F469423

General Info

Members Datasets Scaffolds Average Seq Length
615 332 573 311

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100019375|Ga0070693_1000193752
Length 373
Sequence VALGEGKPTSLTLYSGNTAGRSTHPTYNSESHKLAKPSIVRYSFQLARKIRTMRRSPTQSPFDLPSRMSFESMKELHERKDRLEFNKLQKRLRRLTGSAIVDYNMIEDGDKVMVCLSGGKDSYTMLDILMSLQKTAPITFELVAVNMDQKQPGFPEHILPAYLEQVGVPYHIIERDTYSIVKEVIPEGKTTCGLCSRLRRGTLYGFADEIGATKIALGHHRDDIIETLFLNMFFGGKLKAMPPKLLADDKRNIVIRPLSYCAEEDIAHFAELKGFPIIPCNLCGSQENLQRQVVKDMLQVWEQKYPGRTETIFSAIRNVQPSQLADLNLFNFVNLETNKGAAAEDLDTDACGITPLASRTDNAVQYVDVLDLH

Samples

Sample ID Description Type Environment
1 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
2 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
3 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221645 Massilia sp. Root351 Isolate Unclassified
8 2643221656 Pelomonas sp. Root405 Isolate Unclassified
9 2643221664 Massilia sp. Root418 Isolate Unclassified
10 2643221720 Lysobacter sp. Root916 Isolate Unclassified
11 2643221728 Lysobacter sp. Root983 Isolate Unclassified
12 2738541280 Massilia sp. GV090 Isolate Unclassified
13 2738541297 Duganella sp. GV083 Isolate Unclassified
14 2738541300 Massilia sp. GV016 Isolate Unclassified
15 2738541357 Duganella sp. GV053 Isolate Unclassified
16 2738543003 Duganella sp. GV066 Isolate Unclassified
17 2738543018 Massilia sp. GV045 Isolate Unclassified
18 2738543026 Duganella sp. GV089 Isolate Unclassified
19 2738543029 Duganella sp. GV039 Isolate Unclassified
20 2738543030 Massilia sp. GV097 Isolate Unclassified
21 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
22 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
23 2821131069 Duganella sp. 1224 Isolate Unclassified
24 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
25 2857558681 Duganella sp. R-74565 Isolate Unclassified
26 2857564685 Duganella sp. R-74599 Isolate Unclassified
27 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
28 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
29 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
30 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
31 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
32 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
33 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
34 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
35 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
36 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
37 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
38 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
39 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
40 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
41 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
42 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
43 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
44 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
45 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
52 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
53 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
54 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
55 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
61 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
70 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
71 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
72 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
123 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
124 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
181 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
182 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
187 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
205 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
206 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
207 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
208 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
209 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
210 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
211 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
220 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
223 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
242 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
243 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
246 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
285 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
288 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
292 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
311 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
312 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
313 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
317 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
318 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
319 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
320 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
321 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
327 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
328 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
329 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
330 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
331 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
332 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.17
Metatranscriptomes 0
Isolates 6.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.41
Nodule 0.33
Rhizoplane 1.95
Rhizosphere 76.75
Stem 0
Stem Tuber 0
Unclassified 10.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000030 3300002704 Bacteria 114492
2 JGI25156J39149_1000162 3300002705 Bacteria 49240
3 JGI25162J39368_1004105 3300002737 Bacteria 3605
4 JGI25154J39366_1000056 3300002738 Bacteria 114494
5 JGI25154J39366_1001554 3300002738 Bacteria 7954
6 JGI25157J39369_1000498 3300002741 Bacteria 24228
7 JGI25159J45721_1010443 3300002987 Bacteria 2362
8 JGI25153J46596_10004468 3300003215 Bacteria 7539
9 rootH2_10070928 3300003320 Bacteria 6285
10 rootH1_10012258 3300003323 Bacteria 148276
11 rootH1_10115272 3300003323 Bacteria 9279
12 JGI25160J50197_1014774 3300003354 Bacteria 2595
13 JGI25161J50226_1000863 3300003374 Bacteria 11197
14 Ga0055532_1000059 3300003758 Bacteria 152948
15 Ga0055532_1000359 3300003758 Bacteria 24174
16 Ga0055525_1000031 3300003759 Bacteria 314909
17 Ga0055525_1000236 3300003759 Bacteria 57698
18 Ga0055525_1000243 3300003759 Bacteria 55208
19 Ga0055527_1000070 3300003760 Bacteria 85704
20 Ga0055535_1000117 3300003761 Bacteria 85705
21 Ga0055535_1014228 3300003761 Bacteria 1150
22 Ga0055542_1000156 3300003762 Bacteria 85704
23 Ga0055529_1000353 3300003763 Bacteria 50427
24 Ga0055526_1000030 3300003771 Bacteria 143833
25 Ga0055526_1007526 3300003771 Bacteria 5635
26 Ga0055524_1005727 3300003775 Bacteria 5503
27 Ga0055524_1015863 3300003775 Bacteria 2728
28 Ga0055524_1031271 3300003775 Bacteria 1534
29 Ga0055534_1003949 3300003784 Bacteria 4472
30 Ga0055534_1011314 3300003784 Bacteria 1821
31 Ga0055528_1015918 3300003790 Bacteria 2688
32 Ga0055528_1031448 3300003790 Bacteria 1381
33 Ga0055531_10000001 3300003794 Bacteria 543586
34 Ga0055531_10014922 3300003794 Bacteria 3465
35 Ga0065165_1000772 3300005262 Bacteria 43168
36 Ga0065714_10127593 3300005288 Bacteria 1280
37 Ga0065715_10022803 3300005293 Bacteria 1911
38 Ga0070676_10137126 3300005328 Bacteria 1553
39 Ga0070690_100016167 3300005330 Bacteria 4464
40 Ga0070670_100000001 3300005331 Bacteria 728788
41 Ga0070670_100021572 3300005331 Bacteria 5539
42 Ga0070670_100220619 3300005331 Bacteria 1649
43 Ga0070670_100430360 3300005331 Bacteria 1167
44 Ga0068869_100003613 3300005334 Bacteria 9492
45 Ga0070666_10000989 3300005335 Bacteria 17380
46 Ga0070666_10367400 3300005335 Bacteria 1031
47 Ga0070682_100155467 3300005337 Bacteria 1574
48 Ga0068868_100065307 3300005338 Bacteria 2891
49 Ga0070660_100160137 3300005339 Bacteria 1813
50 Ga0070687_100019808 3300005343 Bacteria 3137
51 Ga0070668_100000210 3300005347 Bacteria 38311
52 Ga0070669_100012030 3300005353 Bacteria 6140
53 Ga0070675_100043763 3300005354 Bacteria 3660
54 Ga0070674_100001560 3300005356 Bacteria 12278
55 Ga0070667_100000294 3300005367 Bacteria 56218
56 Ga0070667_100000331 3300005367 Bacteria 52620
57 Ga0070662_100001733 3300005457 Bacteria 13422
58 Ga0070662_100297798 3300005457 Bacteria 1310
59 Ga0068867_100001702 3300005459 Bacteria 15330
60 Ga0070685_10000049 3300005466 Bacteria 72567
61 Ga0068853_100140174 3300005539 Bacteria 2170
62 Ga0070672_100000286 3300005543 Bacteria 28584
63 Ga0070672_100041120 3300005543 Bacteria 3552
64 Ga0070693_100019375 3300005547 Bacteria 3565
65 Ga0070665_100005658 3300005548 Bacteria 12848
66 Ga0068855_100145221 3300005563 Bacteria 2701
67 Ga0070664_100058792 3300005564 Bacteria 3270
68 Ga0070664_100076556 3300005564 Bacteria 2875
69 Ga0070664_100145962 3300005564 Bacteria 2086
70 Ga0068854_100000287 3300005578 Bacteria 33813
71 Ga0068852_100055576 3300005616 Bacteria 3417
72 Ga0068852_100163918 3300005616 Bacteria 2078
73 Ga0068859_100008427 3300005617 Bacteria 10441
74 Ga0068859_100042640 3300005617 Bacteria 4558
75 Ga0068864_100000012 3300005618 Bacteria 335070
76 Ga0068864_100061979 3300005618 Bacteria 3239
77 Ga0068861_100002282 3300005719 Bacteria 12446
78 Ga0068863_100000638 3300005841 Bacteria 35489
79 Ga0068863_100579341 3300005841 Bacteria 1110
80 Ga0068858_100000623 3300005842 Bacteria 36873
81 Ga0068860_100000600 3300005843 Bacteria 43032
82 Ga0068860_100001020 3300005843 Bacteria 30989
83 Ga0068860_100315844 3300005843 Bacteria 1533
84 Ga0068862_100013761 3300005844 Bacteria 6705
85 Ga0068862_100413696 3300005844 Bacteria 1264
86 Ga0075432_10063753 3300006058 Bacteria 1316
87 Ga0097621_100094490 3300006237 Bacteria 2507
88 Ga0068865_100003535 3300006881 Bacteria 9372
89 Ga0097620_100008426 3300006931 Bacteria 10441
90 Ga0097620_100042638 3300006931 Bacteria 4558
91 Ga0105251_10037296 3300009011 Bacteria 2386
92 Ga0105244_10001189 3300009036 Bacteria 21505
93 Ga0105250_10000004 3300009092 Bacteria 438653
94 Ga0105240_10000344 3300009093 Bacteria 87083
95 Ga0105245_10004988 3300009098 Bacteria 11668
96 Ga0105243_10010278 3300009148 Bacteria 7113
97 Ga0105243_10197363 3300009148 Bacteria 1762
98 Ga0105248_10006169 3300009177 Bacteria 13140
99 Ga0105248_10146359 3300009177 Bacteria 2666
100 Ga0105238_10030435 3300009551 Bacteria 5495
101 Ga0157373_10067347 3300013100 Bacteria 2532
102 Ga0157370_10257097 3300013104 Bacteria 1614
103 Ga0163162_10000701 3300013306 Bacteria 30951
104 Ga0157372_10049628 3300013307 Bacteria 4667
105 Ga0157372_10176004 3300013307 Bacteria 2476
106 Ga0157375_10002767 3300013308 Bacteria 15170
107 Ga0157375_10026291 3300013308 Bacteria 5421
108 Ga0163163_10000162 3300014325 Bacteria 69827
109 Ga0157380_10000472 3300014326 Bacteria 24494
110 Ga0182008_10010622 3300014497 Bacteria 4925
111 Ga0182008_10026551 3300014497 Bacteria 2937
112 Ga0157379_10000208 3300014968 Bacteria 45395
113 Ga0157379_10001128 3300014968 Bacteria 21831
114 Ga0157379_10203142 3300014968 Bacteria 1792
115 Ga0182006_1000007 3300015261 Bacteria 452190
116 Ga0182007_10000470 3300015262 Bacteria 24392
117 Ga0163161_10023274 3300017792 Bacteria 4370
118 Ga0213872_10000091 3300021361 Bacteria 83723
119 Ga0213872_10000373 3300021361 Bacteria 37639
120 Ga0213872_10000561 3300021361 Bacteria 28726
121 Ga0213872_10039696 3300021361 Bacteria 2148
122 Ga0209435_100032 3300025206 Bacteria 153068
123 Ga0209147_100109 3300025229 Bacteria 153068
124 Ga0209563_100044 3300025230 Bacteria 396812
125 Ga0209437_100260 3300025233 Bacteria 82215
126 Ga0209437_112209 3300025233 Bacteria 1261
127 Ga0209258_100595 3300025242 Bacteria 29751
128 Ga0207425_1000009 3300025245 Bacteria 593135
129 Ga0207425_1000408 3300025245 Bacteria 28971
130 Ga0209646_1000113 3300025246 Bacteria 153068
131 Ga0209646_1000613 3300025246 Bacteria 13729
132 Ga0209026_1000102 3300025250 Bacteria 153068
133 Ga0209759_1000104 3300025256 Bacteria 153068
134 Ga0209129_1000061 3300025258 Bacteria 246061
135 Ga0209129_1008102 3300025258 Bacteria 2983
136 Ga0209565_1000684 3300025263 Bacteria 21085
137 Ga0209565_1000730 3300025263 Bacteria 19659
138 Ga0209455_1005597 3300025272 Bacteria 3852
139 Ga0209673_1026903 3300025273 Bacteria 1880
140 Ga0209675_1004599 3300025291 Bacteria 6075
141 Ga0209675_1007804 3300025291 Bacteria 4033
142 Ga0209564_1000010 3300025295 Bacteria 885399
143 Ga0209564_1005690 3300025295 Bacteria 6992
144 Ga0209564_1028784 3300025295 Bacteria 1765
145 Ga0209758_1000101 3300025297 Bacteria 225913
146 Ga0209050_1000805 3300025298 Bacteria 44138
147 Ga0209050_1022530 3300025298 Bacteria 2254
148 Ga0209256_1000910 3300025299 Bacteria 36259
149 Ga0209256_1001504 3300025299 Bacteria 23632
150 Ga0209256_1002911 3300025299 Bacteria 12900
151 Ga0207426_1002734 3300025302 Bacteria 10704
152 Ga0209051_1009294 3300025303 Bacteria 5080
153 Ga0209257_1000033 3300025304 Bacteria 671006
154 Ga0209257_1000556 3300025304 Bacteria 63959
155 Ga0209257_1001235 3300025304 Bacteria 31746
156 Ga0209257_1001266 3300025304 Bacteria 31042
157 Ga0207655_1002972 3300025728 Bacteria 13016
158 Ga0207688_10149732 3300025901 Bacteria 1378
159 Ga0207680_10001583 3300025903 Bacteria 10729
160 Ga0207680_10009956 3300025903 Bacteria 4738
161 Ga0207647_10000014 3300025904 Bacteria 143525
162 Ga0207645_10022783 3300025907 Bacteria 4072
163 Ga0207645_10031602 3300025907 Bacteria 3406
164 Ga0207705_10045627 3300025909 Bacteria 3149
165 Ga0207695_10012277 3300025913 Bacteria 10288
166 Ga0207695_10040526 3300025913 Bacteria 4991
167 Ga0207662_10035309 3300025918 Bacteria 2920
168 Ga0207657_10014527 3300025919 Bacteria 7678
169 Ga0207681_10004051 3300025923 Bacteria 9091
170 Ga0207681_10072070 3300025923 Bacteria 2411
171 Ga0207694_10013637 3300025924 Bacteria 6125
172 Ga0207650_10000002 3300025925 Bacteria 1439222
173 Ga0207650_10286988 3300025925 Bacteria 1341
174 Ga0207659_10030922 3300025926 Bacteria 3661
175 Ga0207659_10181085 3300025926 Bacteria 1669
176 Ga0207687_10025555 3300025927 Bacteria 3952
177 Ga0207644_10000065 3300025931 Bacteria 76549
178 Ga0207644_10000378 3300025931 Bacteria 29004
179 Ga0207706_10016222 3300025933 Bacteria 6731
180 Ga0207709_10121229 3300025935 Bacteria 1766
181 Ga0207669_10003679 3300025937 Bacteria 6663
182 Ga0207669_10010197 3300025937 Bacteria 4515
183 Ga0207691_10002401 3300025940 Bacteria 18333
184 Ga0207691_10045422 3300025940 Bacteria 4038
185 Ga0207711_10010530 3300025941 Bacteria 7684
186 Ga0207711_10214006 3300025941 Bacteria 1761
187 Ga0207689_10005498 3300025942 Bacteria 11332
188 Ga0207679_10118722 3300025945 Bacteria 2101
189 Ga0207667_10000432 3300025949 Bacteria 56395
190 Ga0207667_10219657 3300025949 Bacteria 1947
191 Ga0207640_10000208 3300025981 Bacteria 41443
192 Ga0207658_10000001 3300025986 Bacteria 1439333
193 Ga0207677_10042166 3300026023 Bacteria 3024
194 Ga0207703_10003715 3300026035 Bacteria 12703
195 Ga0207703_10541088 3300026035 Bacteria 1097
196 Ga0207639_10116028 3300026041 Bacteria 2191
197 Ga0207708_10026433 3300026075 Bacteria 4392
198 Ga0207641_10017145 3300026088 Bacteria 5924
199 Ga0207641_10017204 3300026088 Bacteria 5915
200 Ga0207648_10024782 3300026089 Bacteria 5352
201 Ga0207676_10000001 3300026095 Bacteria 1439222
202 Ga0207676_10003147 3300026095 Bacteria 11783
203 Ga0207676_10023903 3300026095 Bacteria 4516
204 Ga0207675_100016016 3300026118 Bacteria 6999
205 Ga0207698_10002844 3300026142 Bacteria 10350
206 Ga0207698_10021747 3300026142 Bacteria 4442
207 Ga0207698_10163203 3300026142 Bacteria 1952
208 Ga0268264_10000061 3300028381 Bacteria 303123
209 Ga0268264_10004393 3300028381 Bacteria 12027
210 Ga0268264_10308958 3300028381 Bacteria 1491
211 Ga0307515_10249686 3300028794 Bacteria 1529
212 Ga0316178_1016907 3300030735 Bacteria 2459
213 Ga0316180_1121954 3300030736 Bacteria 1189
214 Ga0265328_10008548 3300031239 Bacteria 4215
215 Ga0265331_10007271 3300031250 Bacteria 6421
216 Ga0265327_10000042 3300031251 Bacteria 287487
217 Ga0307408_100000037 3300031548 Bacteria 187096
218 Ga0307408_100032545 3300031548 Bacteria 3636
219 Ga0307408_100048855 3300031548 Bacteria 3036
220 Ga0265313_10001064 3300031595 Bacteria 26581
221 Ga0316575_10001369 3300031665 Bacteria 7832
222 Ga0265314_10068838 3300031711 Bacteria 2378
223 Ga0307405_10126359 3300031731 Bacteria 1759
224 Ga0307518_10067586 3300031838 Bacteria 2591
225 Ga0307416_100547308 3300032002 Bacteria 1230
226 Ga0307414_10032262 3300032004 Bacteria 3446
227 Ga0307414_10082205 3300032004 Bacteria 2361
228 Ga0307411_10002442 3300032005 Bacteria 8217
229 Ga0307411_10224467 3300032005 Bacteria 1460
230 Ga0307411_10423334 3300032005 Bacteria 1107
231 Ga0373927_0063641 3300035695 Bacteria 2386
232 Ga0316584_0064297 3300036712 Bacteria 2747
233 Ga0395900_0000239 3300037418 Bacteria 86321
234 Ga0395900_0194521 3300037418 Bacteria 2055
235 Ga0395905_0001707 3300037471 Bacteria 25805
236 Ga0395901_0134832 3300038443 Bacteria 2595
237 Ga0436361_0470837 3300039447 Bacteria 7008
238 Ga0436361_0580915 3300039447 Bacteria 36900
239 Ga0436361_0714431 3300039447 Bacteria 79592
240 Ga0436361_0784860 3300039447 Bacteria 8881
241 Ga0439466_0002133 3300041411 Bacteria 7751
242 Ga0451843_1208912 3300041509 Bacteria 2229
243 Ga0451853_1912378 3300041512 Bacteria 3478
244 Ga0439449_0005032 3300042007 Bacteria 5082
245 Ga0439451_002517 3300042009 Bacteria 3724
246 Ga0439454_015276 3300042011 Bacteria 1074
247 Ga0450890_001083 3300042127 Bacteria 3969
248 Ga0450891_000393 3300042129 Bacteria 4559
249 Ga0450892_000695 3300042130 Bacteria 3779
250 Ga0450904_000068 3300042139 Bacteria 23099
251 Ga0450889_000316 3300042144 Bacteria 5368
252 Ga0450893_0006564 3300042532 Bacteria 1882
253 Ga0466972_0003231 3300044658 Bacteria 8088
254 Ga0466965_0017161 3300044683 Bacteria 3456
255 Ga0466966_0028359 3300044684 Bacteria 3647
256 Ga0466968_0001184 3300044735 Bacteria 9230
257 Ga0466957_0030284 3300044842 Bacteria 3230
258 Ga0451576_0230832 3300045051 Bacteria 1933
259 Ga0466958_0090233 3300045836 Bacteria 1896
260 Ga0495617_000157 3300046452 Bacteria 43264
261 Ga0495617_001215 3300046452 Bacteria 11606
262 Ga0495627_029274 3300046453 Bacteria 1753
263 Ga0495603_0025604 3300046455 Bacteria 3568
264 Ga0495590_0000118 3300046457 Bacteria 47657
265 Ga0495590_0001148 3300046457 Bacteria 11581
266 Ga0495591_000214 3300046458 Bacteria 58417
267 Ga0495591_021977 3300046458 Bacteria 2070
268 Ga0495629_0040624 3300046459 Bacteria 3272
269 Ga0495629_0242586 3300046459 Bacteria 1240
270 Ga0495638_0000064 3300046460 Bacteria 180807
271 Ga0495638_0000408 3300046460 Bacteria 52490
272 Ga0495638_0013405 3300046460 Bacteria 5581
273 Ga0495653_0006181 3300046463 Bacteria 9824
274 Ga0495650_0000084 3300046471 Bacteria 235690
275 Ga0495650_0000257 3300046471 Bacteria 102881
276 Ga0495650_0000283 3300046471 Bacteria 96503
277 Ga0495580_0012124 3300046472 Bacteria 6631
278 Ga0495582_0005956 3300046473 Bacteria 6796
279 Ga0495605_0000125 3300046474 Bacteria 101414
280 Ga0495605_0000873 3300046474 Bacteria 20838
281 Ga0495605_0001968 3300046474 Bacteria 13017
282 Ga0495605_0020160 3300046474 Bacteria 3546
283 Ga0495584_0000482 3300046491 Bacteria 27407
284 Ga0495584_0000609 3300046491 Bacteria 23950
285 Ga0495584_0001576 3300046491 Bacteria 13473
286 Ga0495584_0001940 3300046491 Bacteria 11897
287 Ga0495584_0006265 3300046491 Bacteria 6240
288 Ga0495584_0012735 3300046491 Bacteria 4292
289 Ga0495584_0021745 3300046491 Bacteria 3257
290 Ga0495584_0091770 3300046491 Bacteria 1531
291 Ga0495585_0000352 3300046492 Bacteria 44459
292 Ga0495585_0000404 3300046492 Bacteria 41829
293 Ga0495585_0000524 3300046492 Bacteria 36254
294 Ga0495585_0001486 3300046492 Bacteria 18318
295 Ga0495585_0001735 3300046492 Bacteria 16596
296 Ga0495585_0041147 3300046492 Bacteria 2592
297 Ga0495585_0052286 3300046492 Bacteria 2261
298 Ga0495596_0001436 3300046500 Bacteria 13648
299 Ga0495596_0022085 3300046500 Bacteria 2592
300 Ga0495596_0030896 3300046500 Bacteria 2142
301 Ga0495607_0001141 3300046501 Bacteria 24051
302 Ga0495607_0038470 3300046501 Bacteria 2865
303 Ga0495607_0042076 3300046501 Bacteria 2710
304 Ga0495607_0064355 3300046501 Bacteria 2071
305 Ga0495583_0000137 3300046506 Bacteria 123815
306 Ga0495583_0000231 3300046506 Bacteria 93091
307 Ga0495583_0001074 3300046506 Bacteria 30538
308 Ga0495583_0001094 3300046506 Bacteria 29993
309 Ga0495606_0000400 3300046507 Bacteria 73341
310 Ga0495606_0000703 3300046507 Bacteria 51821
311 Ga0495606_0007181 3300046507 Bacteria 10052
312 Ga0495606_0027360 3300046507 Bacteria 4046
313 Ga0495606_0063243 3300046507 Bacteria 2359
314 Ga0495606_0223765 3300046507 Bacteria 1058
315 Ga0495610_0000027 3300046512 Bacteria 275273
316 Ga0495610_0001351 3300046512 Bacteria 21769
317 Ga0495610_0001490 3300046512 Bacteria 20605
318 Ga0495610_0006573 3300046512 Bacteria 7952
319 Ga0495610_0006638 3300046512 Bacteria 7897
320 Ga0495610_0049988 3300046512 Bacteria 2043
321 Ga0495616_0000072 3300046513 Bacteria 87767
322 Ga0495616_0000106 3300046513 Bacteria 72335
323 Ga0495616_0000324 3300046513 Bacteria 38102
324 Ga0495616_0002097 3300046513 Bacteria 13399
325 Ga0495616_0021450 3300046513 Bacteria 3498
326 Ga0495616_0024185 3300046513 Bacteria 3260
327 Ga0495616_0031076 3300046513 Bacteria 2800
328 Ga0495616_0055243 3300046513 Bacteria 1966
329 Ga0495616_0073418 3300046513 Bacteria 1650
330 Ga0495620_0000055 3300046515 Bacteria 99544
331 Ga0495620_0004824 3300046515 Bacteria 7580
332 Ga0495630_0249248 3300046517 Bacteria 1357
333 Ga0495631_0000349 3300046518 Bacteria 31928
334 Ga0495631_0000452 3300046518 Bacteria 27992
335 Ga0495631_0003687 3300046518 Bacteria 8354
336 Ga0495632_0000025 3300046519 Bacteria 176815
337 Ga0495632_0000342 3300046519 Bacteria 44311
338 Ga0495632_0000566 3300046519 Bacteria 34383
339 Ga0495632_0022704 3300046519 Bacteria 3359
340 Ga0495632_0059315 3300046519 Bacteria 1862
341 Ga0495637_0000003 3300046520 Bacteria 623293
342 Ga0495637_0000240 3300046520 Bacteria 42746
343 Ga0495643_0000471 3300046522 Bacteria 51325
344 Ga0495643_0000906 3300046522 Bacteria 31248
345 Ga0495643_0003125 3300046522 Bacteria 12363
346 Ga0495643_0019321 3300046522 Bacteria 3944
347 Ga0495643_0105764 3300046522 Bacteria 1436
348 Ga0495644_0000471 3300046523 Bacteria 17417
349 Ga0495644_0010246 3300046523 Bacteria 3611
350 Ga0495644_0045983 3300046523 Bacteria 1640
351 Ga0495648_0000134 3300046524 Bacteria 87750
352 Ga0495648_0004553 3300046524 Bacteria 11811
353 Ga0495648_0007917 3300046524 Bacteria 8431
354 Ga0495648_0010909 3300046524 Bacteria 6891
355 Ga0495648_0011923 3300046524 Bacteria 6520
356 Ga0495648_0012043 3300046524 Bacteria 6479
357 Ga0495648_0016240 3300046524 Bacteria 5371
358 Ga0495648_0020374 3300046524 Bacteria 4625
359 Ga0495648_0118645 3300046524 Bacteria 1426
360 Ga0495666_0003104 3300046526 Bacteria 8348
361 Ga0495642_0001010 3300046528 Bacteria 13058
362 Ga0495642_0001769 3300046528 Bacteria 9314
363 Ga0495642_0007579 3300046528 Bacteria 4158
364 Ga0495642_0026741 3300046528 Bacteria 2293
365 Ga0495642_0045659 3300046528 Bacteria 1790
366 Ga0495654_0000131 3300046530 Bacteria 80339
367 Ga0495654_0001328 3300046530 Bacteria 17257
368 Ga0495654_0013625 3300046530 Bacteria 4347
369 Ga0495654_0018546 3300046530 Bacteria 3644
370 Ga0495654_0068243 3300046530 Bacteria 1690
371 Ga0495665_0006428 3300046531 Bacteria 6344
372 Ga0495640_0126903 3300046533 Bacteria 1654
373 Ga0495586_0015424 3300046535 Bacteria 4065
374 Ga0495587_0025778 3300046536 Bacteria 3591
375 Ga0495587_0051136 3300046536 Bacteria 2443
376 Ga0495587_0093565 3300046536 Bacteria 1735
377 Ga0495609_0000412 3300046538 Bacteria 35828
378 Ga0495609_0000616 3300046538 Bacteria 27691
379 Ga0495609_0003721 3300046538 Bacteria 8614
380 Ga0495609_0004228 3300046538 Bacteria 7935
381 Ga0495609_0014613 3300046538 Bacteria 3687
382 Ga0495597_0000340 3300046542 Bacteria 41815
383 Ga0495597_0000415 3300046542 Bacteria 36751
384 Ga0495622_0013885 3300046557 Bacteria 3736
385 Ga0495622_0023471 3300046557 Bacteria 2876
386 Ga0495622_0043043 3300046557 Bacteria 2099
387 Ga0495622_0093385 3300046557 Bacteria 1381
388 Ga0495633_0000134 3300046558 Bacteria 98658
389 Ga0495633_0000535 3300046558 Bacteria 37893
390 Ga0495633_0000552 3300046558 Bacteria 36892
391 Ga0495633_0001267 3300046558 Bacteria 20125
392 Ga0495633_0004214 3300046558 Bacteria 9212
393 Ga0495633_0005435 3300046558 Bacteria 7782
394 Ga0495633_0011104 3300046558 Bacteria 4882
395 Ga0495633_0026584 3300046558 Bacteria 2838
396 Ga0495656_0002559 3300046615 Bacteria 6064
397 Ga0495656_0040510 3300046615 Bacteria 1942
398 Ga0495656_0053480 3300046615 Bacteria 1735
399 Ga0495656_0078422 3300046615 Bacteria 1484
400 Ga0495668_0001212 3300046616 Bacteria 26091
401 Ga0495668_0002631 3300046616 Bacteria 14437
402 Ga0495634_0001509 3300046642 Bacteria 20601
403 Ga0495611_0000370 3300046648 Bacteria 28963
404 Ga0495611_0001926 3300046648 Bacteria 9864
405 Ga0495611_0013636 3300046648 Bacteria 3462
406 Ga0495611_0017119 3300046648 Bacteria 3098
407 Ga0495611_0072063 3300046648 Bacteria 1580
408 Ga0495611_0104947 3300046648 Bacteria 1314
409 Ga0495625_0001523 3300046660 Bacteria 27723
410 Ga0495625_0002248 3300046660 Bacteria 21255
411 Ga0495625_0016339 3300046660 Bacteria 5844
412 Ga0495625_0024430 3300046660 Bacteria 4599
413 Ga0495625_0050583 3300046660 Bacteria 2981
414 Ga0495625_0051383 3300046660 Bacteria 2955
415 Ga0495625_0074471 3300046660 Bacteria 2378
416 Ga0495659_0000131 3300046664 Bacteria 32964
417 Ga0495659_0003174 3300046664 Bacteria 5272
418 Ga0495659_0004375 3300046664 Bacteria 4444
419 Ga0495659_0011325 3300046664 Bacteria 2873
420 Ga0495661_0002371 3300046665 Bacteria 14535
421 Ga0495661_0005799 3300046665 Bacteria 8730
422 Ga0495661_0022463 3300046665 Bacteria 4104
423 Ga0495661_0041137 3300046665 Bacteria 2861
424 Ga0495661_0047176 3300046665 Bacteria 2624
425 Ga0495588_0066309 3300046674 Bacteria 1873
426 Ga0495588_0113477 3300046674 Bacteria 1427
427 Ga0495646_0055444 3300046680 Bacteria 2380
428 Ga0495647_0018327 3300046681 Bacteria 2491
429 Ga0495669_0002501 3300046684 Bacteria 7502
430 Ga0495670_0001054 3300046691 Bacteria 13359
431 Ga0495670_0005293 3300046691 Bacteria 6348
432 Ga0495670_0017049 3300046691 Bacteria 3571
433 Ga0495671_0000106 3300046692 Bacteria 74947
434 Ga0495671_0000424 3300046692 Bacteria 33646
435 Ga0495671_0001030 3300046692 Bacteria 19398
436 Ga0495671_0002928 3300046692 Bacteria 10643
437 Ga0495671_0005258 3300046692 Bacteria 7601
438 Ga0495671_0016501 3300046692 Bacteria 3942
439 Ga0495671_0017036 3300046692 Bacteria 3871
440 Ga0495671_0026566 3300046692 Bacteria 3000
441 Ga0495649_0002046 3300046694 Bacteria 14554
442 Ga0495649_0023389 3300046694 Bacteria 3453
443 Ga0495649_0024212 3300046694 Bacteria 3386
444 Ga0495589_0000287 3300046794 Bacteria 40912
445 Ga0495589_0002781 3300046794 Bacteria 9683
446 Ga0495589_0004277 3300046794 Bacteria 7633
447 Ga0495589_0004564 3300046794 Bacteria 7358
448 Ga0495600_0021038 3300046809 Bacteria 4175
449 Ga0495660_0005163 3300046810 Bacteria 7848
450 Ga0495660_0007612 3300046810 Bacteria 6360
451 Ga0495660_0007977 3300046810 Bacteria 6219
452 Ga0495660_0036277 3300046810 Bacteria 2750
453 Ga0495660_0064503 3300046810 Bacteria 1957
454 Ga0495660_0084426 3300046810 Bacteria 1660
455 Ga0495581_0034695 3300047315 Bacteria 2918
456 Ga0495604_0019809 3300047317 Bacteria 5381
457 Ga0495636_0000144 3300047318 Bacteria 28781
458 Ga0495636_0010710 3300047318 Bacteria 3625
459 Ga0495636_0016357 3300047318 Bacteria 2962
460 Ga0495636_0032030 3300047318 Bacteria 2155
461 Ga0495636_0033363 3300047318 Bacteria 2114
462 Ga0495674_0028570 3300047319 Bacteria 5082
463 Ga0495672_0000088 3300047320 Bacteria 153860
464 Ga0495672_0000399 3300047320 Bacteria 52911
465 Ga0495672_0000678 3300047320 Bacteria 37915
466 Ga0495672_0000786 3300047320 Bacteria 34407
467 Ga0495672_0000973 3300047320 Bacteria 29705
468 Ga0495672_0126256 3300047320 Bacteria 1352
469 Ga0495676_0000097 3300047321 Bacteria 65781
470 Ga0495676_0069415 3300047321 Bacteria 2719
471 Ga0495676_0090820 3300047321 Bacteria 2284
472 Ga0495680_0022418 3300047322 Bacteria 5262
473 Ga0495683_0000336 3300047323 Bacteria 39214
474 Ga0495683_0001078 3300047323 Bacteria 18893
475 Ga0495683_0011104 3300047323 Bacteria 4748
476 Ga0495683_0011328 3300047323 Bacteria 4694
477 Ga0495683_0017527 3300047323 Bacteria 3711
478 Ga0495683_0077960 3300047323 Bacteria 1619
479 Ga0495687_000042 3300047443 Bacteria 218868
480 Ga0495687_000115 3300047443 Bacteria 122883
481 Ga0495687_000462 3300047443 Bacteria 49713
482 Ga0495687_000619 3300047443 Bacteria 41204
483 Ga0495687_010355 3300047443 Bacteria 5119
484 Ga0495677_0000454 3300047445 Bacteria 17476
485 Ga0495677_0000678 3300047445 Bacteria 13776
486 Ga0495679_003372 3300047446 Bacteria 7699
487 Ga0495679_006199 3300047446 Bacteria 5188
488 Ga0495679_009483 3300047446 Bacteria 3894
489 Ga0495685_001534 3300047447 Bacteria 7087
490 Ga0495685_001869 3300047447 Bacteria 6506
491 Ga0495673_0000008 3300047469 Bacteria 752462
492 Ga0495673_0000009 3300047469 Bacteria 731993
493 Ga0495673_0019469 3300047469 Bacteria 3399
494 Ga0495673_0035519 3300047469 Bacteria 2295
495 Ga0495681_0000256 3300047470 Bacteria 43302
496 Ga0495681_0013083 3300047470 Bacteria 4839
497 Ga0495681_0015958 3300047470 Bacteria 4235
498 Ga0495681_0036382 3300047470 Bacteria 2434
499 Ga0495686_0000728 3300047472 Bacteria 44006
500 Ga0495686_0010126 3300047472 Bacteria 6729
501 Ga0495686_0011743 3300047472 Bacteria 6166
502 Ga0495602_0014183 3300048088 Bacteria 8100
503 Ga0495614_0001960 3300048089 Bacteria 9051
504 Ga0495626_0000043 3300048091 Bacteria 168109
505 Ga0495626_0003172 3300048091 Bacteria 10710
506 Ga0495626_0005864 3300048091 Bacteria 7079
507 Ga0495626_0008641 3300048091 Bacteria 5565
508 Ga0495626_0013229 3300048091 Bacteria 4293
509 Ga0496101_0074104 3300048904 Bacteria 2503
510 Ga0496101_0165790 3300048904 Bacteria 1696
511 Ga0496102_0000611 3300048905 Bacteria 37080
512 Ga0496102_0015675 3300048905 Bacteria 6603
513 Ga0496105_0131174 3300048908 Bacteria 2066
514 Ga0496106_0017181 3300048909 Bacteria 5357
515 Ga0496107_0085649 3300048910 Bacteria 2299
516 Ga0496111_0008745 3300048914 Bacteria 6720
517 Ga0496113_0394832 3300048916 Bacteria 1110
518 Ga0496114_0007833 3300048917 Bacteria 8452
519 Ga0496115_0153307 3300048918 Bacteria 1903
520 Ga0496116_0039524 3300048919 Bacteria 3261
521 Ga0496116_0097294 3300048919 Bacteria 1770
522 Ga0496117_0000005 3300048920 Bacteria 777468
523 Ga0496118_0000022 3300048921 Bacteria 438602
524 Ga0496118_0017010 3300048921 Bacteria 6642
525 Ga0496121_0012789 3300048924 Bacteria 9088
526 Ga0496121_0066302 3300048924 Bacteria 2932
527 Ga0496121_0106507 3300048924 Bacteria 2149
528 Ga0496122_0000980 3300048925 Bacteria 51101
529 Ga0496122_0001491 3300048925 Bacteria 37476
530 Ga0496122_0001630 3300048925 Bacteria 35015
531 Ga0496122_0008792 3300048925 Bacteria 10791
532 Ga0496123_0001111 3300048926 Bacteria 40321
533 Ga0496123_0001968 3300048926 Bacteria 26656
534 Ga0496123_0004729 3300048926 Bacteria 14094
535 Ga0496123_0036210 3300048926 Bacteria 3503
536 Ga0496124_0034594 3300048927 Bacteria 4432
537 Ga0496124_0081134 3300048927 Bacteria 2667
538 Ga0496124_0088439 3300048927 Bacteria 2532
539 Ga0496125_0000313 3300048928 Bacteria 95423
540 Ga0496125_0002883 3300048928 Bacteria 21647
541 Ga0496125_0005645 3300048928 Bacteria 13815
542 Ga0495678_000202 3300049459 Bacteria 69911
543 Ga0495678_000403 3300049459 Bacteria 43653
544 Ga0495678_000622 3300049459 Bacteria 32958
545 Ga0495678_001894 3300049459 Bacteria 15198
546 Ga0495678_002745 3300049459 Bacteria 11549
547 Ga0495678_011469 3300049459 Bacteria 4241
548 Ga0495682_0000578 3300049460 Bacteria 24806
549 Ga0495682_0002545 3300049460 Bacteria 8584
550 Ga0495682_0002658 3300049460 Bacteria 8348
551 Ga0495682_0016364 3300049460 Bacteria 2807
552 Ga0501294_002960 3300049517 Bacteria 1602
553 Ga0501296_008442 3300049519 Bacteria 1194
554 Ga0501034_0117343 3300049571 Bacteria 2649
555 Ga0501047_0319391 3300049581 Bacteria 1393
556 Ga0501223_017808 3300049663 Bacteria 1401
557 Ga0501227_019583 3300049665 Bacteria 1544
558 Ga0501235_004034 3300049669 Bacteria 3177
559 Ga0501255_001590 3300049684 Bacteria 1862
560 Ga0501272_001324 3300049769 Bacteria 2330
561 Ga0501279_002615 3300049775 Bacteria 2352
562 Ga0501035_0001119 3300049822 Bacteria 28027
563 Ga0501035_0171468 3300049822 Bacteria 1874
564 Ga0501044_0020584 3300049823 Bacteria 7042
565 Ga0501044_0021815 3300049823 Bacteria 6830
566 nmdc:mga07m45_5560_c1 3300050496 Bacteria 3527
567 Ga0495601_0159498 3300053077 Bacteria 1474
568 Ga0500650_0000031 3300053098 Bacteria 54318
569 Ga0500594_0035164 3300053118 Bacteria 1342
570 Ga0500607_012081 3300053121 Bacteria 5084
571 Ga0500618_005611 3300053125 Bacteria 3787
572 Ga0500618_019432 3300053125 Bacteria 1673
573 Ga0500586_000093 3300053145 Bacteria 15423

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041509 Ga0451843_1208912 Ga0451843_1208912_1192_2124 270
2 3300005564 Ga0070664_100076556 Ga0070664_1000765563 276
3 3300031665 Ga0316575_10001369 Ga0316575_100013695 278
4 3300046615 Ga0495656_0078422 Ga0495656_0078422_529_1434 278
5 3300032005 Ga0307411_10423334 Ga0307411_104233341 279
6 iso_pu_bacteria 2643221581 2643914430 279
7 3300005331 Ga0070670_100430360 Ga0070670_1004303601 280
8 3300005339 Ga0070660_100160137 Ga0070660_1001601373 280
9 3300005844 Ga0068862_100413696 Ga0068862_1004136961 280
10 3300013307 Ga0157372_10176004 Ga0157372_101760042 280
11 3300025919 Ga0207657_10014527 Ga0207657_100145277 280
12 3300025937 Ga0207669_10010197 Ga0207669_100101975 280
13 3300025940 Ga0207691_10002401 Ga0207691_1000240114 280
14 3300041512 Ga0451853_1912378 Ga0451853_1912378_434_1456 280
15 3300042007 Ga0439449_0005032 Ga0439449_0005032_2037_3011 280
16 3300046615 Ga0495656_0040510 Ga0495656_0040510_131_1036 280
17 3300003759 Ga0055525_1000236 Ga0055525_100023638 281
18 3300003760 Ga0055527_1000070 Ga0055527_100007048 281
19 3300003761 Ga0055535_1000117 Ga0055535_100011748 281
20 3300003762 Ga0055542_1000156 Ga0055542_100015639 281
21 3300003763 Ga0055529_1000353 Ga0055529_10003533 281
22 3300005578 Ga0068854_100000287 Ga0068854_10000028731 281
23 3300025904 Ga0207647_10000014 Ga0207647_1000001434 281
24 3300025913 Ga0207695_10040526 Ga0207695_100405263 281
25 3300025949 Ga0207667_10000432 Ga0207667_1000043235 281
26 3300025981 Ga0207640_10000208 Ga0207640_100002087 281
27 3300031731 Ga0307405_10126359 Ga0307405_101263592 281
28 3300046664 Ga0495659_0011325 Ga0495659_0011325_866_1807 281
29 3300047318 Ga0495636_0033363 Ga0495636_0033363_606_1547 281
30 iso_pu_bacteria 2643221573 2643880079 281
31 iso_pu_bacteria 2643221720 2644662369 281
32 iso_pu_bacteria 2643221728 2644698739 281
33 iso_pu_bacteria 2895498888 2895502110 281
34 iso_pu_bacteria 2895511927 2895518037 281
35 iso_pu_bacteria 2895522137 2895523428 281
36 iso_pu_bacteria 2895525241 2895526340 281
37 3300005353 Ga0070669_100012030 Ga0070669_1000120303 282
38 3300005548 Ga0070665_100005658 Ga0070665_1000056589 282
39 3300005617 Ga0068859_100008427 Ga0068859_1000084279 282
40 3300005844 Ga0068862_100013761 Ga0068862_1000137613 282
41 3300006931 Ga0097620_100008426 Ga0097620_1000084263 282
42 3300031548 Ga0307408_100048855 Ga0307408_1000488553 282
43 3300046460 Ga0495638_0013405 Ga0495638_0013405_4369_5289 282
44 3300049581 Ga0501047_0319391 Ga0501047_0319391_470_1381 282
45 3300049822 Ga0501035_0171468 Ga0501035_0171468_522_1433 282
46 3300049823 Ga0501044_0020584 Ga0501044_0020584_645_1556 282
47 3300005331 Ga0070670_100000001 Ga0070670_100000001641 283
48 3300005335 Ga0070666_10367400 Ga0070666_103674001 283
49 3300005367 Ga0070667_100000331 Ga0070667_10000033137 283
50 3300005618 Ga0068864_100000012 Ga0068864_100000012283 283
51 3300014325 Ga0163163_10000162 Ga0163163_1000016239 283
52 3300025903 Ga0207680_10009956 Ga0207680_100099565 283
53 3300025925 Ga0207650_10000002 Ga0207650_100000021316 283
54 3300025986 Ga0207658_10000001 Ga0207658_1000000139 283
55 3300026088 Ga0207641_10017145 Ga0207641_100171455 283
56 3300026095 Ga0207676_10000001 Ga0207676_100000011316 283
57 3300032004 Ga0307414_10032262 Ga0307414_100322623 283
58 3300049822 Ga0501035_0001119 Ga0501035_0001119_12956_13870 283
59 3300049823 Ga0501044_0021815 Ga0501044_0021815_2572_3486 283
60 3300003775 Ga0055524_1031271 Ga0055524_10312712 284
61 3300003784 Ga0055534_1011314 Ga0055534_10113142 284
62 3300003790 Ga0055528_1031448 Ga0055528_10314482 284
63 3300003794 Ga0055531_10014922 Ga0055531_100149222 284
64 3300013104 Ga0157370_10257097 Ga0157370_102570972 284
65 3300014497 Ga0182008_10010622 Ga0182008_100106222 284
66 3300025273 Ga0209673_1026903 Ga0209673_10269032 284
67 3300025291 Ga0209675_1007804 Ga0209675_10078042 284
68 3300025299 Ga0209256_1000910 Ga0209256_10009102 284
69 3300025304 Ga0209257_1001235 Ga0209257_100123530 284
70 3300030735 Ga0316178_1016907 Ga0316178_10169073 284
71 3300030736 Ga0316180_1121954 Ga0316180_11219541 284
72 3300032002 Ga0307416_100547308 Ga0307416_1005473082 284
73 3300046453 Ga0495627_029274 Ga0495627_029274_25_948 284
74 3300046458 Ga0495591_021977 Ga0495591_021977_806_1729 284
75 3300046474 Ga0495605_0000125 Ga0495605_0000125_87959_88882 284
76 3300046512 Ga0495610_0006573 Ga0495610_0006573_6394_7317 284
77 3300046515 Ga0495620_0000055 Ga0495620_0000055_12384_13307 284
78 3300046530 Ga0495654_0001328 Ga0495654_0001328_15858_16781 284
79 3300046538 Ga0495609_0000412 Ga0495609_0000412_22392_23315 284
80 3300046558 Ga0495633_0000134 Ga0495633_0000134_86352_87275 284
81 3300046692 Ga0495671_0002928 Ga0495671_0002928_7176_8099 284
82 3300046794 Ga0495589_0004564 Ga0495589_0004564_4320_5243 284
83 3300046810 Ga0495660_0036277 Ga0495660_0036277_1460_2383 284
84 3300047446 Ga0495679_003372 Ga0495679_003372_2425_3348 284
85 3300047469 Ga0495673_0035519 Ga0495673_0035519_504_1427 284
86 3300047470 Ga0495681_0013083 Ga0495681_0013083_1793_2716 284
87 3300048091 Ga0495626_0003172 Ga0495626_0003172_3487_4437 284
88 3300048926 Ga0496123_0036210 Ga0496123_0036210_1487_2410 284
89 3300025295 Ga0209564_1005690 Ga0209564_10056906 285
90 3300041411 Ga0439466_0002133 Ga0439466_0002133_1484_2413 285
91 3300042009 Ga0439451_002517 Ga0439451_002517_1392_2321 285
92 3300003320 rootH2_10070928 rootH2_100709283 286
93 3300003323 rootH1_10012258 rootH1_1001225880 286
94 3300003323 rootH1_10115272 rootH1_101152724 286
95 3300009092 Ga0105250_10000004 Ga0105250_10000004184 286
96 3300014968 Ga0157379_10000208 Ga0157379_1000020824 286
97 3300046517 Ga0495630_0249248 Ga0495630_0249248_321_1235 286
98 3300053098 Ga0500650_0000031 Ga0500650_0000031_35243_36166 286
99 3300003758 Ga0055532_1000359 Ga0055532_100035928 287
100 3300003759 Ga0055525_1000243 Ga0055525_100024328 287
101 3300005466 Ga0070685_10000049 Ga0070685_1000004910 287
102 3300005843 Ga0068860_100000600 Ga0068860_10000060019 287
103 3300013307 Ga0157372_10049628 Ga0157372_100496283 287
104 3300025909 Ga0207705_10045627 Ga0207705_100456272 287
105 3300026088 Ga0207641_10017204 Ga0207641_100172045 287
106 3300028381 Ga0268264_10000061 Ga0268264_1000006134 287
107 3300037418 Ga0395900_0000239 Ga0395900_0000239_13104_14021 287
108 3300031548 Ga0307408_100032545 Ga0307408_1000325452 288
109 3300031595 Ga0265313_10001064 Ga0265313_100010643 289
110 3300036712 Ga0316584_0064297 Ga0316584_0064297_282_1286 289
111 3300046615 Ga0495656_0053480 Ga0495656_0053480_129_1085 290
112 iso_pu_bacteria 8054357960 8054360133 291
113 iso_pu_bacteria 2881714928 2881715265 292
114 3300014968 Ga0157379_10203142 Ga0157379_102031421 294
115 3300025923 Ga0207681_10072070 Ga0207681_100720702 294
116 3300025931 Ga0207644_10000065 Ga0207644_1000006568 294
117 3300026035 Ga0207703_10541088 Ga0207703_105410881 294
118 3300048927 Ga0496124_0081134 Ga0496124_0081134_142_1107 294
119 3300005841 Ga0068863_100579341 Ga0068863_1005793412 296
120 3300005843 Ga0068860_100315844 Ga0068860_1003158442 296
121 3300006058 Ga0075432_10063753 Ga0075432_100637532 296
122 3300028381 Ga0268264_10308958 Ga0268264_103089582 296
123 3300049459 Ga0495678_000622 Ga0495678_000622_31444_32361 297
124 3300049460 Ga0495682_0000578 Ga0495682_0000578_10638_11555 297
125 3300021361 Ga0213872_10000091 Ga0213872_1000009187 298
126 3300037418 Ga0395900_0194521 Ga0395900_0194521_469_1371 298
127 3300038443 Ga0395901_0134832 Ga0395901_0134832_1254_2156 298
128 3300045051 Ga0451576_0230832 Ga0451576_0230832_241_1149 298
129 3300046513 Ga0495616_0000106 Ga0495616_0000106_6824_7726 298
130 3300046524 Ga0495648_0016240 Ga0495648_0016240_272_1174 298
131 3300046530 Ga0495654_0018546 Ga0495654_0018546_1562_2464 298
132 3300047320 Ga0495672_0000786 Ga0495672_0000786_22744_23649 298
133 3300047470 Ga0495681_0000256 Ga0495681_0000256_31923_32825 298
134 3300048908 Ga0496105_0131174 Ga0496105_0131174_424_1326 298
135 3300048910 Ga0496107_0085649 Ga0496107_0085649_704_1606 298
136 iso_pu_bacteria 2643221664 2644359366 298
137 iso_pu_bacteria 2738541280 2738738210 298
138 iso_pu_bacteria 2881927736 2881929172 298
139 3300002987 JGI25159J45721_1010443 JGI25159J45721_10104431 299
140 3300003215 JGI25153J46596_10004468 JGI25153J46596_100044686 299
141 3300003354 JGI25160J50197_1014774 JGI25160J50197_10147741 299
142 3300003374 JGI25161J50226_1000863 JGI25161J50226_10008634 299
143 3300003771 Ga0055526_1007526 Ga0055526_10075264 299
144 3300003775 Ga0055524_1005727 Ga0055524_10057275 299
145 3300003775 Ga0055524_1015863 Ga0055524_10158632 299
146 3300003784 Ga0055534_1003949 Ga0055534_10039495 299
147 3300003790 Ga0055528_1015918 Ga0055528_10159181 299
148 3300003794 Ga0055531_10000001 Ga0055531_1000000111 299
149 3300005337 Ga0070682_100155467 Ga0070682_1001554672 299
150 3300025245 Ga0207425_1000009 Ga0207425_1000009570 299
151 3300025245 Ga0207425_1000408 Ga0207425_10004089 299
152 3300025258 Ga0209129_1000061 Ga0209129_1000061216 299
153 3300025258 Ga0209129_1008102 Ga0209129_10081024 299
154 3300025263 Ga0209565_1000684 Ga0209565_10006846 299
155 3300025263 Ga0209565_1000730 Ga0209565_10007309 299
156 3300025291 Ga0209675_1004599 Ga0209675_10045995 299
157 3300025295 Ga0209564_1028784 Ga0209564_10287842 299
158 3300025297 Ga0209758_1000101 Ga0209758_100010114 299
159 3300025298 Ga0209050_1000805 Ga0209050_100080523 299
160 3300025298 Ga0209050_1022530 Ga0209050_10225303 299
161 3300025299 Ga0209256_1001504 Ga0209256_10015048 299
162 3300025299 Ga0209256_1002911 Ga0209256_10029114 299
163 3300025302 Ga0207426_1002734 Ga0207426_10027344 299
164 3300025303 Ga0209051_1009294 Ga0209051_10092942 299
165 3300025304 Ga0209257_1000033 Ga0209257_100003398 299
166 3300025304 Ga0209257_1000556 Ga0209257_100055610 299
167 3300025304 Ga0209257_1001266 Ga0209257_100126618 299
168 3300032004 Ga0307414_10082205 Ga0307414_100822051 299
169 3300032005 Ga0307411_10002442 Ga0307411_100024422 299
170 3300037471 Ga0395905_0001707 Ga0395905_0001707_4704_5633 299
171 3300046507 Ga0495606_0027360 Ga0495606_0027360_2152_3072 299
172 3300046513 Ga0495616_0002097 Ga0495616_0002097_2212_3162 299
173 3300046519 Ga0495632_0000566 Ga0495632_0000566_23102_24010 299
174 3300046538 Ga0495609_0003721 Ga0495609_0003721_62_1012 299
175 3300046660 Ga0495625_0024430 Ga0495625_0024430_2687_3604 299
176 3300046660 Ga0495625_0051383 Ga0495625_0051383_1250_2170 299
177 3300046691 Ga0495670_0017049 Ga0495670_0017049_1381_2331 299
178 3300046694 Ga0495649_0024212 Ga0495649_0024212_2416_3324 299
179 3300046810 Ga0495660_0064503 Ga0495660_0064503_395_1315 299
180 3300049459 Ga0495678_002745 Ga0495678_002745_10032_10940 299
181 3300049460 Ga0495682_0002545 Ga0495682_0002545_2543_3493 299
182 3300049517 Ga0501294_002960 Ga0501294_002960_476_1387 299
183 3300049519 Ga0501296_008442 Ga0501296_008442_81_992 299
184 3300049663 Ga0501223_017808 Ga0501223_017808_387_1298 299
185 3300049665 Ga0501227_019583 Ga0501227_019583_475_1404 299
186 3300049669 Ga0501235_004034 Ga0501235_004034_567_1478 299
187 3300049684 Ga0501255_001590 Ga0501255_001590_71_982 299
188 3300049769 Ga0501272_001324 Ga0501272_001324_143_1054 299
189 3300049775 Ga0501279_002615 Ga0501279_002615_1031_1936 299
190 iso_pu_bacteria 2643221585 2643932823 299
191 iso_pu_bacteria 2643221645 2644254846 299
192 iso_pu_bacteria 2643221656 2644314073 299
193 iso_pu_bacteria 2738541300 2738842984 299
194 iso_pu_bacteria 2738543018 2739273732 299
195 iso_pu_bacteria 2738543030 2739342776 299
196 iso_pu_bacteria 2857558681 2857562097 299
197 iso_pu_bacteria 2857564685 2857567896 299
198 3300009148 Ga0105243_10197363 Ga0105243_101973632 300
199 3300025935 Ga0207709_10121229 Ga0207709_101212292 300
200 3300031548 Ga0307408_100000037 Ga0307408_10000003737 300
201 3300031838 Ga0307518_10067586 Ga0307518_100675864 300
202 3300046460 Ga0495638_0000408 Ga0495638_0000408_39478_40428 300
203 3300046474 Ga0495605_0000873 Ga0495605_0000873_19603_20553 300
204 3300046501 Ga0495607_0038470 Ga0495607_0038470_1386_2336 300
205 3300046506 Ga0495583_0000231 Ga0495583_0000231_9463_10413 300
206 3300046513 Ga0495616_0031076 Ga0495616_0031076_180_1130 300
207 3300046519 Ga0495632_0000342 Ga0495632_0000342_10298_11206 300
208 3300046523 Ga0495644_0000471 Ga0495644_0000471_16196_17146 300
209 3300046524 Ga0495648_0020374 Ga0495648_0020374_1439_2389 300
210 3300046528 Ga0495642_0045659 Ga0495642_0045659_319_1227 300
211 3300046538 Ga0495609_0000616 Ga0495609_0000616_7478_8428 300
212 3300046660 Ga0495625_0050583 Ga0495625_0050583_1429_2379 300
213 3300046664 Ga0495659_0003174 Ga0495659_0003174_1192_2142 300
214 3300046692 Ga0495671_0026566 Ga0495671_0026566_1493_2443 300
215 3300046810 Ga0495660_0007977 Ga0495660_0007977_5008_5919 300
216 3300047318 Ga0495636_0000144 Ga0495636_0000144_27401_28351 300
217 3300047320 Ga0495672_0126256 Ga0495672_0126256_287_1237 300
218 3300047321 Ga0495676_0069415 Ga0495676_0069415_1114_2019 300
219 3300047323 Ga0495683_0000336 Ga0495683_0000336_9679_10629 300
220 3300047323 Ga0495683_0077960 Ga0495683_0077960_671_1582 300
221 3300047443 Ga0495687_000042 Ga0495687_000042_9463_10413 300
222 3300047445 Ga0495677_0000678 Ga0495677_0000678_11313_12263 300
223 3300047447 Ga0495685_001534 Ga0495685_001534_5580_6530 300
224 3300047469 Ga0495673_0019469 Ga0495673_0019469_1659_2609 300
225 3300047470 Ga0495681_0015958 Ga0495681_0015958_583_1494 300
226 3300049459 Ga0495678_011469 Ga0495678_011469_116_1066 300
227 3300053121 Ga0500607_012081 Ga0500607_012081_111_1028 300
228 iso_pu_bacteria 2738541297 2738826673 300
229 iso_pu_bacteria 2738541357 2739150470 300
230 iso_pu_bacteria 2738543003 2739192389 300
231 iso_pu_bacteria 2738543026 2739318866 300
232 iso_pu_bacteria 2738543029 2739337107 300
233 iso_pu_bacteria 2821131069 2821135390 300
234 3300005547 Ga0070693_100019375 Ga0070693_1000193752 301
235 3300009036 Ga0105244_10001189 Ga0105244_1000118911 301
236 3300025728 Ga0207655_1002972 Ga0207655_10029726 301
237 3300042011 Ga0439454_015276 Ga0439454_015276_151_1062 301
238 3300046459 Ga0495629_0242586 Ga0495629_0242586_97_1008 301
239 3300046491 Ga0495584_0021745 Ga0495584_0021745_2044_2964 301
240 3300046491 Ga0495584_0091770 Ga0495584_0091770_355_1266 301
241 3300046513 Ga0495616_0073418 Ga0495616_0073418_374_1285 301
242 3300046520 Ga0495637_0000240 Ga0495637_0000240_5233_6144 301
243 3300046524 Ga0495648_0007917 Ga0495648_0007917_353_1303 301
244 3300046530 Ga0495654_0000131 Ga0495654_0000131_10105_11016 301
245 3300046557 Ga0495622_0013885 Ga0495622_0013885_2729_3640 301
246 3300046557 Ga0495622_0093385 Ga0495622_0093385_97_1008 301
247 3300046558 Ga0495633_0026584 Ga0495633_0026584_1897_2808 301
248 3300046648 Ga0495611_0017119 Ga0495611_0017119_812_1723 301
249 3300046674 Ga0495588_0066309 Ga0495588_0066309_345_1256 301
250 3300046684 Ga0495669_0002501 Ga0495669_0002501_378_1289 301
251 3300047315 Ga0495581_0034695 Ga0495581_0034695_170_1081 301
252 3300047321 Ga0495676_0000097 Ga0495676_0000097_11604_12515 301
253 3300047323 Ga0495683_0017527 Ga0495683_0017527_1606_2556 301
254 3300047443 Ga0495687_010355 Ga0495687_010355_222_1133 301
255 3300048088 Ga0495602_0014183 Ga0495602_0014183_3509_4447 301
256 3300048089 Ga0495614_0001960 Ga0495614_0001960_4118_5029 301
257 3300048091 Ga0495626_0005864 Ga0495626_0005864_3909_4820 301
258 3300048904 Ga0496101_0074104 Ga0496101_0074104_879_1790 301
259 3300048916 Ga0496113_0394832 Ga0496113_0394832_109_1020 301
260 3300048925 Ga0496122_0000980 Ga0496122_0000980_10693_11604 301
261 3300048926 Ga0496123_0004729 Ga0496123_0004729_11185_12096 301
262 3300048928 Ga0496125_0005645 Ga0496125_0005645_1892_2803 301
263 3300050496 nmdc:mga07m45_5560_c1 nmdc:mga07m45_5560_c1_2250_3182 301
264 iso_pu_bacteria 2808606418 2809145984 301
265 3300046457 Ga0495590_0000118 Ga0495590_0000118_10756_11670 302
266 3300046458 Ga0495591_000214 Ga0495591_000214_51845_52759 302
267 3300046459 Ga0495629_0040624 Ga0495629_0040624_28_942 302
268 3300046463 Ga0495653_0006181 Ga0495653_0006181_376_1314 302
269 3300046471 Ga0495650_0000084 Ga0495650_0000084_226830_227780 302
270 3300046472 Ga0495580_0012124 Ga0495580_0012124_3978_4916 302
271 3300046473 Ga0495582_0005956 Ga0495582_0005956_2122_3060 302
272 3300046474 Ga0495605_0020160 Ga0495605_0020160_719_1669 302
273 3300046491 Ga0495584_0000482 Ga0495584_0000482_17097_18041 302
274 3300046491 Ga0495584_0000609 Ga0495584_0000609_692_1606 302
275 3300046491 Ga0495584_0006265 Ga0495584_0006265_2110_3036 302
276 3300046500 Ga0495596_0001436 Ga0495596_0001436_6440_7390 302
277 3300046501 Ga0495607_0001141 Ga0495607_0001141_4918_5832 302
278 3300046501 Ga0495607_0042076 Ga0495607_0042076_560_1474 302
279 3300046506 Ga0495583_0001074 Ga0495583_0001074_19334_20248 302
280 3300046506 Ga0495583_0001094 Ga0495583_0001094_28051_28974 302
281 3300046507 Ga0495606_0000400 Ga0495606_0000400_9106_10026 302
282 3300046512 Ga0495610_0001351 Ga0495610_0001351_10150_11064 302
283 3300046512 Ga0495610_0006638 Ga0495610_0006638_4819_5736 302
284 3300046513 Ga0495616_0021450 Ga0495616_0021450_2390_3304 302
285 3300046518 Ga0495631_0000349 Ga0495631_0000349_5508_6422 302
286 3300046518 Ga0495631_0000452 Ga0495631_0000452_10706_11620 302
287 3300046519 Ga0495632_0000025 Ga0495632_0000025_10345_11262 302
288 3300046519 Ga0495632_0059315 Ga0495632_0059315_36_950 302
289 3300046520 Ga0495637_0000003 Ga0495637_0000003_611674_612588 302
290 3300046522 Ga0495643_0003125 Ga0495643_0003125_11277_12188 302
291 3300046522 Ga0495643_0019321 Ga0495643_0019321_360_1274 302
292 3300046523 Ga0495644_0045983 Ga0495644_0045983_36_950 302
293 3300046526 Ga0495666_0003104 Ga0495666_0003104_5916_6854 302
294 3300046530 Ga0495654_0013625 Ga0495654_0013625_1864_2778 302
295 3300046530 Ga0495654_0068243 Ga0495654_0068243_252_1175 302
296 3300046531 Ga0495665_0006428 Ga0495665_0006428_3038_3976 302
297 3300046533 Ga0495640_0126903 Ga0495640_0126903_449_1387 302
298 3300046536 Ga0495587_0051136 Ga0495587_0051136_343_1281 302
299 3300046538 Ga0495609_0014613 Ga0495609_0014613_383_1297 302
300 3300046542 Ga0495597_0000340 Ga0495597_0000340_4570_5484 302
301 3300046542 Ga0495597_0000415 Ga0495597_0000415_25415_26329 302
302 3300046558 Ga0495633_0001267 Ga0495633_0001267_13202_14116 302
303 3300046616 Ga0495668_0001212 Ga0495668_0001212_4411_5325 302
304 3300046642 Ga0495634_0001509 Ga0495634_0001509_1892_2830 302
305 3300046648 Ga0495611_0000370 Ga0495611_0000370_18373_19287 302
306 3300046660 Ga0495625_0016339 Ga0495625_0016339_111_1025 302
307 3300046664 Ga0495659_0000131 Ga0495659_0000131_10729_11646 302
308 3300046665 Ga0495661_0005799 Ga0495661_0005799_7391_8305 302
309 3300046692 Ga0495671_0000424 Ga0495671_0000424_11376_12293 302
310 3300046692 Ga0495671_0016501 Ga0495671_0016501_648_1565 302
311 3300046692 Ga0495671_0017036 Ga0495671_0017036_2677_3591 302
312 3300046694 Ga0495649_0002046 Ga0495649_0002046_3365_4279 302
313 3300046794 Ga0495589_0000287 Ga0495589_0000287_29728_30642 302
314 3300046794 Ga0495589_0002781 Ga0495589_0002781_260_1174 302
315 3300046794 Ga0495589_0004277 Ga0495589_0004277_737_1687 302
316 3300046809 Ga0495600_0021038 Ga0495600_0021038_2234_3172 302
317 3300046810 Ga0495660_0084426 Ga0495660_0084426_554_1468 302
318 3300047317 Ga0495604_0019809 Ga0495604_0019809_2205_3143 302
319 3300047319 Ga0495674_0028570 Ga0495674_0028570_2930_3844 302
320 3300047320 Ga0495672_0000678 Ga0495672_0000678_7759_8709 302
321 3300047320 Ga0495672_0000973 Ga0495672_0000973_18115_19032 302
322 3300047321 Ga0495676_0090820 Ga0495676_0090820_1004_1915 302
323 3300047443 Ga0495687_000462 Ga0495687_000462_48374_49288 302
324 3300047445 Ga0495677_0000454 Ga0495677_0000454_16377_17291 302
325 3300047446 Ga0495679_006199 Ga0495679_006199_1373_2287 302
326 3300047446 Ga0495679_009483 Ga0495679_009483_546_1460 302
327 3300047447 Ga0495685_001869 Ga0495685_001869_2110_3024 302
328 3300047470 Ga0495681_0036382 Ga0495681_0036382_1177_2091 302
329 3300048918 Ga0496115_0153307 Ga0496115_0153307_515_1426 302
330 3300049459 Ga0495678_000202 Ga0495678_000202_10295_11209 302
331 3300002738 JGI25154J39366_1001554 JGI25154J39366_10015546 303
332 3300005262 Ga0065165_1000772 Ga0065165_100077211 303
333 3300021361 Ga0213872_10000373 Ga0213872_1000037314 303
334 3300025233 Ga0209437_112209 Ga0209437_1122091 303
335 3300025246 Ga0209646_1000613 Ga0209646_10006133 303
336 3300028794 Ga0307515_10249686 Ga0307515_102496862 303
337 3300039447 Ga0436361_0580915 Ga0436361_0580915_20027_20956 303
338 3300042139 Ga0450904_000068 Ga0450904_000068_6135_7061 303
339 3300046455 Ga0495603_0025604 Ga0495603_0025604_894_1823 303
340 3300046460 Ga0495638_0000064 Ga0495638_0000064_166485_167423 303
341 3300046471 Ga0495650_0000257 Ga0495650_0000257_13642_14559 303
342 3300046474 Ga0495605_0001968 Ga0495605_0001968_1555_2472 303
343 3300046491 Ga0495584_0001576 Ga0495584_0001576_2287_3204 303
344 3300046492 Ga0495585_0000404 Ga0495585_0000404_18247_19176 303
345 3300046492 Ga0495585_0001486 Ga0495585_0001486_16983_17897 303
346 3300046492 Ga0495585_0001735 Ga0495585_0001735_4740_5654 303
347 3300046492 Ga0495585_0052286 Ga0495585_0052286_893_1810 303
348 3300046500 Ga0495596_0022085 Ga0495596_0022085_887_1804 303
349 3300046507 Ga0495606_0007181 Ga0495606_0007181_219_1139 303
350 3300046512 Ga0495610_0000027 Ga0495610_0000027_264460_265380 303
351 3300046512 Ga0495610_0049988 Ga0495610_0049988_782_1702 303
352 3300046513 Ga0495616_0000072 Ga0495616_0000072_11394_12323 303
353 3300046513 Ga0495616_0024185 Ga0495616_0024185_452_1369 303
354 3300046515 Ga0495620_0004824 Ga0495620_0004824_6427_7356 303
355 3300046519 Ga0495632_0022704 Ga0495632_0022704_622_1539 303
356 3300046522 Ga0495643_0000906 Ga0495643_0000906_1255_2181 303
357 3300046523 Ga0495644_0010246 Ga0495644_0010246_2268_3185 303
358 3300046528 Ga0495642_0001769 Ga0495642_0001769_7952_8881 303
359 3300046528 Ga0495642_0026741 Ga0495642_0026741_577_1494 303
360 3300046535 Ga0495586_0015424 Ga0495586_0015424_969_1883 303
361 3300046538 Ga0495609_0004228 Ga0495609_0004228_5774_6691 303
362 3300046557 Ga0495622_0023471 Ga0495622_0023471_1611_2525 303
363 3300046558 Ga0495633_0000535 Ga0495633_0000535_10940_11857 303
364 3300046558 Ga0495633_0011104 Ga0495633_0011104_807_1727 303
365 3300046615 Ga0495656_0002559 Ga0495656_0002559_3008_3925 303
366 3300046648 Ga0495611_0013636 Ga0495611_0013636_1813_2745 303
367 3300046648 Ga0495611_0072063 Ga0495611_0072063_437_1354 303
368 3300046665 Ga0495661_0041137 Ga0495661_0041137_646_1563 303
369 3300046674 Ga0495588_0113477 Ga0495588_0113477_142_1071 303
370 3300046692 Ga0495671_0000106 Ga0495671_0000106_73669_74589 303
371 3300046692 Ga0495671_0005258 Ga0495671_0005258_284_1234 303
372 3300046810 Ga0495660_0007612 Ga0495660_0007612_5217_6134 303
373 3300047323 Ga0495683_0001078 Ga0495683_0001078_16354_17268 303
374 3300047472 Ga0495686_0010126 Ga0495686_0010126_5384_6310 303
375 3300048091 Ga0495626_0013229 Ga0495626_0013229_382_1302 303
376 3300049460 Ga0495682_0016364 Ga0495682_0016364_395_1312 303
377 3300053125 Ga0500618_019432 Ga0500618_019432_445_1362 303
378 iso_pu_bacteria 8047673197 8047676193 303
379 3300005539 Ga0068853_100140174 Ga0068853_1001401742 304
380 3300021361 Ga0213872_10000561 Ga0213872_1000056124 304
381 3300026041 Ga0207639_10116028 Ga0207639_101160282 304
382 3300026142 Ga0207698_10021747 Ga0207698_100217473 304
383 3300031239 Ga0265328_10008548 Ga0265328_100085484 304
384 3300031250 Ga0265331_10007271 Ga0265331_100072718 304
385 3300031251 Ga0265327_10000042 Ga0265327_1000004296 304
386 3300031711 Ga0265314_10068838 Ga0265314_100688381 304
387 3300039447 Ga0436361_0470837 Ga0436361_0470837_4195_5142 304
388 3300044684 Ga0466966_0028359 Ga0466966_0028359_275_1195 304
389 3300045836 Ga0466958_0090233 Ga0466958_0090233_157_1077 304
390 3300046452 Ga0495617_000157 Ga0495617_000157_9797_10723 304
391 3300046452 Ga0495617_001215 Ga0495617_001215_7346_8263 304
392 3300046471 Ga0495650_0000283 Ga0495650_0000283_15311_16249 304
393 3300046492 Ga0495585_0000352 Ga0495585_0000352_9278_10204 304
394 3300046492 Ga0495585_0000524 Ga0495585_0000524_13887_14804 304
395 3300046492 Ga0495585_0041147 Ga0495585_0041147_1266_2186 304
396 3300046506 Ga0495583_0000137 Ga0495583_0000137_111590_112510 304
397 3300046507 Ga0495606_0000703 Ga0495606_0000703_7174_8112 304
398 3300046512 Ga0495610_0001490 Ga0495610_0001490_16872_17801 304
399 3300046513 Ga0495616_0000324 Ga0495616_0000324_26124_27041 304
400 3300046518 Ga0495631_0003687 Ga0495631_0003687_5348_6265 304
401 3300046522 Ga0495643_0000471 Ga0495643_0000471_10970_11899 304
402 3300046524 Ga0495648_0000134 Ga0495648_0000134_75908_76825 304
403 3300046524 Ga0495648_0004553 Ga0495648_0004553_1769_2698 304
404 3300046524 Ga0495648_0012043 Ga0495648_0012043_5186_6112 304
405 3300046528 Ga0495642_0007579 Ga0495642_0007579_3083_4009 304
406 3300046558 Ga0495633_0004214 Ga0495633_0004214_7661_8587 304
407 3300046616 Ga0495668_0002631 Ga0495668_0002631_6938_7858 304
408 3300046648 Ga0495611_0104947 Ga0495611_0104947_240_1157 304
409 3300046660 Ga0495625_0001523 Ga0495625_0001523_3040_3969 304
410 3300046660 Ga0495625_0074471 Ga0495625_0074471_1341_2270 304
411 3300046694 Ga0495649_0023389 Ga0495649_0023389_1416_2345 304
412 3300047320 Ga0495672_0000399 Ga0495672_0000399_10970_11899 304
413 3300047323 Ga0495683_0011104 Ga0495683_0011104_2792_3718 304
414 3300047323 Ga0495683_0011328 Ga0495683_0011328_677_1597 304
415 3300047443 Ga0495687_000115 Ga0495687_000115_11355_12281 304
416 3300047469 Ga0495673_0000008 Ga0495673_0000008_9544_10473 304
417 3300047469 Ga0495673_0000009 Ga0495673_0000009_9998_10924 304
418 3300047472 Ga0495686_0011743 Ga0495686_0011743_771_1697 304
419 3300048091 Ga0495626_0008641 Ga0495626_0008641_2207_3139 304
420 3300048924 Ga0496121_0066302 Ga0496121_0066302_215_1135 304
421 3300048927 Ga0496124_0088439 Ga0496124_0088439_1305_2225 304
422 3300049459 Ga0495678_000403 Ga0495678_000403_32022_32948 304
423 3300049459 Ga0495678_001894 Ga0495678_001894_8827_9747 304
424 3300053118 Ga0500594_0035164 Ga0500594_0035164_243_1163 304
425 3300053145 Ga0500586_000093 Ga0500586_000093_4751_5677 304
426 3300003759 Ga0055525_1000031 Ga0055525_100003119 305
427 3300003771 Ga0055526_1000030 Ga0055526_1000030123 305
428 3300025230 Ga0209563_100044 Ga0209563_10004488 305
429 3300025295 Ga0209564_1000010 Ga0209564_100001014 305
430 3300032005 Ga0307411_10224467 Ga0307411_102244672 305
431 3300039447 Ga0436361_0714431 Ga0436361_0714431_78413_79354 305
432 3300042127 Ga0450890_001083 Ga0450890_001083_2602_3609 305
433 3300042129 Ga0450891_000393 Ga0450891_000393_1132_2139 305
434 3300042130 Ga0450892_000695 Ga0450892_000695_1403_2410 305
435 3300042144 Ga0450889_000316 Ga0450889_000316_2551_3558 305
436 3300042532 Ga0450893_0006564 Ga0450893_0006564_278_1285 305
437 3300046491 Ga0495584_0001940 Ga0495584_0001940_10920_11843 305
438 3300046524 Ga0495648_0011923 Ga0495648_0011923_2909_3829 305
439 3300046558 Ga0495633_0005435 Ga0495633_0005435_6639_7583 305
440 3300046648 Ga0495611_0001926 Ga0495611_0001926_8279_9202 305
441 3300046665 Ga0495661_0047176 Ga0495661_0047176_289_1233 305
442 3300046691 Ga0495670_0001054 Ga0495670_0001054_10461_11405 305
443 3300046692 Ga0495671_0001030 Ga0495671_0001030_2110_3030 305
444 3300047318 Ga0495636_0016357 Ga0495636_0016357_1886_2809 305
445 3300048917 Ga0496114_0007833 Ga0496114_0007833_3566_4495 305
446 3300048928 Ga0496125_0000313 Ga0496125_0000313_82903_83832 305
447 iso_pu_bacteria 2643221544 2643743159 305
448 3300005564 Ga0070664_100058792 Ga0070664_1000587923 306
449 3300021361 Ga0213872_10039696 Ga0213872_100396961 306
450 3300039447 Ga0436361_0784860 Ga0436361_0784860_5292_6248 306
451 3300046491 Ga0495584_0012735 Ga0495584_0012735_2510_3439 306
452 3300046500 Ga0495596_0030896 Ga0495596_0030896_92_1021 306
453 3300046501 Ga0495607_0064355 Ga0495607_0064355_826_1749 306
454 3300046507 Ga0495606_0223765 Ga0495606_0223765_88_1017 306
455 3300046513 Ga0495616_0055243 Ga0495616_0055243_311_1255 306
456 3300046522 Ga0495643_0105764 Ga0495643_0105764_191_1114 306
457 3300046524 Ga0495648_0010909 Ga0495648_0010909_5019_5942 306
458 3300046528 Ga0495642_0001010 Ga0495642_0001010_9409_10332 306
459 3300046665 Ga0495661_0002371 Ga0495661_0002371_102_1025 306
460 3300047472 Ga0495686_0000728 Ga0495686_0000728_28328_29284 306
461 3300048905 Ga0496102_0000611 Ga0496102_0000611_22310_23233 306
462 3300049571 Ga0501034_0117343 Ga0501034_0117343_753_1676 306
463 iso_pu_bacteria 2857547612 2857548981 306
464 3300005293 Ga0065715_10022803 Ga0065715_100228032 307
465 3300005618 Ga0068864_100061979 Ga0068864_1000619793 307
466 3300006237 Ga0097621_100094490 Ga0097621_1000944903 307
467 3300009177 Ga0105248_10006169 Ga0105248_100061697 307
468 3300025931 Ga0207644_10000378 Ga0207644_100003789 307
469 3300025941 Ga0207711_10010530 Ga0207711_100105303 307
470 3300046524 Ga0495648_0118645 Ga0495648_0118645_71_1000 307
471 3300046664 Ga0495659_0004375 Ga0495659_0004375_2442_3371 307
472 3300046665 Ga0495661_0022463 Ga0495661_0022463_2803_3732 307
473 3300046681 Ga0495647_0018327 Ga0495647_0018327_1263_2258 307
474 3300046691 Ga0495670_0005293 Ga0495670_0005293_3176_4105 307
475 3300046810 Ga0495660_0005163 Ga0495660_0005163_280_1209 307
476 3300047318 Ga0495636_0010710 Ga0495636_0010710_2420_3346 307
477 3300047443 Ga0495687_000619 Ga0495687_000619_39950_40879 307
478 3300048904 Ga0496101_0165790 Ga0496101_0165790_682_1614 307
479 3300048905 Ga0496102_0015675 Ga0496102_0015675_284_1210 307
480 3300048909 Ga0496106_0017181 Ga0496106_0017181_4141_5070 307
481 3300048925 Ga0496122_0008792 Ga0496122_0008792_8673_9602 307
482 3300053077 Ga0495601_0159498 Ga0495601_0159498_240_1235 307
483 3300005288 Ga0065714_10127593 Ga0065714_101275931 308
484 3300005328 Ga0070676_10137126 Ga0070676_101371262 308
485 3300005330 Ga0070690_100016167 Ga0070690_1000161673 308
486 3300005331 Ga0070670_100220619 Ga0070670_1002206192 308
487 3300005334 Ga0068869_100003613 Ga0068869_1000036133 308
488 3300005335 Ga0070666_10000989 Ga0070666_1000098912 308
489 3300005338 Ga0068868_100065307 Ga0068868_1000653072 308
490 3300005343 Ga0070687_100019808 Ga0070687_1000198083 308
491 3300005347 Ga0070668_100000210 Ga0070668_1000002106 308
492 3300005354 Ga0070675_100043763 Ga0070675_1000437634 308
493 3300005356 Ga0070674_100001560 Ga0070674_1000015603 308
494 3300005367 Ga0070667_100000294 Ga0070667_1000002945 308
495 3300005457 Ga0070662_100001733 Ga0070662_1000017336 308
496 3300005457 Ga0070662_100297798 Ga0070662_1002977982 308
497 3300005459 Ga0068867_100001702 Ga0068867_1000017024 308
498 3300005543 Ga0070672_100000286 Ga0070672_1000002863 308
499 3300005543 Ga0070672_100041120 Ga0070672_1000411202 308
500 3300005564 Ga0070664_100145962 Ga0070664_1001459622 308
501 3300005616 Ga0068852_100055576 Ga0068852_1000555763 308
502 3300005617 Ga0068859_100042640 Ga0068859_1000426404 308
503 3300005719 Ga0068861_100002282 Ga0068861_1000022824 308
504 3300005841 Ga0068863_100000638 Ga0068863_1000006384 308
505 3300005842 Ga0068858_100000623 Ga0068858_10000062318 308
506 3300005843 Ga0068860_100001020 Ga0068860_10000102022 308
507 3300006881 Ga0068865_100003535 Ga0068865_1000035355 308
508 3300006931 Ga0097620_100042638 Ga0097620_1000426384 308
509 3300009098 Ga0105245_10004988 Ga0105245_100049884 308
510 3300009148 Ga0105243_10010278 Ga0105243_100102786 308
511 3300009177 Ga0105248_10146359 Ga0105248_101463593 308
512 3300013306 Ga0163162_10000701 Ga0163162_1000070121 308
513 3300013308 Ga0157375_10002767 Ga0157375_100027673 308
514 3300013308 Ga0157375_10026291 Ga0157375_100262914 308
515 3300014326 Ga0157380_10000472 Ga0157380_100004724 308
516 3300014968 Ga0157379_10001128 Ga0157379_100011288 308
517 3300017792 Ga0163161_10023274 Ga0163161_100232744 308
518 3300025901 Ga0207688_10149732 Ga0207688_101497322 308
519 3300025903 Ga0207680_10001583 Ga0207680_100015833 308
520 3300025907 Ga0207645_10022783 Ga0207645_100227834 308
521 3300025907 Ga0207645_10031602 Ga0207645_100316022 308
522 3300025918 Ga0207662_10035309 Ga0207662_100353092 308
523 3300025923 Ga0207681_10004051 Ga0207681_100040513 308
524 3300025925 Ga0207650_10286988 Ga0207650_102869882 308
525 3300025926 Ga0207659_10030922 Ga0207659_100309224 308
526 3300025926 Ga0207659_10181085 Ga0207659_101810852 308
527 3300025927 Ga0207687_10025555 Ga0207687_100255553 308
528 3300025933 Ga0207706_10016222 Ga0207706_100162226 308
529 3300025937 Ga0207669_10003679 Ga0207669_100036794 308
530 3300025940 Ga0207691_10045422 Ga0207691_100454222 308
531 3300025941 Ga0207711_10214006 Ga0207711_102140062 308
532 3300025942 Ga0207689_10005498 Ga0207689_100054988 308
533 3300025945 Ga0207679_10118722 Ga0207679_101187222 308
534 3300026023 Ga0207677_10042166 Ga0207677_100421663 308
535 3300026035 Ga0207703_10003715 Ga0207703_100037157 308
536 3300026075 Ga0207708_10026433 Ga0207708_100264334 308
537 3300026089 Ga0207648_10024782 Ga0207648_100247824 308
538 3300026095 Ga0207676_10003147 Ga0207676_1000314710 308
539 3300026095 Ga0207676_10023903 Ga0207676_100239034 308
540 3300026118 Ga0207675_100016016 Ga0207675_1000160163 308
541 3300026142 Ga0207698_10163203 Ga0207698_101632032 308
542 3300028381 Ga0268264_10004393 Ga0268264_100043933 308
543 3300035695 Ga0373927_0063641 Ga0373927_0063641_177_1178 308
544 3300044658 Ga0466972_0003231 Ga0466972_0003231_195_1130 308
545 3300044683 Ga0466965_0017161 Ga0466965_0017161_1735_2670 308
546 3300044735 Ga0466968_0001184 Ga0466968_0001184_8285_9220 308
547 3300044842 Ga0466957_0030284 Ga0466957_0030284_1497_2432 308
548 3300046558 Ga0495633_0000552 Ga0495633_0000552_27905_28858 308
549 iso_pu_bacteria 2600255292 2601671176 308
550 iso_pu_bacteria 2885080285 2885081155 308
551 3300047318 Ga0495636_0032030 Ga0495636_0032030_930_1865 309
552 iso_pu_bacteria 2932422444 2932423039 309
553 3300015261 Ga0182006_1000007 Ga0182006_100000711 310
554 3300015262 Ga0182007_10000470 Ga0182007_1000047011 310
555 3300046457 Ga0495590_0001148 Ga0495590_0001148_10516_11454 310
556 3300046507 Ga0495606_0063243 Ga0495606_0063243_69_1007 310
557 3300046536 Ga0495587_0025778 Ga0495587_0025778_2313_3251 310
558 3300046536 Ga0495587_0093565 Ga0495587_0093565_499_1437 310
559 3300046557 Ga0495622_0043043 Ga0495622_0043043_315_1286 310
560 3300046680 Ga0495646_0055444 Ga0495646_0055444_88_1026 310
561 3300047322 Ga0495680_0022418 Ga0495680_0022418_810_1748 310
562 3300048091 Ga0495626_0000043 Ga0495626_0000043_158907_159851 310
563 3300048914 Ga0496111_0008745 Ga0496111_0008745_1074_2045 310
564 3300048919 Ga0496116_0039524 Ga0496116_0039524_1163_2134 310
565 3300048920 Ga0496117_0000005 Ga0496117_0000005_419434_420405 310
566 3300048921 Ga0496118_0000022 Ga0496118_0000022_18198_19169 310
567 3300048924 Ga0496121_0012789 Ga0496121_0012789_5619_6590 310
568 3300048925 Ga0496122_0001491 Ga0496122_0001491_28591_29562 310
569 3300048926 Ga0496123_0001968 Ga0496123_0001968_7577_8548 310
570 3300048927 Ga0496124_0034594 Ga0496124_0034594_3397_4368 310
571 3300049460 Ga0495682_0002658 Ga0495682_0002658_5106_6077 310
572 iso_pu_bacteria 2932410948 2932415322 310
573 iso_pu_bacteria 2932416698 2932421517 310
574 3300047320 Ga0495672_0000088 Ga0495672_0000088_145744_146691 312
575 iso_pu_bacteria 2548876994 2550695871 312
576 iso_pu_bacteria 2818991445 2819594830 312
577 iso_pu_bacteria 2884811622 2884813817 312
578 iso_pu_bacteria 2884836552 2884838405 312
579 iso_pu_bacteria 2884852848 2884854697 312
580 iso_pu_bacteria 2896154374 2896156635 312
581 3300048919 Ga0496116_0097294 Ga0496116_0097294_236_1198 315
582 3300053125 Ga0500618_005611 Ga0500618_005611_1142_2179 315
583 3300002704 JGI25155J39150_1000030 JGI25155J39150_100003092 316
584 3300002705 JGI25156J39149_1000162 JGI25156J39149_100016236 316
585 3300002737 JGI25162J39368_1004105 JGI25162J39368_10041054 316
586 3300002738 JGI25154J39366_1000056 JGI25154J39366_100005692 316
587 3300002741 JGI25157J39369_1000498 JGI25157J39369_100049818 316
588 3300003758 Ga0055532_1000059 Ga0055532_1000059128 316
589 3300003761 Ga0055535_1014228 Ga0055535_10142281 316
590 3300005331 Ga0070670_100021572 Ga0070670_1000215726 316
591 3300005563 Ga0068855_100145221 Ga0068855_1001452212 316
592 3300005616 Ga0068852_100163918 Ga0068852_1001639182 316
593 3300009011 Ga0105251_10037296 Ga0105251_100372963 316
594 3300009093 Ga0105240_10000344 Ga0105240_1000034467 316
595 3300009551 Ga0105238_10030435 Ga0105238_100304355 316
596 3300013100 Ga0157373_10067347 Ga0157373_100673473 316
597 3300014497 Ga0182008_10026551 Ga0182008_100265511 316
598 3300025206 Ga0209435_100032 Ga0209435_10003217 316
599 3300025229 Ga0209147_100109 Ga0209147_10010917 316
600 3300025233 Ga0209437_100260 Ga0209437_10026018 316
601 3300025242 Ga0209258_100595 Ga0209258_10059520 316
602 3300025246 Ga0209646_1000113 Ga0209646_100011317 316
603 3300025250 Ga0209026_1000102 Ga0209026_100010217 316
604 3300025256 Ga0209759_1000104 Ga0209759_100010417 316
605 3300025272 Ga0209455_1005597 Ga0209455_10055974 316
606 3300025913 Ga0207695_10012277 Ga0207695_100122775 316
607 3300025924 Ga0207694_10013637 Ga0207694_100136373 316
608 3300025949 Ga0207667_10219657 Ga0207667_102196571 316
609 3300026142 Ga0207698_10002844 Ga0207698_100028449 316
610 3300046660 Ga0495625_0002248 Ga0495625_0002248_16990_17961 316
611 3300048921 Ga0496118_0017010 Ga0496118_0017010_2175_3146 316
612 3300048924 Ga0496121_0106507 Ga0496121_0106507_597_1568 316
613 3300048925 Ga0496122_0001630 Ga0496122_0001630_17751_18722 316
614 3300048926 Ga0496123_0001111 Ga0496123_0001111_20074_21045 316
615 3300048928 Ga0496125_0002883 Ga0496125_0002883_9562_10533 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01171

ATP_bind_3

PP-loop family

111

279

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b4e-assembly1.cif.gz_A-2 sulfur transferase ttua in complex with iron sulfur cluster and atp derivative 0.8374 30 265
5gha-assembly2.cif.gz_C sulfur transferase ttua in complex with sulfur carrier ttub 0.8289 30 261
5gha-assembly1.cif.gz_A sulfur transferase ttua in complex with sulfur carrier ttub 0.8263 30 268
5ztb-assembly2.cif.gz_A structure of sulfurtransferase 0.8232 30 269
5b4f-assembly1.cif.gz_A-2 sulfur transferase ttua in complex with iron sulfur cluster 0.819 30 261
ID Description Score Start End Superfamily
af_P76055_2_264_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9457 25 277 3.40.50.620
af_P76055_2_264_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9076 25 277 3.40.50.620
af_Q9N4F1_687_954_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8855 29 263 3.40.50.620
af_Q5AML2_30_291_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.862 31 266 3.40.50.620
af_A0A1D6HL54_20_239_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8405 30 216 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A6N8Q4V5-F1-model_v4 deleted 0.9606 25 271
AF-A0A839ILN5-F1-model_v4 tRNA-cytidine(32) 2-sulfurtransferase (EC 2.8.1.-) (Two-thiocytidine biosynthesis protein A) (tRNA 2-thiocytidine biosynthesis protein TtcA) 0.9602 25 279 GO:0000049
GO:0000287
GO:0005524
GO:0005737
GO:0016783
GO:0034227
GO:0051539
AF-A0A7H4N058-F1-model_v4 tRNA-cytidine(32) 2-sulfurtransferase (EC 2.8.1.-) (Two-thiocytidine biosynthesis protein A) (tRNA 2-thiocytidine biosynthesis protein TtcA) 0.9587 25 272 GO:0000049
GO:0000287
GO:0005524
GO:0005737
GO:0016783
GO:0034227
GO:0051539
AF-A0A6L8BDZ5-F1-model_v4 tRNA 2-thiocytidine(32) synthetase TtcA (EC 2.8.1.-) 0.9577 29 265 GO:0000049
GO:0005524
GO:0005737
GO:0006400
GO:0016740
GO:0046872
GO:0051539
AF-A0A2N2S6P7-F1-model_v4 tRNA 2-thiocytidine(32) synthetase TtcA 0.9565 29 247 GO:0000049
GO:0005524
GO:0005737
GO:0006400
GO:0016740
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
78.79 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map