694 |
| 477 | Ga0495683_0017527 | 3300047323 | Bacteria | 3711 |
| 478 | Ga0495683_0077960 | 3300047323 | Bacteria | 1619 |
| 479 | Ga0495687_000042 | 3300047443 | Bacteria | 218868 |
| 480 | Ga0495687_000115 | 3300047443 | Bacteria | 122883 |
| 481 | Ga0495687_000462 | 3300047443 | Bacteria | 49713 |
| 482 | Ga0495687_000619 | 3300047443 | Bacteria | 41204 |
| 483 | Ga0495687_010355 | 3300047443 | Bacteria | 5119 |
| 484 | Ga0495677_0000454 | 3300047445 | Bacteria | 17476 |
| 485 | Ga0495677_0000678 | 3300047445 | Bacteria | 13776 |
| 486 | Ga0495679_003372 | 3300047446 | Bacteria | 7699 |
| 487 | Ga0495679_006199 | 3300047446 | Bacteria | 5188 |
| 488 | Ga0495679_009483 | 3300047446 | Bacteria | 3894 |
| 489 | Ga0495685_001534 | 3300047447 | Bacteria | 7087 |
| 490 | Ga0495685_001869 | 3300047447 | Bacteria | 6506 |
| 491 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 492 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 493 | Ga0495673_0019469 | 3300047469 | Bacteria | 3399 |
| 494 | Ga0495673_0035519 | 3300047469 | Bacteria | 2295 |
| 495 | Ga0495681_0000256 | 3300047470 | Bacteria | 43302 |
| 496 | Ga0495681_0013083 | 3300047470 | Bacteria | 4839 |
| 497 | Ga0495681_0015958 | 3300047470 | Bacteria | 4235 |
| 498 | Ga0495681_0036382 | 3300047470 | Bacteria | 2434 |
| 499 | Ga0495686_0000728 | 3300047472 | Bacteria | 44006 |
| 500 | Ga0495686_0010126 | 3300047472 | Bacteria | 6729 |
| 501 | Ga0495686_0011743 | 3300047472 | Bacteria | 6166 |
| 502 | Ga0495602_0014183 | 3300048088 | Bacteria | 8100 |
| 503 | Ga0495614_0001960 | 3300048089 | Bacteria | 9051 |
| 504 | Ga0495626_0000043 | 3300048091 | Bacteria | 168109 |
| 505 | Ga0495626_0003172 | 3300048091 | Bacteria | 10710 |
| 506 | Ga0495626_0005864 | 3300048091 | Bacteria | 7079 |
| 507 | Ga0495626_0008641 | 3300048091 | Bacteria | 5565 |
| 508 | Ga0495626_0013229 | 3300048091 | Bacteria | 4293 |
| 509 | Ga0496101_0074104 | 3300048904 | Bacteria | 2503 |
| 510 | Ga0496101_0165790 | 3300048904 | Bacteria | 1696 |
| 511 | Ga0496102_0000611 | 3300048905 | Bacteria | 37080 |
| 512 | Ga0496102_0015675 | 3300048905 | Bacteria | 6603 |
| 513 | Ga0496105_0131174 | 3300048908 | Bacteria | 2066 |
| 514 | Ga0496106_0017181 | 3300048909 | Bacteria | 5357 |
| 515 | Ga0496107_0085649 | 3300048910 | Bacteria | 2299 |
| 516 | Ga0496111_0008745 | 3300048914 | Bacteria | 6720 |
| 517 | Ga0496113_0394832 | 3300048916 | Bacteria | 1110 |
| 518 | Ga0496114_0007833 | 3300048917 | Bacteria | 8452 |
| 519 | Ga0496115_0153307 | 3300048918 | Bacteria | 1903 |
| 520 | Ga0496116_0039524 | 3300048919 | Bacteria | 3261 |
| 521 | Ga0496116_0097294 | 3300048919 | Bacteria | 1770 |
| 522 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 523 | Ga0496118_0000022 | 3300048921 | Bacteria | 438602 |
| 524 | Ga0496118_0017010 | 3300048921 | Bacteria | 6642 |
| 525 | Ga0496121_0012789 | 3300048924 | Bacteria | 9088 |
| 526 | Ga0496121_0066302 | 3300048924 | Bacteria | 2932 |
| 527 | Ga0496121_0106507 | 3300048924 | Bacteria | 2149 |
| 528 | Ga0496122_0000980 | 3300048925 | Bacteria | 51101 |
| 529 | Ga0496122_0001491 | 3300048925 | Bacteria | 37476 |
| 530 | Ga0496122_0001630 | 3300048925 | Bacteria | 35015 |
| 531 | Ga0496122_0008792 | 3300048925 | Bacteria | 10791 |
| 532 | Ga0496123_0001111 | 3300048926 | Bacteria | 40321 |
| 533 | Ga0496123_0001968 | 3300048926 | Bacteria | 26656 |
| 534 | Ga0496123_0004729 | 3300048926 | Bacteria | 14094 |
| 535 | Ga0496123_0036210 | 3300048926 | Bacteria | 3503 |
| 536 | Ga0496124_0034594 | 3300048927 | Bacteria | 4432 |
| 537 | Ga0496124_0081134 | 3300048927 | Bacteria | 2667 |
| 538 | Ga0496124_0088439 | 3300048927 | Bacteria | 2532 |
| 539 | Ga0496125_0000313 | 3300048928 | Bacteria | 95423 |
| 540 | Ga0496125_0002883 | 3300048928 | Bacteria | 21647 |
| 541 | Ga0496125_0005645 | 3300048928 | Bacteria | 13815 |
| 542 | Ga0495678_000202 | 3300049459 | Bacteria | 69911 |
| 543 | Ga0495678_000403 | 3300049459 | Bacteria | 43653 |
| 544 | Ga0495678_000622 | 3300049459 | Bacteria | 32958 |
| 545 | Ga0495678_001894 | 3300049459 | Bacteria | 15198 |
| 546 | Ga0495678_002745 | 3300049459 | Bacteria | 11549 |
| 547 | Ga0495678_011469 | 3300049459 | Bacteria | 4241 |
| 548 | Ga0495682_0000578 | 3300049460 | Bacteria | 24806 |
| 549 | Ga0495682_0002545 | 3300049460 | Bacteria | 8584 |
| 550 | Ga0495682_0002658 | 3300049460 | Bacteria | 8348 |
| 551 | Ga0495682_0016364 | 3300049460 | Bacteria | 2807 |
| 552 | Ga0501294_002960 | 3300049517 | Bacteria | 1602 |
| 553 | Ga0501296_008442 | 3300049519 | Bacteria | 1194 |
| 554 | Ga0501034_0117343 | 3300049571 | Bacteria | 2649 |
| 555 | Ga0501047_0319391 | 3300049581 | Bacteria | 1393 |
| 556 | Ga0501223_017808 | 3300049663 | Bacteria | 1401 |
| 557 | Ga0501227_019583 | 3300049665 | Bacteria | 1544 |
| 558 | Ga0501235_004034 | 3300049669 | Bacteria | 3177 |
| 559 | Ga0501255_001590 | 3300049684 | Bacteria | 1862 |
| 560 | Ga0501272_001324 | 3300049769 | Bacteria | 2330 |
| 561 | Ga0501279_002615 | 3300049775 | Bacteria | 2352 |
| 562 | Ga0501035_0001119 | 3300049822 | Bacteria | 28027 |
| 563 | Ga0501035_0171468 | 3300049822 | Bacteria | 1874 |
| 564 | Ga0501044_0020584 | 3300049823 | Bacteria | 7042 |
| 565 | Ga0501044_0021815 | 3300049823 | Bacteria | 6830 |
| 566 | nmdc:mga07m45_5560_c1 | 3300050496 | Bacteria | 3527 |
| 567 | Ga0495601_0159498 | 3300053077 | Bacteria | 1474 |
| 568 | Ga0500650_0000031 | 3300053098 | Bacteria | 54318 |
| 569 | Ga0500594_0035164 | 3300053118 | Bacteria | 1342 |
| 570 | Ga0500607_012081 | 3300053121 | Bacteria | 5084 |
| 571 | Ga0500618_005611 | 3300053125 | Bacteria | 3787 |
| 572 | Ga0500618_019432 | 3300053125 | Bacteria | 1673 |
| 573 | Ga0500586_000093 | 3300053145 | Bacteria | 15423 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041509 | Ga0451843_1208912 | Ga0451843_1208912_1192_2124 | 270 |
| 2 | 3300005564 | Ga0070664_100076556 | Ga0070664_1000765563 | 276 |
| 3 | 3300031665 | Ga0316575_10001369 | Ga0316575_100013695 | 278 |
| 4 | 3300046615 | Ga0495656_0078422 | Ga0495656_0078422_529_1434 | 278 |
| 5 | 3300032005 | Ga0307411_10423334 | Ga0307411_104233341 | 279 |
| 6 | iso_pu_bacteria | 2643221581 | 2643914430 | 279 |
| 7 | 3300005331 | Ga0070670_100430360 | Ga0070670_1004303601 | 280 |
| 8 | 3300005339 | Ga0070660_100160137 | Ga0070660_1001601373 | 280 |
| 9 | 3300005844 | Ga0068862_100413696 | Ga0068862_1004136961 | 280 |
| 10 | 3300013307 | Ga0157372_10176004 | Ga0157372_101760042 | 280 |
| 11 | 3300025919 | Ga0207657_10014527 | Ga0207657_100145277 | 280 |
| 12 | 3300025937 | Ga0207669_10010197 | Ga0207669_100101975 | 280 |
| 13 | 3300025940 | Ga0207691_10002401 | Ga0207691_1000240114 | 280 |
| 14 | 3300041512 | Ga0451853_1912378 | Ga0451853_1912378_434_1456 | 280 |
| 15 | 3300042007 | Ga0439449_0005032 | Ga0439449_0005032_2037_3011 | 280 |
| 16 | 3300046615 | Ga0495656_0040510 | Ga0495656_0040510_131_1036 | 280 |
| 17 | 3300003759 | Ga0055525_1000236 | Ga0055525_100023638 | 281 |
| 18 | 3300003760 | Ga0055527_1000070 | Ga0055527_100007048 | 281 |
| 19 | 3300003761 | Ga0055535_1000117 | Ga0055535_100011748 | 281 |
| 20 | 3300003762 | Ga0055542_1000156 | Ga0055542_100015639 | 281 |
| 21 | 3300003763 | Ga0055529_1000353 | Ga0055529_10003533 | 281 |
| 22 | 3300005578 | Ga0068854_100000287 | Ga0068854_10000028731 | 281 |
| 23 | 3300025904 | Ga0207647_10000014 | Ga0207647_1000001434 | 281 |
| 24 | 3300025913 | Ga0207695_10040526 | Ga0207695_100405263 | 281 |
| 25 | 3300025949 | Ga0207667_10000432 | Ga0207667_1000043235 | 281 |
| 26 | 3300025981 | Ga0207640_10000208 | Ga0207640_100002087 | 281 |
| 27 | 3300031731 | Ga0307405_10126359 | Ga0307405_101263592 | 281 |
| 28 | 3300046664 | Ga0495659_0011325 | Ga0495659_0011325_866_1807 | 281 |
| 29 | 3300047318 | Ga0495636_0033363 | Ga0495636_0033363_606_1547 | 281 |
| 30 | iso_pu_bacteria | 2643221573 | 2643880079 | 281 |
| 31 | iso_pu_bacteria | 2643221720 | 2644662369 | 281 |
| 32 | iso_pu_bacteria | 2643221728 | 2644698739 | 281 |
| 33 | iso_pu_bacteria | 2895498888 | 2895502110 | 281 |
| 34 | iso_pu_bacteria | 2895511927 | 2895518037 | 281 |
| 35 | iso_pu_bacteria | 2895522137 | 2895523428 | 281 |
| 36 | iso_pu_bacteria | 2895525241 | 2895526340 | 281 |
| 37 | 3300005353 | Ga0070669_100012030 | Ga0070669_1000120303 | 282 |
| 38 | 3300005548 | Ga0070665_100005658 | Ga0070665_1000056589 | 282 |
| 39 | 3300005617 | Ga0068859_100008427 | Ga0068859_1000084279 | 282 |
| 40 | 3300005844 | Ga0068862_100013761 | Ga0068862_1000137613 | 282 |
| 41 | 3300006931 | Ga0097620_100008426 | Ga0097620_1000084263 | 282 |
| 42 | 3300031548 | Ga0307408_100048855 | Ga0307408_1000488553 | 282 |
| 43 | 3300046460 | Ga0495638_0013405 | Ga0495638_0013405_4369_5289 | 282 |
| 44 | 3300049581 | Ga0501047_0319391 | Ga0501047_0319391_470_1381 | 282 |
| 45 | 3300049822 | Ga0501035_0171468 | Ga0501035_0171468_522_1433 | 282 |
| 46 | 3300049823 | Ga0501044_0020584 | Ga0501044_0020584_645_1556 | 282 |
| 47 | 3300005331 | Ga0070670_100000001 | Ga0070670_100000001641 | 283 |
| 48 | 3300005335 | Ga0070666_10367400 | Ga0070666_103674001 | 283 |
| 49 | 3300005367 | Ga0070667_100000331 | Ga0070667_10000033137 | 283 |
| 50 | 3300005618 | Ga0068864_100000012 | Ga0068864_100000012283 | 283 |
| 51 | 3300014325 | Ga0163163_10000162 | Ga0163163_1000016239 | 283 |
| 52 | 3300025903 | Ga0207680_10009956 | Ga0207680_100099565 | 283 |
| 53 | 3300025925 | Ga0207650_10000002 | Ga0207650_100000021316 | 283 |
| 54 | 3300025986 | Ga0207658_10000001 | Ga0207658_1000000139 | 283 |
| 55 | 3300026088 | Ga0207641_10017145 | Ga0207641_100171455 | 283 |
| 56 | 3300026095 | Ga0207676_10000001 | Ga0207676_100000011316 | 283 |
| 57 | 3300032004 | Ga0307414_10032262 | Ga0307414_100322623 | 283 |
| 58 | 3300049822 | Ga0501035_0001119 | Ga0501035_0001119_12956_13870 | 283 |
| 59 | 3300049823 | Ga0501044_0021815 | Ga0501044_0021815_2572_3486 | 283 |
| 60 | 3300003775 | Ga0055524_1031271 | Ga0055524_10312712 | 284 |
| 61 | 3300003784 | Ga0055534_1011314 | Ga0055534_10113142 | 284 |
| 62 | 3300003790 | Ga0055528_1031448 | Ga0055528_10314482 | 284 |
| 63 | 3300003794 | Ga0055531_10014922 | Ga0055531_100149222 | 284 |
| 64 | 3300013104 | Ga0157370_10257097 | Ga0157370_102570972 | 284 |
| 65 | 3300014497 | Ga0182008_10010622 | Ga0182008_100106222 | 284 |
| 66 | 3300025273 | Ga0209673_1026903 | Ga0209673_10269032 | 284 |
| 67 | 3300025291 | Ga0209675_1007804 | Ga0209675_10078042 | 284 |
| 68 | 3300025299 | Ga0209256_1000910 | Ga0209256_10009102 | 284 |
| 69 | 3300025304 | Ga0209257_1001235 | Ga0209257_100123530 | 284 |
| 70 | 3300030735 | Ga0316178_1016907 | Ga0316178_10169073 | 284 |
| 71 | 3300030736 | Ga0316180_1121954 | Ga0316180_11219541 | 284 |
| 72 | 3300032002 | Ga0307416_100547308 | Ga0307416_1005473082 | 284 |
| 73 | 3300046453 | Ga0495627_029274 | Ga0495627_029274_25_948 | 284 |
| 74 | 3300046458 | Ga0495591_021977 | Ga0495591_021977_806_1729 | 284 |
| 75 | 3300046474 | Ga0495605_0000125 | Ga0495605_0000125_87959_88882 | 284 |
| 76 | 3300046512 | Ga0495610_0006573 | Ga0495610_0006573_6394_7317 | 284 |
| 77 | 3300046515 | Ga0495620_0000055 | Ga0495620_0000055_12384_13307 | 284 |
| 78 | 3300046530 | Ga0495654_0001328 | Ga0495654_0001328_15858_16781 | 284 |
| 79 | 3300046538 | Ga0495609_0000412 | Ga0495609_0000412_22392_23315 | 284 |
| 80 | 3300046558 | Ga0495633_0000134 | Ga0495633_0000134_86352_87275 | 284 |
| 81 | 3300046692 | Ga0495671_0002928 | Ga0495671_0002928_7176_8099 | 284 |
| 82 | 3300046794 | Ga0495589_0004564 | Ga0495589_0004564_4320_5243 | 284 |
| 83 | 3300046810 | Ga0495660_0036277 | Ga0495660_0036277_1460_2383 | 284 |
| 84 | 3300047446 | Ga0495679_003372 | Ga0495679_003372_2425_3348 | 284 |
| 85 | 3300047469 | Ga0495673_0035519 | Ga0495673_0035519_504_1427 | 284 |
| 86 | 3300047470 | Ga0495681_0013083 | Ga0495681_0013083_1793_2716 | 284 |
| 87 | 3300048091 | Ga0495626_0003172 | Ga0495626_0003172_3487_4437 | 284 |
| 88 | 3300048926 | Ga0496123_0036210 | Ga0496123_0036210_1487_2410 | 284 |
| 89 | 3300025295 | Ga0209564_1005690 | Ga0209564_10056906 | 285 |
| 90 | 3300041411 | Ga0439466_0002133 | Ga0439466_0002133_1484_2413 | 285 |
| 91 | 3300042009 | Ga0439451_002517 | Ga0439451_002517_1392_2321 | 285 |
| 92 | 3300003320 | rootH2_10070928 | rootH2_100709283 | 286 |
| 93 | 3300003323 | rootH1_10012258 | rootH1_1001225880 | 286 |
| 94 | 3300003323 | rootH1_10115272 | rootH1_101152724 | 286 |
| 95 | 3300009092 | Ga0105250_10000004 | Ga0105250_10000004184 | 286 |
| 96 | 3300014968 | Ga0157379_10000208 | Ga0157379_1000020824 | 286 |
| 97 | 3300046517 | Ga0495630_0249248 | Ga0495630_0249248_321_1235 | 286 |
| 98 | 3300053098 | Ga0500650_0000031 | Ga0500650_0000031_35243_36166 | 286 |
| 99 | 3300003758 | Ga0055532_1000359 | Ga0055532_100035928 | 287 |
| 100 | 3300003759 | Ga0055525_1000243 | Ga0055525_100024328 | 287 |
| 101 | 3300005466 | Ga0070685_10000049 | Ga0070685_1000004910 | 287 |
| 102 | 3300005843 | Ga0068860_100000600 | Ga0068860_10000060019 | 287 |
| 103 | 3300013307 | Ga0157372_10049628 | Ga0157372_100496283 | 287 |
| 104 | 3300025909 | Ga0207705_10045627 | Ga0207705_100456272 | 287 |
| 105 | 3300026088 | Ga0207641_10017204 | Ga0207641_100172045 | 287 |
| 106 | 3300028381 | Ga0268264_10000061 | Ga0268264_1000006134 | 287 |
| 107 | 3300037418 | Ga0395900_0000239 | Ga0395900_0000239_13104_14021 | 287 |
| 108 | 3300031548 | Ga0307408_100032545 | Ga0307408_1000325452 | 288 |
| 109 | 3300031595 | Ga0265313_10001064 | Ga0265313_100010643 | 289 |
| 110 | 3300036712 | Ga0316584_0064297 | Ga0316584_0064297_282_1286 | 289 |
| 111 | 3300046615 | Ga0495656_0053480 | Ga0495656_0053480_129_1085 | 290 |
| 112 | iso_pu_bacteria | 8054357960 | 8054360133 | 291 |
| 113 | iso_pu_bacteria | 2881714928 | 2881715265 | 292 |
| 114 | 3300014968 | Ga0157379_10203142 | Ga0157379_102031421 | 294 |
| 115 | 3300025923 | Ga0207681_10072070 | Ga0207681_100720702 | 294 |
| 116 | 3300025931 | Ga0207644_10000065 | Ga0207644_1000006568 | 294 |
| 117 | 3300026035 | Ga0207703_10541088 | Ga0207703_105410881 | 294 |
| 118 | 3300048927 | Ga0496124_0081134 | Ga0496124_0081134_142_1107 | 294 |
| 119 | 3300005841 | Ga0068863_100579341 | Ga0068863_1005793412 | 296 |
| 120 | 3300005843 | Ga0068860_100315844 | Ga0068860_1003158442 | 296 |
| 121 | 3300006058 | Ga0075432_10063753 | Ga0075432_100637532 | 296 |
| 122 | 3300028381 | Ga0268264_10308958 | Ga0268264_103089582 | 296 |
| 123 | 3300049459 | Ga0495678_000622 | Ga0495678_000622_31444_32361 | 297 |
| 124 | 3300049460 | Ga0495682_0000578 | Ga0495682_0000578_10638_11555 | 297 |
| 125 | 3300021361 | Ga0213872_10000091 | Ga0213872_1000009187 | 298 |
| 126 | 3300037418 | Ga0395900_0194521 | Ga0395900_0194521_469_1371 | 298 |
| 127 | 3300038443 | Ga0395901_0134832 | Ga0395901_0134832_1254_2156 | 298 |
| 128 | 3300045051 | Ga0451576_0230832 | Ga0451576_0230832_241_1149 | 298 |
| 129 | 3300046513 | Ga0495616_0000106 | Ga0495616_0000106_6824_7726 | 298 |
| 130 | 3300046524 | Ga0495648_0016240 | Ga0495648_0016240_272_1174 | 298 |
| 131 | 3300046530 | Ga0495654_0018546 | Ga0495654_0018546_1562_2464 | 298 |
| 132 | 3300047320 | Ga0495672_0000786 | Ga0495672_0000786_22744_23649 | 298 |
| 133 | 3300047470 | Ga0495681_0000256 | Ga0495681_0000256_31923_32825 | 298 |
| 134 | 3300048908 | Ga0496105_0131174 | Ga0496105_0131174_424_1326 | 298 |
| 135 | 3300048910 | Ga0496107_0085649 | Ga0496107_0085649_704_1606 | 298 |
| 136 | iso_pu_bacteria | 2643221664 | 2644359366 | 298 |
| 137 | iso_pu_bacteria | 2738541280 | 2738738210 | 298 |
| 138 | iso_pu_bacteria | 2881927736 | 2881929172 | 298 |
| 139 | 3300002987 | JGI25159J45721_1010443 | JGI25159J45721_10104431 | 299 |
| 140 | 3300003215 | JGI25153J46596_10004468 | JGI25153J46596_100044686 | 299 |
| 141 | 3300003354 | JGI25160J50197_1014774 | JGI25160J50197_10147741 | 299 |
| 142 | 3300003374 | JGI25161J50226_1000863 | JGI25161J50226_10008634 | 299 |
| 143 | 3300003771 | Ga0055526_1007526 | Ga0055526_10075264 | 299 |
| 144 | 3300003775 | Ga0055524_1005727 | Ga0055524_10057275 | 299 |
| 145 | 3300003775 | Ga0055524_1015863 | Ga0055524_10158632 | 299 |
| 146 | 3300003784 | Ga0055534_1003949 | Ga0055534_10039495 | 299 |
| 147 | 3300003790 | Ga0055528_1015918 | Ga0055528_10159181 | 299 |
| 148 | 3300003794 | Ga0055531_10000001 | Ga0055531_1000000111 | 299 |
| 149 | 3300005337 | Ga0070682_100155467 | Ga0070682_1001554672 | 299 |
| 150 | 3300025245 | Ga0207425_1000009 | Ga0207425_1000009570 | 299 |
| 151 | 3300025245 | Ga0207425_1000408 | Ga0207425_10004089 | 299 |
| 152 | 3300025258 | Ga0209129_1000061 | Ga0209129_1000061216 | 299 |
| 153 | 3300025258 | Ga0209129_1008102 | Ga0209129_10081024 | 299 |
| 154 | 3300025263 | Ga0209565_1000684 | Ga0209565_10006846 | 299 |
| 155 | 3300025263 | Ga0209565_1000730 | Ga0209565_10007309 | 299 |
| 156 | 3300025291 | Ga0209675_1004599 | Ga0209675_10045995 | 299 |
| 157 | 3300025295 | Ga0209564_1028784 | Ga0209564_10287842 | 299 |
| 158 | 3300025297 | Ga0209758_1000101 | Ga0209758_100010114 | 299 |
| 159 | 3300025298 | Ga0209050_1000805 | Ga0209050_100080523 | 299 |
| 160 | 3300025298 | Ga0209050_1022530 | Ga0209050_10225303 | 299 |
| 161 | 3300025299 | Ga0209256_1001504 | Ga0209256_10015048 | 299 |
| 162 | 3300025299 | Ga0209256_1002911 | Ga0209256_10029114 | 299 |
| 163 | 3300025302 | Ga0207426_1002734 | Ga0207426_10027344 | 299 |
| 164 | 3300025303 | Ga0209051_1009294 | Ga0209051_10092942 | 299 |
| 165 | 3300025304 | Ga0209257_1000033 | Ga0209257_100003398 | 299 |
| 166 | 3300025304 | Ga0209257_1000556 | Ga0209257_100055610 | 299 |
| 167 | 3300025304 | Ga0209257_1001266 | Ga0209257_100126618 | 299 |
| 168 | 3300032004 | Ga0307414_10082205 | Ga0307414_100822051 | 299 |
| 169 | 3300032005 | Ga0307411_10002442 | Ga0307411_100024422 | 299 |
| 170 | 3300037471 | Ga0395905_0001707 | Ga0395905_0001707_4704_5633 | 299 |
| 171 | 3300046507 | Ga0495606_0027360 | Ga0495606_0027360_2152_3072 | 299 |
| 172 | 3300046513 | Ga0495616_0002097 | Ga0495616_0002097_2212_3162 | 299 |
| 173 | 3300046519 | Ga0495632_0000566 | Ga0495632_0000566_23102_24010 | 299 |
| 174 | 3300046538 | Ga0495609_0003721 | Ga0495609_0003721_62_1012 | 299 |
| 175 | 3300046660 | Ga0495625_0024430 | Ga0495625_0024430_2687_3604 | 299 |
| 176 | 3300046660 | Ga0495625_0051383 | Ga0495625_0051383_1250_2170 | 299 |
| 177 | 3300046691 | Ga0495670_0017049 | Ga0495670_0017049_1381_2331 | 299 |
| 178 | 3300046694 | Ga0495649_0024212 | Ga0495649_0024212_2416_3324 | 299 |
| 179 | 3300046810 | Ga0495660_0064503 | Ga0495660_0064503_395_1315 | 299 |
| 180 | 3300049459 | Ga0495678_002745 | Ga0495678_002745_10032_10940 | 299 |
| 181 | 3300049460 | Ga0495682_0002545 | Ga0495682_0002545_2543_3493 | 299 |
| 182 | 3300049517 | Ga0501294_002960 | Ga0501294_002960_476_1387 | 299 |
| 183 | 3300049519 | Ga0501296_008442 | Ga0501296_008442_81_992 | 299 |
| 184 | 3300049663 | Ga0501223_017808 | Ga0501223_017808_387_1298 | 299 |
| 185 | 3300049665 | Ga0501227_019583 | Ga0501227_019583_475_1404 | 299 |
| 186 | 3300049669 | Ga0501235_004034 | Ga0501235_004034_567_1478 | 299 |
| 187 | 3300049684 | Ga0501255_001590 | Ga0501255_001590_71_982 | 299 |
| 188 | 3300049769 | Ga0501272_001324 | Ga0501272_001324_143_1054 | 299 |
| 189 | 3300049775 | Ga0501279_002615 | Ga0501279_002615_1031_1936 | 299 |
| 190 | iso_pu_bacteria | 2643221585 | 2643932823 | 299 |
| 191 | iso_pu_bacteria | 2643221645 | 2644254846 | 299 |
| 192 | iso_pu_bacteria | 2643221656 | 2644314073 | 299 |
| 193 | iso_pu_bacteria | 2738541300 | 2738842984 | 299 |
| 194 | iso_pu_bacteria | 2738543018 | 2739273732 | 299 |
| 195 | iso_pu_bacteria | 2738543030 | 2739342776 | 299 |
| 196 | iso_pu_bacteria | 2857558681 | 2857562097 | 299 |
| 197 | iso_pu_bacteria | 2857564685 | 2857567896 | 299 |
| 198 | 3300009148 | Ga0105243_10197363 | Ga0105243_101973632 | 300 |
| 199 | 3300025935 | Ga0207709_10121229 | Ga0207709_101212292 | 300 |
| 200 | 3300031548 | Ga0307408_100000037 | Ga0307408_10000003737 | 300 |
| 201 | 3300031838 | Ga0307518_10067586 | Ga0307518_100675864 | 300 |
| 202 | 3300046460 | Ga0495638_0000408 | Ga0495638_0000408_39478_40428 | 300 |
| 203 | 3300046474 | Ga0495605_0000873 | Ga0495605_0000873_19603_20553 | 300 |
| 204 | 3300046501 | Ga0495607_0038470 | Ga0495607_0038470_1386_2336 | 300 |
| 205 | 3300046506 | Ga0495583_0000231 | Ga0495583_0000231_9463_10413 | 300 |
| 206 | 3300046513 | Ga0495616_0031076 | Ga0495616_0031076_180_1130 | 300 |
| 207 | 3300046519 | Ga0495632_0000342 | Ga0495632_0000342_10298_11206 | 300 |
| 208 | 3300046523 | Ga0495644_0000471 | Ga0495644_0000471_16196_17146 | 300 |
| 209 | 3300046524 | Ga0495648_0020374 | Ga0495648_0020374_1439_2389 | 300 |
| 210 | 3300046528 | Ga0495642_0045659 | Ga0495642_0045659_319_1227 | 300 |
| 211 | 3300046538 | Ga0495609_0000616 | Ga0495609_0000616_7478_8428 | 300 |
| 212 | 3300046660 | Ga0495625_0050583 | Ga0495625_0050583_1429_2379 | 300 |
| 213 | 3300046664 | Ga0495659_0003174 | Ga0495659_0003174_1192_2142 | 300 |
| 214 | 3300046692 | Ga0495671_0026566 | Ga0495671_0026566_1493_2443 | 300 |
| 215 | 3300046810 | Ga0495660_0007977 | Ga0495660_0007977_5008_5919 | 300 |
| 216 | 3300047318 | Ga0495636_0000144 | Ga0495636_0000144_27401_28351 | 300 |
| 217 | 3300047320 | Ga0495672_0126256 | Ga0495672_0126256_287_1237 | 300 |
| 218 | 3300047321 | Ga0495676_0069415 | Ga0495676_0069415_1114_2019 | 300 |
| 219 | 3300047323 | Ga0495683_0000336 | Ga0495683_0000336_9679_10629 | 300 |
| 220 | 3300047323 | Ga0495683_0077960 | Ga0495683_0077960_671_1582 | 300 |
| 221 | 3300047443 | Ga0495687_000042 | Ga0495687_000042_9463_10413 | 300 |
| 222 | 3300047445 | Ga0495677_0000678 | Ga0495677_0000678_11313_12263 | 300 |
| 223 | 3300047447 | Ga0495685_001534 | Ga0495685_001534_5580_6530 | 300 |
| 224 | 3300047469 | Ga0495673_0019469 | Ga0495673_0019469_1659_2609 | 300 |
| 225 | 3300047470 | Ga0495681_0015958 | Ga0495681_0015958_583_1494 | 300 |
| 226 | 3300049459 | Ga0495678_011469 | Ga0495678_011469_116_1066 | 300 |
| 227 | 3300053121 | Ga0500607_012081 | Ga0500607_012081_111_1028 | 300 |
| 228 | iso_pu_bacteria | 2738541297 | 2738826673 | 300 |
| 229 | iso_pu_bacteria | 2738541357 | 2739150470 | 300 |
| 230 | iso_pu_bacteria | 2738543003 | 2739192389 | 300 |
| 231 | iso_pu_bacteria | 2738543026 | 2739318866 | 300 |
| 232 | iso_pu_bacteria | 2738543029 | 2739337107 | 300 |
| 233 | iso_pu_bacteria | 2821131069 | 2821135390 | 300 |
| 234 | 3300005547 | Ga0070693_100019375 | Ga0070693_1000193752 | 301 |
| 235 | 3300009036 | Ga0105244_10001189 | Ga0105244_1000118911 | 301 |
| 236 | 3300025728 | Ga0207655_1002972 | Ga0207655_10029726 | 301 |
| 237 | 3300042011 | Ga0439454_015276 | Ga0439454_015276_151_1062 | 301 |
| 238 | 3300046459 | Ga0495629_0242586 | Ga0495629_0242586_97_1008 | 301 |
| 239 | 3300046491 | Ga0495584_0021745 | Ga0495584_0021745_2044_2964 | 301 |
| 240 | 3300046491 | Ga0495584_0091770 | Ga0495584_0091770_355_1266 | 301 |
| 241 | 3300046513 | Ga0495616_0073418 | Ga0495616_0073418_374_1285 | 301 |
| 242 | 3300046520 | Ga0495637_0000240 | Ga0495637_0000240_5233_6144 | 301 |
| 243 | 3300046524 | Ga0495648_0007917 | Ga0495648_0007917_353_1303 | 301 |
| 244 | 3300046530 | Ga0495654_0000131 | Ga0495654_0000131_10105_11016 | 301 |
| 245 | 3300046557 | Ga0495622_0013885 | Ga0495622_0013885_2729_3640 | 301 |
| 246 | 3300046557 | Ga0495622_0093385 | Ga0495622_0093385_97_1008 | 301 |
| 247 | 3300046558 | Ga0495633_0026584 | Ga0495633_0026584_1897_2808 | 301 |
| 248 | 3300046648 | Ga0495611_0017119 | Ga0495611_0017119_812_1723 | 301 |
| 249 | 3300046674 | Ga0495588_0066309 | Ga0495588_0066309_345_1256 | 301 |
| 250 | 3300046684 | Ga0495669_0002501 | Ga0495669_0002501_378_1289 | 301 |
| 251 | 3300047315 | Ga0495581_0034695 | Ga0495581_0034695_170_1081 | 301 |
| 252 | 3300047321 | Ga0495676_0000097 | Ga0495676_0000097_11604_12515 | 301 |
| 253 | 3300047323 | Ga0495683_0017527 | Ga0495683_0017527_1606_2556 | 301 |
| 254 | 3300047443 | Ga0495687_010355 | Ga0495687_010355_222_1133 | 301 |
| 255 | 3300048088 | Ga0495602_0014183 | Ga0495602_0014183_3509_4447 | 301 |
| 256 | 3300048089 | Ga0495614_0001960 | Ga0495614_0001960_4118_5029 | 301 |
| 257 | 3300048091 | Ga0495626_0005864 | Ga0495626_0005864_3909_4820 | 301 |
| 258 | 3300048904 | Ga0496101_0074104 | Ga0496101_0074104_879_1790 | 301 |
| 259 | 3300048916 | Ga0496113_0394832 | Ga0496113_0394832_109_1020 | 301 |
| 260 | 3300048925 | Ga0496122_0000980 | Ga0496122_0000980_10693_11604 | 301 |
| 261 | 3300048926 | Ga0496123_0004729 | Ga0496123_0004729_11185_12096 | 301 |
| 262 | 3300048928 | Ga0496125_0005645 | Ga0496125_0005645_1892_2803 | 301 |
| 263 | 3300050496 | nmdc:mga07m45_5560_c1 | nmdc:mga07m45_5560_c1_2250_3182 | 301 |
| 264 | iso_pu_bacteria | 2808606418 | 2809145984 | 301 |
| 265 | 3300046457 | Ga0495590_0000118 | Ga0495590_0000118_10756_11670 | 302 |
| 266 | 3300046458 | Ga0495591_000214 | Ga0495591_000214_51845_52759 | 302 |
| 267 | 3300046459 | Ga0495629_0040624 | Ga0495629_0040624_28_942 | 302 |
| 268 | 3300046463 | Ga0495653_0006181 | Ga0495653_0006181_376_1314 | 302 |
| 269 | 3300046471 | Ga0495650_0000084 | Ga0495650_0000084_226830_227780 | 302 |
| 270 | 3300046472 | Ga0495580_0012124 | Ga0495580_0012124_3978_4916 | 302 |
| 271 | 3300046473 | Ga0495582_0005956 | Ga0495582_0005956_2122_3060 | 302 |
| 272 | 3300046474 | Ga0495605_0020160 | Ga0495605_0020160_719_1669 | 302 |
| 273 | 3300046491 | Ga0495584_0000482 | Ga0495584_0000482_17097_18041 | 302 |
| 274 | 3300046491 | Ga0495584_0000609 | Ga0495584_0000609_692_1606 | 302 |
| 275 | 3300046491 | Ga0495584_0006265 | Ga0495584_0006265_2110_3036 | 302 |
| 276 | 3300046500 | Ga0495596_0001436 | Ga0495596_0001436_6440_7390 | 302 |
| 277 | 3300046501 | Ga0495607_0001141 | Ga0495607_0001141_4918_5832 | 302 |
| 278 | 3300046501 | Ga0495607_0042076 | Ga0495607_0042076_560_1474 | 302 |
| 279 | 3300046506 | Ga0495583_0001074 | Ga0495583_0001074_19334_20248 | 302 |
| 280 | 3300046506 | Ga0495583_0001094 | Ga0495583_0001094_28051_28974 | 302 |
| 281 | 3300046507 | Ga0495606_0000400 | Ga0495606_0000400_9106_10026 | 302 |
| 282 | 3300046512 | Ga0495610_0001351 | Ga0495610_0001351_10150_11064 | 302 |
| 283 | 3300046512 | Ga0495610_0006638 | Ga0495610_0006638_4819_5736 | 302 |
| 284 | 3300046513 | Ga0495616_0021450 | Ga0495616_0021450_2390_3304 | 302 |
| 285 | 3300046518 | Ga0495631_0000349 | Ga0495631_0000349_5508_6422 | 302 |
| 286 | 3300046518 | Ga0495631_0000452 | Ga0495631_0000452_10706_11620 | 302 |
| 287 | 3300046519 | Ga0495632_0000025 | Ga0495632_0000025_10345_11262 | 302 |
| 288 | 3300046519 | Ga0495632_0059315 | Ga0495632_0059315_36_950 | 302 |
| 289 | 3300046520 | Ga0495637_0000003 | Ga0495637_0000003_611674_612588 | 302 |
| 290 | 3300046522 | Ga0495643_0003125 | Ga0495643_0003125_11277_12188 | 302 |
| 291 | 3300046522 | Ga0495643_0019321 | Ga0495643_0019321_360_1274 | 302 |
| 292 | 3300046523 | Ga0495644_0045983 | Ga0495644_0045983_36_950 | 302 |
| 293 | 3300046526 | Ga0495666_0003104 | Ga0495666_0003104_5916_6854 | 302 |
| 294 | 3300046530 | Ga0495654_0013625 | Ga0495654_0013625_1864_2778 | 302 |
| 295 | 3300046530 | Ga0495654_0068243 | Ga0495654_0068243_252_1175 | 302 |
| 296 | 3300046531 | Ga0495665_0006428 | Ga0495665_0006428_3038_3976 | 302 |
| 297 | 3300046533 | Ga0495640_0126903 | Ga0495640_0126903_449_1387 | 302 |
| 298 | 3300046536 | Ga0495587_0051136 | Ga0495587_0051136_343_1281 | 302 |
| 299 | 3300046538 | Ga0495609_0014613 | Ga0495609_0014613_383_1297 | 302 |
| 300 | 3300046542 | Ga0495597_0000340 | Ga0495597_0000340_4570_5484 | 302 |
| 301 | 3300046542 | Ga0495597_0000415 | Ga0495597_0000415_25415_26329 | 302 |
| 302 | 3300046558 | Ga0495633_0001267 | Ga0495633_0001267_13202_14116 | 302 |
| 303 | 3300046616 | Ga0495668_0001212 | Ga0495668_0001212_4411_5325 | 302 |
| 304 | 3300046642 | Ga0495634_0001509 | Ga0495634_0001509_1892_2830 | 302 |
| 305 | 3300046648 | Ga0495611_0000370 | Ga0495611_0000370_18373_19287 | 302 |
| 306 | 3300046660 | Ga0495625_0016339 | Ga0495625_0016339_111_1025 | 302 |
| 307 | 3300046664 | Ga0495659_0000131 | Ga0495659_0000131_10729_11646 | 302 |
| 308 | 3300046665 | Ga0495661_0005799 | Ga0495661_0005799_7391_8305 | 302 |
| 309 | 3300046692 | Ga0495671_0000424 | Ga0495671_0000424_11376_12293 | 302 |
| 310 | 3300046692 | Ga0495671_0016501 | Ga0495671_0016501_648_1565 | 302 |
| 311 | 3300046692 | Ga0495671_0017036 | Ga0495671_0017036_2677_3591 | 302 |
| 312 | 3300046694 | Ga0495649_0002046 | Ga0495649_0002046_3365_4279 | 302 |
| 313 | 3300046794 | Ga0495589_0000287 | Ga0495589_0000287_29728_30642 | 302 |
| 314 | 3300046794 | Ga0495589_0002781 | Ga0495589_0002781_260_1174 | 302 |
| 315 | 3300046794 | Ga0495589_0004277 | Ga0495589_0004277_737_1687 | 302 |
| 316 | 3300046809 | Ga0495600_0021038 | Ga0495600_0021038_2234_3172 | 302 |
| 317 | 3300046810 | Ga0495660_0084426 | Ga0495660_0084426_554_1468 | 302 |
| 318 | 3300047317 | Ga0495604_0019809 | Ga0495604_0019809_2205_3143 | 302 |
| 319 | 3300047319 | Ga0495674_0028570 | Ga0495674_0028570_2930_3844 | 302 |
| 320 | 3300047320 | Ga0495672_0000678 | Ga0495672_0000678_7759_8709 | 302 |
| 321 | 3300047320 | Ga0495672_0000973 | Ga0495672_0000973_18115_19032 | 302 |
| 322 | 3300047321 | Ga0495676_0090820 | Ga0495676_0090820_1004_1915 | 302 |
| 323 | 3300047443 | Ga0495687_000462 | Ga0495687_000462_48374_49288 | 302 |
| 324 | 3300047445 | Ga0495677_0000454 | Ga0495677_0000454_16377_17291 | 302 |
| 325 | 3300047446 | Ga0495679_006199 | Ga0495679_006199_1373_2287 | 302 |
| 326 | 3300047446 | Ga0495679_009483 | Ga0495679_009483_546_1460 | 302 |
| 327 | 3300047447 | Ga0495685_001869 | Ga0495685_001869_2110_3024 | 302 |
| 328 | 3300047470 | Ga0495681_0036382 | Ga0495681_0036382_1177_2091 | 302 |
| 329 | 3300048918 | Ga0496115_0153307 | Ga0496115_0153307_515_1426 | 302 |
| 330 | 3300049459 | Ga0495678_000202 | Ga0495678_000202_10295_11209 | 302 |
| 331 | 3300002738 | JGI25154J39366_1001554 | JGI25154J39366_10015546 | 303 |
| 332 | 3300005262 | Ga0065165_1000772 | Ga0065165_100077211 | 303 |
| 333 | 3300021361 | Ga0213872_10000373 | Ga0213872_1000037314 | 303 |
| 334 | 3300025233 | Ga0209437_112209 | Ga0209437_1122091 | 303 |
| 335 | 3300025246 | Ga0209646_1000613 | Ga0209646_10006133 | 303 |
| 336 | 3300028794 | Ga0307515_10249686 | Ga0307515_102496862 | 303 |
| 337 | 3300039447 | Ga0436361_0580915 | Ga0436361_0580915_20027_20956 | 303 |
| 338 | 3300042139 | Ga0450904_000068 | Ga0450904_000068_6135_7061 | 303 |
| 339 | 3300046455 | Ga0495603_0025604 | Ga0495603_0025604_894_1823 | 303 |
| 340 | 3300046460 | Ga0495638_0000064 | Ga0495638_0000064_166485_167423 | 303 |
| 341 | 3300046471 | Ga0495650_0000257 | Ga0495650_0000257_13642_14559 | 303 |
| 342 | 3300046474 | Ga0495605_0001968 | Ga0495605_0001968_1555_2472 | 303 |
| 343 | 3300046491 | Ga0495584_0001576 | Ga0495584_0001576_2287_3204 | 303 |
| 344 | 3300046492 | Ga0495585_0000404 | Ga0495585_0000404_18247_19176 | 303 |
| 345 | 3300046492 | Ga0495585_0001486 | Ga0495585_0001486_16983_17897 | 303 |
| 346 | 3300046492 | Ga0495585_0001735 | Ga0495585_0001735_4740_5654 | 303 |
| 347 | 3300046492 | Ga0495585_0052286 | Ga0495585_0052286_893_1810 | 303 |
| 348 | 3300046500 | Ga0495596_0022085 | Ga0495596_0022085_887_1804 | 303 |
| 349 | 3300046507 | Ga0495606_0007181 | Ga0495606_0007181_219_1139 | 303 |
| 350 | 3300046512 | Ga0495610_0000027 | Ga0495610_0000027_264460_265380 | 303 |
| 351 | 3300046512 | Ga0495610_0049988 | Ga0495610_0049988_782_1702 | 303 |
| 352 | 3300046513 | Ga0495616_0000072 | Ga0495616_0000072_11394_12323 | 303 |
| 353 | 3300046513 | Ga0495616_0024185 | Ga0495616_0024185_452_1369 | 303 |
| 354 | 3300046515 | Ga0495620_0004824 | Ga0495620_0004824_6427_7356 | 303 |
| 355 | 3300046519 | Ga0495632_0022704 | Ga0495632_0022704_622_1539 | 303 |
| 356 | 3300046522 | Ga0495643_0000906 | Ga0495643_0000906_1255_2181 | 303 |
| 357 | 3300046523 | Ga0495644_0010246 | Ga0495644_0010246_2268_3185 | 303 |
| 358 | 3300046528 | Ga0495642_0001769 | Ga0495642_0001769_7952_8881 | 303 |
| 359 | 3300046528 | Ga0495642_0026741 | Ga0495642_0026741_577_1494 | 303 |
| 360 | 3300046535 | Ga0495586_0015424 | Ga0495586_0015424_969_1883 | 303 |
| 361 | 3300046538 | Ga0495609_0004228 | Ga0495609_0004228_5774_6691 | 303 |
| 362 | 3300046557 | Ga0495622_0023471 | Ga0495622_0023471_1611_2525 | 303 |
| 363 | 3300046558 | Ga0495633_0000535 | Ga0495633_0000535_10940_11857 | 303 |
| 364 | 3300046558 | Ga0495633_0011104 | Ga0495633_0011104_807_1727 | 303 |
| 365 | 3300046615 | Ga0495656_0002559 | Ga0495656_0002559_3008_3925 | 303 |
| 366 | 3300046648 | Ga0495611_0013636 | Ga0495611_0013636_1813_2745 | 303 |
| 367 | 3300046648 | Ga0495611_0072063 | Ga0495611_0072063_437_1354 | 303 |
| 368 | 3300046665 | Ga0495661_0041137 | Ga0495661_0041137_646_1563 | 303 |
| 369 | 3300046674 | Ga0495588_0113477 | Ga0495588_0113477_142_1071 | 303 |
| 370 | 3300046692 | Ga0495671_0000106 | Ga0495671_0000106_73669_74589 | 303 |
| 371 | 3300046692 | Ga0495671_0005258 | Ga0495671_0005258_284_1234 | 303 |
| 372 | 3300046810 | Ga0495660_0007612 | Ga0495660_0007612_5217_6134 | 303 |
| 373 | 3300047323 | Ga0495683_0001078 | Ga0495683_0001078_16354_17268 | 303 |
| 374 | 3300047472 | Ga0495686_0010126 | Ga0495686_0010126_5384_6310 | 303 |
| 375 | 3300048091 | Ga0495626_0013229 | Ga0495626_0013229_382_1302 | 303 |
| 376 | 3300049460 | Ga0495682_0016364 | Ga0495682_0016364_395_1312 | 303 |
| 377 | 3300053125 | Ga0500618_019432 | Ga0500618_019432_445_1362 | 303 |
| 378 | iso_pu_bacteria | 8047673197 | 8047676193 | 303 |
| 379 | 3300005539 | Ga0068853_100140174 | Ga0068853_1001401742 | 304 |
| 380 | 3300021361 | Ga0213872_10000561 | Ga0213872_1000056124 | 304 |
| 381 | 3300026041 | Ga0207639_10116028 | Ga0207639_101160282 | 304 |
| 382 | 3300026142 | Ga0207698_10021747 | Ga0207698_100217473 | 304 |
| 383 | 3300031239 | Ga0265328_10008548 | Ga0265328_100085484 | 304 |
| 384 | 3300031250 | Ga0265331_10007271 | Ga0265331_100072718 | 304 |
| 385 | 3300031251 | Ga0265327_10000042 | Ga0265327_1000004296 | 304 |
| 386 | 3300031711 | Ga0265314_10068838 | Ga0265314_100688381 | 304 |
| 387 | 3300039447 | Ga0436361_0470837 | Ga0436361_0470837_4195_5142 | 304 |
| 388 | 3300044684 | Ga0466966_0028359 | Ga0466966_0028359_275_1195 | 304 |
| 389 | 3300045836 | Ga0466958_0090233 | Ga0466958_0090233_157_1077 | 304 |
| 390 | 3300046452 | Ga0495617_000157 | Ga0495617_000157_9797_10723 | 304 |
| 391 | 3300046452 | Ga0495617_001215 | Ga0495617_001215_7346_8263 | 304 |
| 392 | 3300046471 | Ga0495650_0000283 | Ga0495650_0000283_15311_16249 | 304 |
| 393 | 3300046492 | Ga0495585_0000352 | Ga0495585_0000352_9278_10204 | 304 |
| 394 | 3300046492 | Ga0495585_0000524 | Ga0495585_0000524_13887_14804 | 304 |
| 395 | 3300046492 | Ga0495585_0041147 | Ga0495585_0041147_1266_2186 | 304 |
| 396 | 3300046506 | Ga0495583_0000137 | Ga0495583_0000137_111590_112510 | 304 |
| 397 | 3300046507 | Ga0495606_0000703 | Ga0495606_0000703_7174_8112 | 304 |
| 398 | 3300046512 | Ga0495610_0001490 | Ga0495610_0001490_16872_17801 | 304 |
| 399 | 3300046513 | Ga0495616_0000324 | Ga0495616_0000324_26124_27041 | 304 |
| 400 | 3300046518 | Ga0495631_0003687 | Ga0495631_0003687_5348_6265 | 304 |
| 401 | 3300046522 | Ga0495643_0000471 | Ga0495643_0000471_10970_11899 | 304 |
| 402 | 3300046524 | Ga0495648_0000134 | Ga0495648_0000134_75908_76825 | 304 |
| 403 | 3300046524 | Ga0495648_0004553 | Ga0495648_0004553_1769_2698 | 304 |
| 404 | 3300046524 | Ga0495648_0012043 | Ga0495648_0012043_5186_6112 | 304 |
| 405 | 3300046528 | Ga0495642_0007579 | Ga0495642_0007579_3083_4009 | 304 |
| 406 | 3300046558 | Ga0495633_0004214 | Ga0495633_0004214_7661_8587 | 304 |
| 407 | 3300046616 | Ga0495668_0002631 | Ga0495668_0002631_6938_7858 | 304 |
| 408 | 3300046648 | Ga0495611_0104947 | Ga0495611_0104947_240_1157 | 304 |
| 409 | 3300046660 | Ga0495625_0001523 | Ga0495625_0001523_3040_3969 | 304 |
| 410 | 3300046660 | Ga0495625_0074471 | Ga0495625_0074471_1341_2270 | 304 |
| 411 | 3300046694 | Ga0495649_0023389 | Ga0495649_0023389_1416_2345 | 304 |
| 412 | 3300047320 | Ga0495672_0000399 | Ga0495672_0000399_10970_11899 | 304 |
| 413 | 3300047323 | Ga0495683_0011104 | Ga0495683_0011104_2792_3718 | 304 |
| 414 | 3300047323 | Ga0495683_0011328 | Ga0495683_0011328_677_1597 | 304 |
| 415 | 3300047443 | Ga0495687_000115 | Ga0495687_000115_11355_12281 | 304 |
| 416 | 3300047469 | Ga0495673_0000008 | Ga0495673_0000008_9544_10473 | 304 |
| 417 | 3300047469 | Ga0495673_0000009 | Ga0495673_0000009_9998_10924 | 304 |
| 418 | 3300047472 | Ga0495686_0011743 | Ga0495686_0011743_771_1697 | 304 |
| 419 | 3300048091 | Ga0495626_0008641 | Ga0495626_0008641_2207_3139 | 304 |
| 420 | 3300048924 | Ga0496121_0066302 | Ga0496121_0066302_215_1135 | 304 |
| 421 | 3300048927 | Ga0496124_0088439 | Ga0496124_0088439_1305_2225 | 304 |
| 422 | 3300049459 | Ga0495678_000403 | Ga0495678_000403_32022_32948 | 304 |
| 423 | 3300049459 | Ga0495678_001894 | Ga0495678_001894_8827_9747 | 304 |
| 424 | 3300053118 | Ga0500594_0035164 | Ga0500594_0035164_243_1163 | 304 |
| 425 | 3300053145 | Ga0500586_000093 | Ga0500586_000093_4751_5677 | 304 |
| 426 | 3300003759 | Ga0055525_1000031 | Ga0055525_100003119 | 305 |
| 427 | 3300003771 | Ga0055526_1000030 | Ga0055526_1000030123 | 305 |
| 428 | 3300025230 | Ga0209563_100044 | Ga0209563_10004488 | 305 |
| 429 | 3300025295 | Ga0209564_1000010 | Ga0209564_100001014 | 305 |
| 430 | 3300032005 | Ga0307411_10224467 | Ga0307411_102244672 | 305 |
| 431 | 3300039447 | Ga0436361_0714431 | Ga0436361_0714431_78413_79354 | 305 |
| 432 | 3300042127 | Ga0450890_001083 | Ga0450890_001083_2602_3609 | 305 |
| 433 | 3300042129 | Ga0450891_000393 | Ga0450891_000393_1132_2139 | 305 |
| 434 | 3300042130 | Ga0450892_000695 | Ga0450892_000695_1403_2410 | 305 |
| 435 | 3300042144 | Ga0450889_000316 | Ga0450889_000316_2551_3558 | 305 |
| 436 | 3300042532 | Ga0450893_0006564 | Ga0450893_0006564_278_1285 | 305 |
| 437 | 3300046491 | Ga0495584_0001940 | Ga0495584_0001940_10920_11843 | 305 |
| 438 | 3300046524 | Ga0495648_0011923 | Ga0495648_0011923_2909_3829 | 305 |
| 439 | 3300046558 | Ga0495633_0005435 | Ga0495633_0005435_6639_7583 | 305 |
| 440 | 3300046648 | Ga0495611_0001926 | Ga0495611_0001926_8279_9202 | 305 |
| 441 | 3300046665 | Ga0495661_0047176 | Ga0495661_0047176_289_1233 | 305 |
| 442 | 3300046691 | Ga0495670_0001054 | Ga0495670_0001054_10461_11405 | 305 |
| 443 | 3300046692 | Ga0495671_0001030 | Ga0495671_0001030_2110_3030 | 305 |
| 444 | 3300047318 | Ga0495636_0016357 | Ga0495636_0016357_1886_2809 | 305 |
| 445 | 3300048917 | Ga0496114_0007833 | Ga0496114_0007833_3566_4495 | 305 |
| 446 | 3300048928 | Ga0496125_0000313 | Ga0496125_0000313_82903_83832 | 305 |
| 447 | iso_pu_bacteria | 2643221544 | 2643743159 | 305 |
| 448 | 3300005564 | Ga0070664_100058792 | Ga0070664_1000587923 | 306 |
| 449 | 3300021361 | Ga0213872_10039696 | Ga0213872_100396961 | 306 |
| 450 | 3300039447 | Ga0436361_0784860 | Ga0436361_0784860_5292_6248 | 306 |
| 451 | 3300046491 | Ga0495584_0012735 | Ga0495584_0012735_2510_3439 | 306 |
| 452 | 3300046500 | Ga0495596_0030896 | Ga0495596_0030896_92_1021 | 306 |
| 453 | 3300046501 | Ga0495607_0064355 | Ga0495607_0064355_826_1749 | 306 |
| 454 | 3300046507 | Ga0495606_0223765 | Ga0495606_0223765_88_1017 | 306 |
| 455 | 3300046513 | Ga0495616_0055243 | Ga0495616_0055243_311_1255 | 306 |
| 456 | 3300046522 | Ga0495643_0105764 | Ga0495643_0105764_191_1114 | 306 |
| 457 | 3300046524 | Ga0495648_0010909 | Ga0495648_0010909_5019_5942 | 306 |
| 458 | 3300046528 | Ga0495642_0001010 | Ga0495642_0001010_9409_10332 | 306 |
| 459 | 3300046665 | Ga0495661_0002371 | Ga0495661_0002371_102_1025 | 306 |
| 460 | 3300047472 | Ga0495686_0000728 | Ga0495686_0000728_28328_29284 | 306 |
| 461 | 3300048905 | Ga0496102_0000611 | Ga0496102_0000611_22310_23233 | 306 |
| 462 | 3300049571 | Ga0501034_0117343 | Ga0501034_0117343_753_1676 | 306 |
| 463 | iso_pu_bacteria | 2857547612 | 2857548981 | 306 |
| 464 | 3300005293 | Ga0065715_10022803 | Ga0065715_100228032 | 307 |
| 465 | 3300005618 | Ga0068864_100061979 | Ga0068864_1000619793 | 307 |
| 466 | 3300006237 | Ga0097621_100094490 | Ga0097621_1000944903 | 307 |
| 467 | 3300009177 | Ga0105248_10006169 | Ga0105248_100061697 | 307 |
| 468 | 3300025931 | Ga0207644_10000378 | Ga0207644_100003789 | 307 |
| 469 | 3300025941 | Ga0207711_10010530 | Ga0207711_100105303 | 307 |
| 470 | 3300046524 | Ga0495648_0118645 | Ga0495648_0118645_71_1000 | 307 |
| 471 | 3300046664 | Ga0495659_0004375 | Ga0495659_0004375_2442_3371 | 307 |
| 472 | 3300046665 | Ga0495661_0022463 | Ga0495661_0022463_2803_3732 | 307 |
| 473 | 3300046681 | Ga0495647_0018327 | Ga0495647_0018327_1263_2258 | 307 |
| 474 | 3300046691 | Ga0495670_0005293 | Ga0495670_0005293_3176_4105 | 307 |
| 475 | 3300046810 | Ga0495660_0005163 | Ga0495660_0005163_280_1209 | 307 |
| 476 | 3300047318 | Ga0495636_0010710 | Ga0495636_0010710_2420_3346 | 307 |
| 477 | 3300047443 | Ga0495687_000619 | Ga0495687_000619_39950_40879 | 307 |
| 478 | 3300048904 | Ga0496101_0165790 | Ga0496101_0165790_682_1614 | 307 |
| 479 | 3300048905 | Ga0496102_0015675 | Ga0496102_0015675_284_1210 | 307 |
| 480 | 3300048909 | Ga0496106_0017181 | Ga0496106_0017181_4141_5070 | 307 |
| 481 | 3300048925 | Ga0496122_0008792 | Ga0496122_0008792_8673_9602 | 307 |
| 482 | 3300053077 | Ga0495601_0159498 | Ga0495601_0159498_240_1235 | 307 |
| 483 | 3300005288 | Ga0065714_10127593 | Ga0065714_101275931 | 308 |
| 484 | 3300005328 | Ga0070676_10137126 | Ga0070676_101371262 | 308 |
| 485 | 3300005330 | Ga0070690_100016167 | Ga0070690_1000161673 | 308 |
| 486 | 3300005331 | Ga0070670_100220619 | Ga0070670_1002206192 | 308 |
| 487 | 3300005334 | Ga0068869_100003613 | Ga0068869_1000036133 | 308 |
| 488 | 3300005335 | Ga0070666_10000989 | Ga0070666_1000098912 | 308 |
| 489 | 3300005338 | Ga0068868_100065307 | Ga0068868_1000653072 | 308 |
| 490 | 3300005343 | Ga0070687_100019808 | Ga0070687_1000198083 | 308 |
| 491 | 3300005347 | Ga0070668_100000210 | Ga0070668_1000002106 | 308 |
| 492 | 3300005354 | Ga0070675_100043763 | Ga0070675_1000437634 | 308 |
| 493 | 3300005356 | Ga0070674_100001560 | Ga0070674_1000015603 | 308 |
| 494 | 3300005367 | Ga0070667_100000294 | Ga0070667_1000002945 | 308 |
| 495 | 3300005457 | Ga0070662_100001733 | Ga0070662_1000017336 | 308 |
| 496 | 3300005457 | Ga0070662_100297798 | Ga0070662_1002977982 | 308 |
| 497 | 3300005459 | Ga0068867_100001702 | Ga0068867_1000017024 | 308 |
| 498 | 3300005543 | Ga0070672_100000286 | Ga0070672_1000002863 | 308 |
| 499 | 3300005543 | Ga0070672_100041120 | Ga0070672_1000411202 | 308 |
| 500 | 3300005564 | Ga0070664_100145962 | Ga0070664_1001459622 | 308 |
| 501 | 3300005616 | Ga0068852_100055576 | Ga0068852_1000555763 | 308 |
| 502 | 3300005617 | Ga0068859_100042640 | Ga0068859_1000426404 | 308 |
| 503 | 3300005719 | Ga0068861_100002282 | Ga0068861_1000022824 | 308 |
| 504 | 3300005841 | Ga0068863_100000638 | Ga0068863_1000006384 | 308 |
| 505 | 3300005842 | Ga0068858_100000623 | Ga0068858_10000062318 | 308 |
| 506 | 3300005843 | Ga0068860_100001020 | Ga0068860_10000102022 | 308 |
| 507 | 3300006881 | Ga0068865_100003535 | Ga0068865_1000035355 | 308 |
| 508 | 3300006931 | Ga0097620_100042638 | Ga0097620_1000426384 | 308 |
| 509 | 3300009098 | Ga0105245_10004988 | Ga0105245_100049884 | 308 |
| 510 | 3300009148 | Ga0105243_10010278 | Ga0105243_100102786 | 308 |
| 511 | 3300009177 | Ga0105248_10146359 | Ga0105248_101463593 | 308 |
| 512 | 3300013306 | Ga0163162_10000701 | Ga0163162_1000070121 | 308 |
| 513 | 3300013308 | Ga0157375_10002767 | Ga0157375_100027673 | 308 |
| 514 | 3300013308 | Ga0157375_10026291 | Ga0157375_100262914 | 308 |
| 515 | 3300014326 | Ga0157380_10000472 | Ga0157380_100004724 | 308 |
| 516 | 3300014968 | Ga0157379_10001128 | Ga0157379_100011288 | 308 |
| 517 | 3300017792 | Ga0163161_10023274 | Ga0163161_100232744 | 308 |
| 518 | 3300025901 | Ga0207688_10149732 | Ga0207688_101497322 | 308 |
| 519 | 3300025903 | Ga0207680_10001583 | Ga0207680_100015833 | 308 |
| 520 | 3300025907 | Ga0207645_10022783 | Ga0207645_100227834 | 308 |
| 521 | 3300025907 | Ga0207645_10031602 | Ga0207645_100316022 | 308 |
| 522 | 3300025918 | Ga0207662_10035309 | Ga0207662_100353092 | 308 |
| 523 | 3300025923 | Ga0207681_10004051 | Ga0207681_100040513 | 308 |
| 524 | 3300025925 | Ga0207650_10286988 | Ga0207650_102869882 | 308 |
| 525 | 3300025926 | Ga0207659_10030922 | Ga0207659_100309224 | 308 |
| 526 | 3300025926 | Ga0207659_10181085 | Ga0207659_101810852 | 308 |
| 527 | 3300025927 | Ga0207687_10025555 | Ga0207687_100255553 | 308 |
| 528 | 3300025933 | Ga0207706_10016222 | Ga0207706_100162226 | 308 |
| 529 | 3300025937 | Ga0207669_10003679 | Ga0207669_100036794 | 308 |
| 530 | 3300025940 | Ga0207691_10045422 | Ga0207691_100454222 | 308 |
| 531 | 3300025941 | Ga0207711_10214006 | Ga0207711_102140062 | 308 |
| 532 | 3300025942 | Ga0207689_10005498 | Ga0207689_100054988 | 308 |
| 533 | 3300025945 | Ga0207679_10118722 | Ga0207679_101187222 | 308 |
| 534 | 3300026023 | Ga0207677_10042166 | Ga0207677_100421663 | 308 |
| 535 | 3300026035 | Ga0207703_10003715 | Ga0207703_100037157 | 308 |
| 536 | 3300026075 | Ga0207708_10026433 | Ga0207708_100264334 | 308 |
| 537 | 3300026089 | Ga0207648_10024782 | Ga0207648_100247824 | 308 |
| 538 | 3300026095 | Ga0207676_10003147 | Ga0207676_1000314710 | 308 |
| 539 | 3300026095 | Ga0207676_10023903 | Ga0207676_100239034 | 308 |
| 540 | 3300026118 | Ga0207675_100016016 | Ga0207675_1000160163 | 308 |
| 541 | 3300026142 | Ga0207698_10163203 | Ga0207698_101632032 | 308 |
| 542 | 3300028381 | Ga0268264_10004393 | Ga0268264_100043933 | 308 |
| 543 | 3300035695 | Ga0373927_0063641 | Ga0373927_0063641_177_1178 | 308 |
| 544 | 3300044658 | Ga0466972_0003231 | Ga0466972_0003231_195_1130 | 308 |
| 545 | 3300044683 | Ga0466965_0017161 | Ga0466965_0017161_1735_2670 | 308 |
| 546 | 3300044735 | Ga0466968_0001184 | Ga0466968_0001184_8285_9220 | 308 |
| 547 | 3300044842 | Ga0466957_0030284 | Ga0466957_0030284_1497_2432 | 308 |
| 548 | 3300046558 | Ga0495633_0000552 | Ga0495633_0000552_27905_28858 | 308 |
| 549 | iso_pu_bacteria | 2600255292 | 2601671176 | 308 |
| 550 | iso_pu_bacteria | 2885080285 | 2885081155 | 308 |
| 551 | 3300047318 | Ga0495636_0032030 | Ga0495636_0032030_930_1865 | 309 |
| 552 | iso_pu_bacteria | 2932422444 | 2932423039 | 309 |
| 553 | 3300015261 | Ga0182006_1000007 | Ga0182006_100000711 | 310 |
| 554 | 3300015262 | Ga0182007_10000470 | Ga0182007_1000047011 | 310 |
| 555 | 3300046457 | Ga0495590_0001148 | Ga0495590_0001148_10516_11454 | 310 |
| 556 | 3300046507 | Ga0495606_0063243 | Ga0495606_0063243_69_1007 | 310 |
| 557 | 3300046536 | Ga0495587_0025778 | Ga0495587_0025778_2313_3251 | 310 |
| 558 | 3300046536 | Ga0495587_0093565 | Ga0495587_0093565_499_1437 | 310 |
| 559 | 3300046557 | Ga0495622_0043043 | Ga0495622_0043043_315_1286 | 310 |
| 560 | 3300046680 | Ga0495646_0055444 | Ga0495646_0055444_88_1026 | 310 |
| 561 | 3300047322 | Ga0495680_0022418 | Ga0495680_0022418_810_1748 | 310 |
| 562 | 3300048091 | Ga0495626_0000043 | Ga0495626_0000043_158907_159851 | 310 |
| 563 | 3300048914 | Ga0496111_0008745 | Ga0496111_0008745_1074_2045 | 310 |
| 564 | 3300048919 | Ga0496116_0039524 | Ga0496116_0039524_1163_2134 | 310 |
| 565 | 3300048920 | Ga0496117_0000005 | Ga0496117_0000005_419434_420405 | 310 |
| 566 | 3300048921 | Ga0496118_0000022 | Ga0496118_0000022_18198_19169 | 310 |
| 567 | 3300048924 | Ga0496121_0012789 | Ga0496121_0012789_5619_6590 | 310 |
| 568 | 3300048925 | Ga0496122_0001491 | Ga0496122_0001491_28591_29562 | 310 |
| 569 | 3300048926 | Ga0496123_0001968 | Ga0496123_0001968_7577_8548 | 310 |
| 570 | 3300048927 | Ga0496124_0034594 | Ga0496124_0034594_3397_4368 | 310 |
| 571 | 3300049460 | Ga0495682_0002658 | Ga0495682_0002658_5106_6077 | 310 |
| 572 | iso_pu_bacteria | 2932410948 | 2932415322 | 310 |
| 573 | iso_pu_bacteria | 2932416698 | 2932421517 | 310 |
| 574 | 3300047320 | Ga0495672_0000088 | Ga0495672_0000088_145744_146691 | 312 |
| 575 | iso_pu_bacteria | 2548876994 | 2550695871 | 312 |
| 576 | iso_pu_bacteria | 2818991445 | 2819594830 | 312 |
| 577 | iso_pu_bacteria | 2884811622 | 2884813817 | 312 |
| 578 | iso_pu_bacteria | 2884836552 | 2884838405 | 312 |
| 579 | iso_pu_bacteria | 2884852848 | 2884854697 | 312 |
| 580 | iso_pu_bacteria | 2896154374 | 2896156635 | 312 |
| 581 | 3300048919 | Ga0496116_0097294 | Ga0496116_0097294_236_1198 | 315 |
| 582 | 3300053125 | Ga0500618_005611 | Ga0500618_005611_1142_2179 | 315 |
| 583 | 3300002704 | JGI25155J39150_1000030 | JGI25155J39150_100003092 | 316 |
| 584 | 3300002705 | JGI25156J39149_1000162 | JGI25156J39149_100016236 | 316 |
| 585 | 3300002737 | JGI25162J39368_1004105 | JGI25162J39368_10041054 | 316 |
| 586 | 3300002738 | JGI25154J39366_1000056 | JGI25154J39366_100005692 | 316 |
| 587 | 3300002741 | JGI25157J39369_1000498 | JGI25157J39369_100049818 | 316 |
| 588 | 3300003758 | Ga0055532_1000059 | Ga0055532_1000059128 | 316 |
| 589 | 3300003761 | Ga0055535_1014228 | Ga0055535_10142281 | 316 |
| 590 | 3300005331 | Ga0070670_100021572 | Ga0070670_1000215726 | 316 |
| 591 | 3300005563 | Ga0068855_100145221 | Ga0068855_1001452212 | 316 |
| 592 | 3300005616 | Ga0068852_100163918 | Ga0068852_1001639182 | 316 |
| 593 | 3300009011 | Ga0105251_10037296 | Ga0105251_100372963 | 316 |
| 594 | 3300009093 | Ga0105240_10000344 | Ga0105240_1000034467 | 316 |
| 595 | 3300009551 | Ga0105238_10030435 | Ga0105238_100304355 | 316 |
| 596 | 3300013100 | Ga0157373_10067347 | Ga0157373_100673473 | 316 |
| 597 | 3300014497 | Ga0182008_10026551 | Ga0182008_100265511 | 316 |
| 598 | 3300025206 | Ga0209435_100032 | Ga0209435_10003217 | 316 |
| 599 | 3300025229 | Ga0209147_100109 | Ga0209147_10010917 | 316 |
| 600 | 3300025233 | Ga0209437_100260 | Ga0209437_10026018 | 316 |
| 601 | 3300025242 | Ga0209258_100595 | Ga0209258_10059520 | 316 |
| 602 | 3300025246 | Ga0209646_1000113 | Ga0209646_100011317 | 316 |
| 603 | 3300025250 | Ga0209026_1000102 | Ga0209026_100010217 | 316 |
| 604 | 3300025256 | Ga0209759_1000104 | Ga0209759_100010417 | 316 |
| 605 | 3300025272 | Ga0209455_1005597 | Ga0209455_10055974 | 316 |
| 606 | 3300025913 | Ga0207695_10012277 | Ga0207695_100122775 | 316 |
| 607 | 3300025924 | Ga0207694_10013637 | Ga0207694_100136373 | 316 |
| 608 | 3300025949 | Ga0207667_10219657 | Ga0207667_102196571 | 316 |
| 609 | 3300026142 | Ga0207698_10002844 | Ga0207698_100028449 | 316 |
| 610 | 3300046660 | Ga0495625_0002248 | Ga0495625_0002248_16990_17961 | 316 |
| 611 | 3300048921 | Ga0496118_0017010 | Ga0496118_0017010_2175_3146 | 316 |
| 612 | 3300048924 | Ga0496121_0106507 | Ga0496121_0106507_597_1568 | 316 |
| 613 | 3300048925 | Ga0496122_0001630 | Ga0496122_0001630_17751_18722 | 316 |
| 614 | 3300048926 | Ga0496123_0001111 | Ga0496123_0001111_20074_21045 | 316 |
| 615 | 3300048928 | Ga0496125_0002883 | Ga0496125_0002883_9562_10533 | 316 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5b4e-assembly1.cif.gz_A-2 | sulfur transferase ttua in complex with iron sulfur cluster and atp derivative | 0.8374 | 30 | 265 |
| 5gha-assembly2.cif.gz_C | sulfur transferase ttua in complex with sulfur carrier ttub | 0.8289 | 30 | 261 |
| 5gha-assembly1.cif.gz_A | sulfur transferase ttua in complex with sulfur carrier ttub | 0.8263 | 30 | 268 |
| 5ztb-assembly2.cif.gz_A | structure of sulfurtransferase | 0.8232 | 30 | 269 |
| 5b4f-assembly1.cif.gz_A-2 | sulfur transferase ttua in complex with iron sulfur cluster | 0.819 | 30 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76055_2_264_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9457 | 25 | 277 | 3.40.50.620 |
| af_P76055_2_264_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9076 | 25 | 277 | 3.40.50.620 |
| af_Q9N4F1_687_954_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8855 | 29 | 263 | 3.40.50.620 |
| af_Q5AML2_30_291_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.862 | 31 | 266 | 3.40.50.620 |
| af_A0A1D6HL54_20_239_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8405 | 30 | 216 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8Q4V5-F1-model_v4 | deleted | 0.9606 | 25 | 271 |
|
| AF-A0A839ILN5-F1-model_v4 | tRNA-cytidine(32) 2-sulfurtransferase (EC 2.8.1.-) (Two-thiocytidine biosynthesis protein A) (tRNA 2-thiocytidine biosynthesis protein TtcA) | 0.9602 | 25 | 279 |
GO:0000049
GO:0000287 GO:0005524 GO:0005737 GO:0016783 GO:0034227 GO:0051539 |
| AF-A0A7H4N058-F1-model_v4 | tRNA-cytidine(32) 2-sulfurtransferase (EC 2.8.1.-) (Two-thiocytidine biosynthesis protein A) (tRNA 2-thiocytidine biosynthesis protein TtcA) | 0.9587 | 25 | 272 |
GO:0000049
GO:0000287 GO:0005524 GO:0005737 GO:0016783 GO:0034227 GO:0051539 |
| AF-A0A6L8BDZ5-F1-model_v4 | tRNA 2-thiocytidine(32) synthetase TtcA (EC 2.8.1.-) | 0.9577 | 29 | 265 |
GO:0000049
GO:0005524 GO:0005737 GO:0006400 GO:0016740 GO:0046872 GO:0051539 |
| AF-A0A2N2S6P7-F1-model_v4 | tRNA 2-thiocytidine(32) synthetase TtcA | 0.9565 | 29 | 247 |
GO:0000049
GO:0005524 GO:0005737 GO:0006400 GO:0016740 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar