F469397

General Info

Members Datasets Scaffolds Average Seq Length
614 299 1228 190

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_209081_c1|nmdc:mga0qj67_209081_c1_76_723
Length 215
Sequence VDARAKPAHDGGESDYHPSKQRRFIMLAQTKTAEPKVVNGINVDDLFALIEGVKRDPAKGQTSWRVATAWQGQTRSRTQVEGFEIGGEKVTRRFSIDIDEPCELGGSNRFANPQEHLLAALNACMMVGYVAQCAVHGIVLESLEIETDGEIDLRGFLGIDPAVPPGYEKLSTTVRIKGSATKEEFAKIHEAVMATSPNFYNVSQPVAVKPALVVE

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
241 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
242 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
243 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
244 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
261 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
262 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
276 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
280 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
283 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
284 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
285 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
286 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
291 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
292 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
293 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
294 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
295 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
296 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
297 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
298 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
299 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0.16
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.58
Nodule 1.63
Rhizoplane 10.59
Rhizosphere 81.27
Stem 0
Stem Tuber 0
Unclassified 6.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_209081_c1 3300050509 Bacteria 1585
2 Ga0070676_11085216 3300005328 Bacteria 604
3 Ga0070683_100534187 3300005329 Bacteria 1121
4 Ga0070670_100523330 3300005331 Bacteria 1056
5 Ga0068869_100294343 3300005334 Bacteria 1309
6 Ga0070680_100388050 3300005336 Bacteria 1189
7 Ga0070668_100050825 3300005347 Bacteria 3192
8 Ga0070669_100210711 3300005353 Bacteria 1533
9 Ga0070675_100053201 3300005354 Bacteria 3330
10 Ga0070671_100444055 3300005355 Bacteria 1112
11 Ga0070671_100697666 3300005355 Bacteria 880
12 Ga0070674_100230984 3300005356 Bacteria 1444
13 Ga0070688_100367791 3300005365 Bacteria 1057
14 Ga0070659_100403099 3300005366 Bacteria 1155
15 Ga0070709_10135622 3300005434 Bacteria 1685
16 Ga0070709_10766741 3300005434 Bacteria 755
17 Ga0070714_100237618 3300005435 Bacteria 1681
18 Ga0070714_100492911 3300005435 Bacteria 1168
19 Ga0070713_100100284 3300005436 Bacteria 2506
20 Ga0070713_100113973 3300005436 Bacteria 2361
21 Ga0070713_100308929 3300005436 Bacteria 1458
22 Ga0070711_100753408 3300005439 Bacteria 823
23 Ga0070694_100309195 3300005444 Bacteria 1213
24 Ga0070708_100009735 3300005445 Bacteria 7758
25 Ga0070663_100034828 3300005455 Bacteria 3489
26 Ga0070681_10007680 3300005458 Bacteria 10546
27 Ga0070681_10211650 3300005458 Bacteria 1855
28 Ga0068867_100041820 3300005459 Bacteria 3350
29 Ga0068867_100244408 3300005459 Bacteria 1457
30 Ga0070685_10501609 3300005466 Bacteria 859
31 Ga0070706_100061768 3300005467 Bacteria 3460
32 Ga0070707_100276512 3300005468 Bacteria 1632
33 Ga0070707_101246782 3300005468 Bacteria 710
34 Ga0070698_100041231 3300005471 Bacteria 4740
35 Ga0070698_100349809 3300005471 Bacteria 1409
36 Ga0070698_100842623 3300005471 Bacteria 862
37 Ga0070699_100036497 3300005518 Bacteria 4252
38 Ga0070699_100382363 3300005518 Bacteria 1271
39 Ga0070699_101135551 3300005518 Bacteria 717
40 Ga0070679_100016065 3300005530 Bacteria 7210
41 Ga0070684_100257896 3300005535 Bacteria 1594
42 Ga0070697_100042524 3300005536 Bacteria 3677
43 Ga0070697_100445136 3300005536 Bacteria 1128
44 Ga0070665_100217886 3300005548 Bacteria 1909
45 Ga0068855_100684531 3300005563 Bacteria 1099
46 Ga0070664_100813094 3300005564 Bacteria 874
47 Ga0068854_100436558 3300005578 Bacteria 1090
48 Ga0068854_101046244 3300005578 Bacteria 725
49 Ga0068856_100305774 3300005614 Bacteria 1608
50 Ga0070702_100022723 3300005615 Bacteria 3322
51 Ga0068852_100020506 3300005616 Bacteria 5258
52 Ga0068859_100103873 3300005617 Bacteria 2900
53 Ga0068859_100641803 3300005617 Unclassified 1154
54 Ga0068859_100663844 3300005617 Bacteria 1134
55 Ga0068864_100981169 3300005618 Bacteria 837
56 Ga0068861_100045490 3300005719 Bacteria 3305
57 Ga0068870_10129423 3300005840 Bacteria 1464
58 Ga0068858_100519347 3300005842 Bacteria 1151
59 Ga0068860_100082135 3300005843 Bacteria 3065
60 Ga0068860_100145550 3300005843 Bacteria 2280
61 Ga0068860_101391181 3300005843 Bacteria 723
62 Ga0081455_10021804 3300005937 Bacteria 6000
63 Ga0081455_10053760 3300005937 Bacteria 3439
64 Ga0081455_10057332 3300005937 Bacteria 3301
65 Ga0081540_1013246 3300005983 Bacteria 5373
66 Ga0070717_10001490 3300006028 Bacteria 16196
67 Ga0070717_10160725 3300006028 Bacteria 1948
68 Ga0070717_10445481 3300006028 Bacteria 1167
69 Ga0075365_10015729 3300006038 Bacteria 4582
70 Ga0075365_10144169 3300006038 Bacteria 1654
71 Ga0075365_10147544 3300006038 Bacteria 1635
72 Ga0075368_10178348 3300006042 Bacteria 895
73 Ga0070715_10247037 3300006163 Bacteria 931
74 Ga0070712_100019532 3300006175 Bacteria 4421
75 Ga0070712_100098494 3300006175 Bacteria 2157
76 Ga0070712_100100735 3300006175 Bacteria 2135
77 Ga0070712_100651281 3300006175 Bacteria 895
78 Ga0075367_10038765 3300006178 Bacteria 2775
79 Ga0075367_10166639 3300006178 Bacteria 1371
80 Ga0097621_100384015 3300006237 Bacteria 1255
81 Ga0075428_100003188 3300006844 Bacteria 17938
82 Ga0075428_100064505 3300006844 Bacteria 4011
83 Ga0075428_100804917 3300006844 Unclassified 999
84 Ga0075428_100808065 3300006844 Bacteria 997
85 Ga0075431_100993188 3300006847 Unclassified 806
86 Ga0075433_10274109 3300006852 Bacteria 1495
87 Ga0075434_100064867 3300006871 Bacteria 3637
88 Ga0075434_100885397 3300006871 Bacteria 908
89 Ga0068865_100047589 3300006881 Bacteria 2948
90 Ga0097620_100103875 3300006931 Bacteria 2900
91 Ga0097620_100641788 3300006931 Unclassified 1154
92 Ga0097620_100663768 3300006931 Bacteria 1134
93 Ga0099795_10009697 3300007788 Bacteria 2805
94 Ga0099795_10017480 3300007788 Bacteria 2287
95 Ga0099795_10230272 3300007788 Bacteria 792
96 Ga0099795_10274032 3300007788 Bacteria 735
97 Ga0105251_10165339 3300009011 Bacteria 997
98 Ga0105240_10048855 3300009093 Bacteria 5345
99 Ga0105240_10168532 3300009093 Bacteria 2596
100 Ga0105240_10702910 3300009093 Bacteria 1103
101 Ga0111539_10016828 3300009094 Bacteria 9056
102 Ga0111539_10047271 3300009094 Bacteria 5143
103 Ga0111539_11114516 3300009094 Bacteria 917
104 Ga0105245_10573473 3300009098 Bacteria 1152
105 Ga0105245_10608762 3300009098 Bacteria 1120
106 Ga0105247_10222729 3300009101 Bacteria 1277
107 Ga0114129_10020829 3300009147 Bacteria 9314
108 Ga0114129_10251686 3300009147 Bacteria 2371
109 Ga0114129_10285595 3300009147 Bacteria 2203
110 Ga0114129_11683490 3300009147 Unclassified 774
111 Ga0105243_10054395 3300009148 Bacteria 3178
112 Ga0105242_10066418 3300009176 Bacteria 2978
113 Ga0105242_10587821 3300009176 Bacteria 1073
114 Ga0105248_10788317 3300009177 Bacteria 1073
115 Ga0105237_10052255 3300009545 Bacteria 4103
116 Ga0105237_10174498 3300009545 Bacteria 2150
117 Ga0105237_10829811 3300009545 Bacteria 931
118 Ga0105238_10006074 3300009551 Bacteria 11978
119 Ga0105238_10346086 3300009551 Bacteria 1475
120 Ga0105249_10062684 3300009553 Bacteria 3414
121 Ga0105249_12375952 3300009553 Unclassified 603
122 Ga0099796_10001194 3300010159 Bacteria 5049
123 Ga0099796_10002395 3300010159 Bacteria 4103
124 Ga0099796_10049783 3300010159 Bacteria 1450
125 Ga0099796_10290816 3300010159 Unclassified 690
126 Ga0105239_10050276 3300010375 Bacteria 4573
127 Ga0105239_10051994 3300010375 Bacteria 4492
128 Ga0105239_10275502 3300010375 Bacteria 1893
129 Ga0105239_10466863 3300010375 Bacteria 1433
130 Ga0105246_10029834 3300011119 Bacteria 3596
131 Ga0105246_10040145 3300011119 Bacteria 3156
132 Ga0105246_10801799 3300011119 Bacteria 836
133 Ga0157370_10009155 3300013104 Bacteria 10614
134 Ga0157370_10247240 3300013104 Unclassified 1650
135 Ga0157369_10347641 3300013105 Bacteria 1540
136 Ga0157374_10028792 3300013296 Bacteria 5021
137 Ga0157378_10799335 3300013297 Bacteria 969
138 Ga0163162_10472830 3300013306 Bacteria 1385
139 Ga0163162_10939796 3300013306 Unclassified 976
140 Ga0163162_11187865 3300013306 Bacteria 866
141 Ga0157375_10038296 3300013308 Bacteria 4604
142 Ga0157375_10264628 3300013308 Unclassified 1881
143 Ga0157375_10358693 3300013308 Bacteria 1624
144 Ga0157375_12311752 3300013308 Bacteria 641
145 Ga0163163_10044437 3300014325 Bacteria 4358
146 Ga0163163_10185180 3300014325 Bacteria 2130
147 Ga0163163_10195867 3300014325 Bacteria 2069
148 Ga0157380_10038209 3300014326 Bacteria 3726
149 Ga0157380_11521480 3300014326 Unclassified 723
150 Ga0182008_10018418 3300014497 Bacteria 3616
151 Ga0182008_10163776 3300014497 Bacteria 1120
152 Ga0157379_10066286 3300014968 Bacteria 3227
153 Ga0157379_10955843 3300014968 Bacteria 815
154 Ga0157376_10038920 3300014969 Bacteria 3873
155 Ga0163161_10032842 3300017792 Bacteria 3707
156 Ga0206352_10122515 3300020078 Unclassified 739
157 Ga0213875_10001977 3300021388 Bacteria 12673
158 Ga0207710_10137203 3300025900 Bacteria 1179
159 Ga0207710_10166576 3300025900 Bacteria 1076
160 Ga0207688_10021737 3300025901 Bacteria 3508
161 Ga0207699_10078531 3300025906 Bacteria 2039
162 Ga0207645_10392475 3300025907 Bacteria 933
163 Ga0207684_10045471 3300025910 Bacteria 3723
164 Ga0207707_10033089 3300025912 Bacteria 4524
165 Ga0207695_10167961 3300025913 Bacteria 2121
166 Ga0207695_10250187 3300025913 Bacteria 1672
167 Ga0207695_10456372 3300025913 Bacteria 1161
168 Ga0207671_10037292 3300025914 Bacteria 3605
169 Ga0207671_10594231 3300025914 Bacteria 882
170 Ga0207693_10062621 3300025915 Bacteria 2914
171 Ga0207693_10215996 3300025915 Bacteria 1507
172 Ga0207693_10564557 3300025915 Bacteria 887
173 Ga0207693_10567466 3300025915 Bacteria 884
174 Ga0207693_10587940 3300025915 Bacteria 867
175 Ga0207693_10776217 3300025915 Bacteria 739
176 Ga0207660_10212247 3300025917 Unclassified 1516
177 Ga0207652_10067576 3300025921 Bacteria 3100
178 Ga0207646_10005075 3300025922 Bacteria 13984
179 Ga0207646_10181524 3300025922 Bacteria 1901
180 Ga0207681_10423227 3300025923 Bacteria 1079
181 Ga0207650_10013312 3300025925 Bacteria 5694
182 Ga0207650_10109218 3300025925 Bacteria 2139
183 Ga0207659_10041760 3300025926 Bacteria 3213
184 Ga0207700_10068355 3300025928 Bacteria 2723
185 Ga0207700_10125655 3300025928 Bacteria 2087
186 Ga0207700_10736834 3300025928 Unclassified 880
187 Ga0207700_10762299 3300025928 Bacteria 865
188 Ga0207700_10919602 3300025928 Bacteria 783
189 Ga0207664_10195883 3300025929 Bacteria 1742
190 Ga0207664_10260406 3300025929 Bacteria 1517
191 Ga0207690_10217132 3300025932 Bacteria 1461
192 Ga0207706_10056600 3300025933 Bacteria 3457
193 Ga0207686_10056071 3300025934 Bacteria 2475
194 Ga0207686_10059183 3300025934 Bacteria 2419
195 Ga0207670_10057621 3300025936 Bacteria 2635
196 Ga0207670_10926698 3300025936 Bacteria 731
197 Ga0207669_10027880 3300025937 Bacteria 3099
198 Ga0207704_10049860 3300025938 Bacteria 2522
199 Ga0207691_10333407 3300025940 Bacteria 1300
200 Ga0207689_10198808 3300025942 Bacteria 1654
201 Ga0207679_10720656 3300025945 Bacteria 906
202 Ga0207712_10131359 3300025961 Bacteria 1909
203 Ga0207668_10693146 3300025972 Bacteria 895
204 Ga0207658_10128562 3300025986 Bacteria 2032
205 Ga0207677_10378629 3300026023 Bacteria 1194
206 Ga0207703_10104470 3300026035 Bacteria 2407
207 Ga0207703_10468733 3300026035 Bacteria 1179
208 Ga0207639_11216677 3300026041 Bacteria 707
209 Ga0207702_10049504 3300026078 Bacteria 3546
210 Ga0207702_10263796 3300026078 Bacteria 1623
211 Ga0207702_11613612 3300026078 Bacteria 642
212 Ga0207648_10265419 3300026089 Bacteria 1533
213 Ga0207676_10965841 3300026095 Bacteria 838
214 Ga0207675_100010399 3300026118 Bacteria 8719
215 Ga0207683_10015526 3300026121 Bacteria 6485
216 Ga0207698_10543897 3300026142 Bacteria 1137
217 Ga0207698_10668033 3300026142 Bacteria 1031
218 Ga0209179_1004643 3300027512 Bacteria 2090
219 Ga0209179_1041063 3300027512 Bacteria 974
220 Ga0209813_10052222 3300027866 Bacteria 1281
221 Ga0209813_10168923 3300027866 Bacteria 793
222 Ga0207428_10219989 3300027907 Bacteria 1424
223 Ga0268266_10390806 3300028379 Bacteria 1314
224 Ga0268266_10812532 3300028379 Bacteria 903
225 Ga0268265_10437813 3300028380 Bacteria 1218
226 Ga0268264_10361815 3300028381 Bacteria 1384
227 Ga0268264_10402841 3300028381 Bacteria 1315
228 Ga0307511_10124757 3300030521 Bacteria 1576
229 Ga0265339_10133150 3300031249 Bacteria 1269
230 Ga0307513_10384027 3300031456 Unclassified 1143
231 Ga0307509_10027631 3300031507 Bacteria 6312
232 Ga0265314_10029860 3300031711 Bacteria 4045
233 Ga0265342_10004708 3300031712 Bacteria 10624
234 Ga0316576_10147147 3300031727 Unclassified 1775
235 Ga0307507_10144872 3300033179 Bacteria 1808
236 Ga0373926_0005962 3300035083 Bacteria 4033
237 Ga0373926_0015131 3300035083 Bacteria 2628
238 Ga0373934_0033787 3300035086 Bacteria 2008
239 Ga0373944_0029885 3300035089 Bacteria 1632
240 Ga0373923_0041539 3300035111 Bacteria 1896
241 Ga0373923_0135928 3300035111 Bacteria 1108
242 Ga0373936_0066040 3300035113 Bacteria 1485
243 Ga0373936_0072928 3300035113 Bacteria 1418
244 Ga0373936_0314534 3300035113 Bacteria 709
245 Ga0373945_0020047 3300035116 Bacteria 2286
246 Ga0373945_0154233 3300035116 Bacteria 933
247 Ga0373945_0191949 3300035116 Bacteria 845
248 Ga0373953_0000839 3300035117 Bacteria 8562
249 Ga0373953_0007284 3300035117 Bacteria 3699
250 Ga0373954_0086262 3300035118 Bacteria 1504
251 Ga0373954_0097652 3300035118 Bacteria 1415
252 Ga0373954_0166206 3300035118 Bacteria 1080
253 Ga0373956_0086008 3300035119 Bacteria 1446
254 Ga0373957_0079908 3300035120 Bacteria 1290
255 Ga0373957_0122689 3300035120 Bacteria 1052
256 Ga0373943_0036173 3300035170 Bacteria 2364
257 Ga0373943_0046290 3300035170 Bacteria 2123
258 Ga0373943_0113476 3300035170 Bacteria 1432
259 Ga0373946_0333941 3300035171 Unclassified 755
260 Ga0373955_0131824 3300035172 Bacteria 1459
261 Ga0373942_0043207 3300035207 Bacteria 1238
262 Ga0373924_0040293 3300035410 Bacteria 1911
263 Ga0373931_0014744 3300035691 Bacteria 3826
264 Ga0373931_0026346 3300035691 Bacteria 2958
265 Ga0373931_0275847 3300035691 Bacteria 1031
266 Ga0373935_0010353 3300035692 Bacteria 5594
267 Ga0373935_0054109 3300035692 Bacteria 2554
268 Ga0373935_0110192 3300035692 Bacteria 1826
269 Ga0373935_0216453 3300035692 Bacteria 1329
270 Ga0373935_0271216 3300035692 Bacteria 1192
271 Ga0373935_0564943 3300035692 Bacteria 830
272 Ga0373927_0029708 3300035695 Bacteria 3564
273 Ga0373927_0107761 3300035695 Bacteria 1815
274 Ga0373927_0110980 3300035695 Bacteria 1787
275 Ga0373927_0134797 3300035695 Bacteria 1613
276 Ga0373927_0144026 3300035695 Bacteria 1559
277 Ga0373927_0162121 3300035695 Bacteria 1465
278 Ga0373927_0166133 3300035695 Bacteria 1446
279 Ga0373927_0222055 3300035695 Bacteria 1241
280 Ga0373927_0491045 3300035695 Unclassified 811
281 Ga0373927_0506841 3300035695 Unclassified 797
282 Ga0373933_0039489 3300035724 Bacteria 2777
283 Ga0373933_0089116 3300035724 Bacteria 1901
284 Ga0373933_0148162 3300035724 Unclassified 1485
285 Ga0373947_0016115 3300035725 Bacteria 4295
286 Ga0373947_0030721 3300035725 Bacteria 3158
287 Ga0373947_0163613 3300035725 Bacteria 1440
288 Ga0373947_0222958 3300035725 Bacteria 1240
289 Ga0373947_0443041 3300035725 Bacteria 879
290 Ga0373947_0732341 3300035725 Bacteria 675
291 Ga0373947_0849929 3300035725 Bacteria 623
292 Ga0373937_0002643 3300036401 Bacteria 14932
293 Ga0373937_0005774 3300036401 Bacteria 10640
294 Ga0373937_0006153 3300036401 Bacteria 10333
295 Ga0373937_0013955 3300036401 Bacteria 7083
296 Ga0373937_0027133 3300036401 Bacteria 5177
297 Ga0373937_0031949 3300036401 Bacteria 4772
298 Ga0373937_0038392 3300036401 Bacteria 4363
299 Ga0373937_0041880 3300036401 Bacteria 4179
300 Ga0373937_0370926 3300036401 Bacteria 1357
301 Ga0373937_0576702 3300036401 Bacteria 1068
302 Ga0373925_0060713 3300037068 Bacteria 2839
303 Ga0373925_0120635 3300037068 Bacteria 2035
304 Ga0373925_0152310 3300037068 Bacteria 1816
305 Ga0373925_0228508 3300037068 Bacteria 1487
306 Ga0373925_0234100 3300037068 Bacteria 1469
307 Ga0373925_0362693 3300037068 Bacteria 1178
308 Ga0373925_0454613 3300037068 Unclassified 1049
309 Ga0373925_0711331 3300037068 Bacteria 828
310 Ga0373925_0749392 3300037068 Bacteria 805
311 Ga0373925_0816962 3300037068 Unclassified 768
312 Ga0436364_0683287 3300037853 Bacteria 18834
313 Ga0436365_0276230 3300039437 Unclassified 795
314 Ga0436360_0114051 3300039438 Bacteria 1457
315 Ga0466972_0065454 3300044658 Bacteria 1738
316 Ga0466963_0589337 3300044694 Bacteria 785
317 Ga0495592_0024361 3300046454 Bacteria 4602
318 Ga0495592_0074434 3300046454 Bacteria 2467
319 Ga0495592_0088969 3300046454 Bacteria 2219
320 Ga0495592_0116272 3300046454 Bacteria 1887
321 Ga0495592_0438290 3300046454 Bacteria 821
322 Ga0495629_0114685 3300046459 Bacteria 1878
323 Ga0495629_0150604 3300046459 Bacteria 1617
324 Ga0495638_0471183 3300046460 Bacteria 638
325 Ga0495651_0055996 3300046462 Bacteria 3029
326 Ga0495651_0363365 3300046462 Bacteria 953
327 Ga0495651_0701725 3300046462 Bacteria 630
328 Ga0495653_0001158 3300046463 Bacteria 20304
329 Ga0495653_0127662 3300046463 Bacteria 1804
330 Ga0495653_0208694 3300046463 Bacteria 1320
331 Ga0495653_0294479 3300046463 Bacteria 1060
332 Ga0495580_0062802 3300046472 Bacteria 2605
333 Ga0495580_0086035 3300046472 Bacteria 2189
334 Ga0495582_0002687 3300046473 Bacteria 9929
335 Ga0495639_0073134 3300046475 Bacteria 1586
336 Ga0495639_0104115 3300046475 Bacteria 1342
337 Ga0495639_0227539 3300046475 Bacteria 918
338 Ga0495662_0165912 3300046476 Bacteria 1088
339 Ga0495664_0033595 3300046477 Bacteria 3014
340 Ga0495664_0034010 3300046477 Bacteria 2997
341 Ga0495664_0038674 3300046477 Bacteria 2817
342 Ga0495664_0088200 3300046477 Bacteria 1864
343 Ga0495664_0098868 3300046477 Bacteria 1757
344 Ga0495664_0150479 3300046477 Bacteria 1411
345 Ga0495585_0170871 3300046492 Bacteria 1123
346 Ga0495608_0052598 3300046511 Bacteria 2696
347 Ga0495608_0085417 3300046511 Bacteria 2045
348 Ga0495608_0160347 3300046511 Bacteria 1430
349 Ga0495618_0065088 3300046514 Bacteria 2317
350 Ga0495620_0081851 3300046515 Bacteria 1305
351 Ga0495628_0107746 3300046516 Bacteria 2145
352 Ga0495628_0122546 3300046516 Bacteria 1993
353 Ga0495630_0034159 3300046517 Bacteria 3796
354 Ga0495630_0230869 3300046517 Unclassified 1414
355 Ga0495630_0269108 3300046517 Bacteria 1302
356 Ga0495630_0375826 3300046517 Bacteria 1088
357 Ga0495630_0908227 3300046517 Bacteria 671
358 Ga0495666_0002592 3300046526 Bacteria 8993
359 Ga0495652_0097638 3300046529 Bacteria 2389
360 Ga0495652_0217045 3300046529 Bacteria 1439
361 Ga0495640_0021432 3300046533 Bacteria 4742
362 Ga0495640_0083556 3300046533 Bacteria 2119
363 Ga0495640_0319876 3300046533 Bacteria 961
364 Ga0495586_0058771 3300046535 Bacteria 2088
365 Ga0495586_0064415 3300046535 Bacteria 1997
366 Ga0495586_0127741 3300046535 Bacteria 1423
367 Ga0495586_0499818 3300046535 Unclassified 702
368 Ga0495587_0006219 3300046536 Bacteria 7793
369 Ga0495587_0015985 3300046536 Bacteria 4671
370 Ga0495587_0056449 3300046536 Bacteria 2310
371 Ga0495587_0158530 3300046536 Bacteria 1288
372 Ga0495587_0323066 3300046536 Bacteria 862
373 Ga0495587_0432218 3300046536 Bacteria 730
374 Ga0495645_0001603 3300046543 Bacteria 15316
375 Ga0495645_0065206 3300046543 Bacteria 2634
376 Ga0495645_0087844 3300046543 Bacteria 2224
377 Ga0495645_0547308 3300046543 Unclassified 718
378 Ga0495622_0083923 3300046557 Bacteria 1465
379 Ga0495633_0109789 3300046558 Bacteria 1279
380 Ga0495667_0026941 3300046559 Bacteria 3874
381 Ga0495667_0059670 3300046559 Bacteria 2503
382 Ga0495667_0066950 3300046559 Bacteria 2347
383 Ga0495667_0140792 3300046559 Bacteria 1554
384 Ga0495667_0148341 3300046559 Bacteria 1510
385 Ga0495667_0216782 3300046559 Bacteria 1222
386 Ga0495656_0056520 3300046615 Bacteria 1696
387 Ga0495656_0527372 3300046615 Bacteria 628
388 Ga0495634_0046600 3300046642 Bacteria 2925
389 Ga0495634_0054601 3300046642 Bacteria 2673
390 Ga0495635_0014645 3300046663 Bacteria 5486
391 Ga0495635_0305783 3300046663 Bacteria 1066
392 Ga0495635_0425740 3300046663 Bacteria 879
393 Ga0495657_0071259 3300046675 Bacteria 2269
394 Ga0495657_0117614 3300046675 Bacteria 1677
395 Ga0495657_0441428 3300046675 Unclassified 763
396 Ga0495657_0610983 3300046675 Bacteria 630
397 Ga0495599_0003833 3300046678 Bacteria 8833
398 Ga0495599_0027110 3300046678 Bacteria 3591
399 Ga0495599_0183885 3300046678 Bacteria 1287
400 Ga0495623_0013717 3300046679 Bacteria 5253
401 Ga0495623_0032412 3300046679 Bacteria 3359
402 Ga0495623_0275296 3300046679 Bacteria 938
403 Ga0495646_0011073 3300046680 Bacteria 5726
404 Ga0495646_0080832 3300046680 Bacteria 1895
405 Ga0495646_0162653 3300046680 Bacteria 1234
406 Ga0495646_0547439 3300046680 Bacteria 591
407 Ga0495647_0282515 3300046681 Bacteria 745
408 Ga0495658_0213633 3300046683 Bacteria 1206
409 Ga0495658_0443410 3300046683 Bacteria 829
410 Ga0495613_0079298 3300046689 Bacteria 2388
411 Ga0495613_0341573 3300046689 Bacteria 1030
412 Ga0495624_0319671 3300046690 Bacteria 935
413 Ga0495671_0122107 3300046692 Bacteria 1271
414 Ga0495589_0088571 3300046794 Bacteria 1503
415 Ga0495600_0162312 3300046809 Bacteria 1444
416 Ga0495600_0214327 3300046809 Bacteria 1233
417 Ga0495660_0160529 3300046810 Bacteria 1103
418 Ga0495581_0253858 3300047315 Bacteria 1028
419 Ga0495604_0091792 3300047317 Bacteria 2251
420 Ga0495604_0325046 3300047317 Bacteria 1027
421 Ga0495604_0538629 3300047317 Bacteria 754
422 Ga0495674_0006348 3300047319 Bacteria 11331
423 Ga0495674_0082848 3300047319 Bacteria 2750
424 Ga0495674_0178439 3300047319 Bacteria 1770
425 Ga0495674_0191161 3300047319 Bacteria 1701
426 Ga0495674_0266769 3300047319 Bacteria 1406
427 Ga0495674_0796754 3300047319 Bacteria 735
428 Ga0495676_0305134 3300047321 Bacteria 1073
429 Ga0495680_0024106 3300047322 Bacteria 5050
430 Ga0495680_0038563 3300047322 Bacteria 3817
431 Ga0495680_0185738 3300047322 Bacteria 1498
432 Ga0495680_0201437 3300047322 Bacteria 1427
433 Ga0495675_0012058 3300047444 Bacteria 5433
434 Ga0495675_0103321 3300047444 Bacteria 1782
435 Ga0495675_0171292 3300047444 Bacteria 1333
436 Ga0495675_0287780 3300047444 Bacteria 979
437 Ga0495685_132343 3300047447 Bacteria 815
438 Ga0495684_0070195 3300047471 Bacteria 2663
439 Ga0495684_0111596 3300047471 Bacteria 2063
440 Ga0495684_0190958 3300047471 Bacteria 1514
441 Ga0495684_0197830 3300047471 Bacteria 1483
442 Ga0495593_0073645 3300047673 Bacteria 1771
443 Ga0495602_0004532 3300048088 Bacteria 14497
444 Ga0495602_0099575 3300048088 Bacteria 2389
445 Ga0495602_0244521 3300048088 Bacteria 1340
446 Ga0495602_0275582 3300048088 Bacteria 1242
447 Ga0495602_0309487 3300048088 Bacteria 1153
448 Ga0495626_0173162 3300048091 Bacteria 899
449 Ga0496100_0020594 3300048903 Bacteria 3957
450 Ga0496100_1030013 3300048903 Unclassified 648
451 Ga0496101_0036685 3300048904 Bacteria 3472
452 Ga0496101_0076622 3300048904 Bacteria 2463
453 Ga0496101_0139570 3300048904 Bacteria 1846
454 Ga0496102_0006559 3300048905 Bacteria 9938
455 Ga0496102_0071867 3300048905 Bacteria 3177
456 Ga0496102_0085453 3300048905 Bacteria 2913
457 Ga0496102_0392844 3300048905 Bacteria 1305
458 Ga0496103_0008311 3300048906 Bacteria 6166
459 Ga0496103_0051671 3300048906 Bacteria 2544
460 Ga0496103_0270902 3300048906 Bacteria 1092
461 Ga0496104_0024150 3300048907 Bacteria 5592
462 Ga0496104_0029047 3300048907 Bacteria 5127
463 Ga0496104_0066796 3300048907 Bacteria 3415
464 Ga0496104_0119237 3300048907 Bacteria 2533
465 Ga0496105_0016392 3300048908 Bacteria 5915
466 Ga0496105_0045104 3300048908 Bacteria 3637
467 Ga0496105_0054089 3300048908 Bacteria 3315
468 Ga0496105_0807682 3300048908 Bacteria 713
469 Ga0496106_0004636 3300048909 Bacteria 10196
470 Ga0496106_0042806 3300048909 Bacteria 3396
471 Ga0496106_0043236 3300048909 Bacteria 3380
472 Ga0496106_0103657 3300048909 Bacteria 2208
473 Ga0496106_0130243 3300048909 Bacteria 1972
474 Ga0496106_0261233 3300048909 Bacteria 1385
475 Ga0496107_0017590 3300048910 Bacteria 5029
476 Ga0496107_0051008 3300048910 Bacteria 2983
477 Ga0496107_0074819 3300048910 Bacteria 2464
478 Ga0496108_0037683 3300048911 Bacteria 4028
479 Ga0496108_0193866 3300048911 Bacteria 1762
480 Ga0496108_0360762 3300048911 Bacteria 1268
481 Ga0496109_0020035 3300048912 Bacteria 5906
482 Ga0496109_0032574 3300048912 Bacteria 4685
483 Ga0496109_0075750 3300048912 Bacteria 3093
484 Ga0496109_0141846 3300048912 Bacteria 2247
485 Ga0496109_0223025 3300048912 Bacteria 1773
486 Ga0496109_0739270 3300048912 Bacteria 922
487 Ga0496110_0033213 3300048913 Bacteria 4461
488 Ga0496110_0058899 3300048913 Bacteria 3383
489 Ga0496110_0069092 3300048913 Bacteria 3127
490 Ga0496110_0200608 3300048913 Bacteria 1813
491 Ga0496111_0015945 3300048914 Bacteria 5169
492 Ga0496111_0034126 3300048914 Bacteria 3632
493 Ga0496111_0084178 3300048914 Bacteria 2325
494 Ga0496111_0744464 3300048914 Unclassified 711
495 Ga0496112_0000117 3300048915 Bacteria 49274
496 Ga0496112_0021715 3300048915 Bacteria 6107
497 Ga0496112_0033178 3300048915 Bacteria 5016
498 Ga0496112_0064393 3300048915 Bacteria 3617
499 Ga0496112_0122934 3300048915 Bacteria 2566
500 Ga0496112_0126487 3300048915 Bacteria 2526
501 Ga0496112_0135862 3300048915 Bacteria 2429
502 Ga0496113_0013075 3300048916 Bacteria 5604
503 Ga0496113_0014435 3300048916 Bacteria 5388
504 Ga0496113_0057039 3300048916 Bacteria 2933
505 Ga0496113_0111020 3300048916 Bacteria 2134
506 Ga0496113_0249742 3300048916 Bacteria 1416
507 Ga0496114_0038914 3300048917 Bacteria 3935
508 Ga0496114_0084435 3300048917 Bacteria 2689
509 Ga0496114_0107939 3300048917 Bacteria 2382
510 Ga0496114_0131760 3300048917 Bacteria 2159
511 Ga0496115_0035307 3300048918 Bacteria 3955
512 Ga0496115_0063602 3300048918 Bacteria 2977
513 Ga0496115_0867536 3300048918 Bacteria 698
514 Ga0496117_0004243 3300048920 Bacteria 15994
515 Ga0496117_0172256 3300048920 Bacteria 1255
516 Ga0496117_0327275 3300048920 Unclassified 800
517 Ga0496118_0003772 3300048921 Bacteria 18723
518 Ga0496118_0006987 3300048921 Bacteria 12170
519 Ga0496118_0268231 3300048921 Bacteria 958
520 Ga0496121_0000302 3300048924 Bacteria 102347
521 Ga0496121_0003316 3300048924 Bacteria 23126
522 Ga0496124_0003179 3300048927 Bacteria 20302
523 Ga0496126_0000064 3300048929 Bacteria 255729
524 Ga0496126_0016919 3300048929 Bacteria 7276
525 Ga0501290_002082 3300049513 Bacteria 2620
526 Ga0501292_000017 3300049515 Bacteria 57254
527 Ga0501296_042930 3300049519 Bacteria 643
528 Ga0501300_000460 3300049523 Bacteria 6195
529 Ga0501302_001443 3300049525 Bacteria 1307
530 Ga0501032_0026834 3300049569 Bacteria 3959
531 Ga0501034_0150319 3300049571 Bacteria 2305
532 Ga0501037_0212437 3300049573 Bacteria 1364
533 Ga0501038_0694232 3300049574 Unclassified 763
534 Ga0501039_0501662 3300049575 Bacteria 953
535 Ga0501040_0127185 3300049576 Bacteria 1790
536 Ga0501041_0198612 3300049577 Bacteria 1257
537 Ga0501042_0599027 3300049578 Unclassified 801
538 Ga0501047_0315482 3300049581 Bacteria 1404
539 Ga0501073_0369771 3300049589 Bacteria 990
540 Ga0501074_0462287 3300049590 Bacteria 899
541 Ga0501075_0532268 3300049591 Unclassified 897
542 Ga0501079_0294106 3300049741 Bacteria 1270
543 Ga0501079_1214693 3300049741 Bacteria 594
544 Ga0501080_0661054 3300049742 Bacteria 924
545 Ga0501081_0128362 3300049743 Bacteria 1810
546 Ga0501081_0531898 3300049743 Bacteria 877
547 Ga0501279_000019 3300049775 Bacteria 58746
548 Ga0501280_000837 3300049776 Bacteria 6650
549 Ga0501283_000524 3300049779 Bacteria 5040
550 Ga0501044_0071169 3300049823 Bacteria 3537
551 Ga0501045_0138965 3300049824 Bacteria 1807
552 nmdc:mga0yw44_247414_c1 3300050492 Bacteria 1186
553 nmdc:mga0yw44_8587_c1 3300050492 Bacteria 5100
554 nmdc:mga06z11_112704_c1 3300050494 Bacteria 1508
555 nmdc:mga04h51_196521_c1 3300050495 Bacteria 791
556 nmdc:mga04h51_20957_c1 3300050495 Bacteria 1960
557 nmdc:mga05p37_325052_c1 3300050507 Bacteria 1819
558 nmdc:mga05p37_415188_c1 3300050507 Bacteria 1568
559 nmdc:mga05p37_65807_c1 3300050507 Bacteria 4459
560 nmdc:mga09592_250535_c1 3300050508 Bacteria 1535
561 nmdc:mga06r32_942424_c1 3300050510 Unclassified 818
562 nmdc:mga08y16_38677_c1 3300050511 Bacteria 5007
563 nmdc:mga08y16_76282_c1 3300050511 Bacteria 3494
564 nmdc:mga0n895_739346_c1 3300050512 Unclassified 977
565 nmdc:mga0n895_813010_c1 3300050512 Bacteria 924
566 nmdc:mga0n895_84354_c1 3300050512 Bacteria 3170
567 nmdc:mga0a205_275403_c1 3300050515 Bacteria 1559
568 Ga0495601_0007248 3300053077 Bacteria 6504
569 Ga0495601_0009347 3300053077 Bacteria 5797
570 Ga0495601_0027025 3300053077 Bacteria 3546
571 Ga0495601_0031204 3300053077 Bacteria 3312
572 Ga0495601_0040817 3300053077 Bacteria 2907
573 Ga0495601_0109698 3300053077 Bacteria 1787
574 Ga0495612_0003568 3300053078 Bacteria 6448
575 Ga0495612_0036886 3300053078 Bacteria 1984
576 Ga0495612_0099180 3300053078 Bacteria 1239
577 Ga0495655_0012873 3300053083 Bacteria 1715
578 Ga0495595_0005643 3300053084 Bacteria 5063
579 Ga0495595_0028862 3300053084 Bacteria 2479
580 Ga0495595_0055220 3300053084 Bacteria 1848
581 Ga0495595_0142703 3300053084 Bacteria 1175
582 Ga0495595_0199316 3300053084 Unclassified 996
583 Ga0495619_0008745 3300053085 Bacteria 6403
584 Ga0495619_0018321 3300053085 Bacteria 4442
585 Ga0495619_0035609 3300053085 Bacteria 3238
586 Ga0495619_0152867 3300053085 Bacteria 1592
587 Ga0495619_0167122 3300053085 Bacteria 1520
588 Ga0495619_0394951 3300053085 Bacteria 955
589 Ga0495619_0477666 3300053085 Unclassified 858
590 Ga0500647_0207050 3300053091 Bacteria 886
591 Ga0500566_0234467 3300053094 Bacteria 903
592 Ga0500566_0328591 3300053094 Bacteria 709
593 Ga0500595_014412 3300053119 Bacteria 2999
594 Ga0500590_090338 3300053148 Bacteria 1488
595 Ga0500603_034501 3300053150 Bacteria 1323
596 Ga0500638_125575 3300053162 Bacteria 1169
597 Ga0500636_0162331 3300053177 Bacteria 1216
598 Ga0500637_0058616 3300053178 Bacteria 2203
599 Ga0501084_0377910 3300054114 Unclassified 1197
600 Ga0501084_0591397 3300054114 Bacteria 938
601 Ga0501082_0091419 3300060353 Bacteria 2628
602 Ga0501082_0241972 3300060353 Bacteria 1570
603 Ga0501082_0806086 3300060353 Unclassified 821
604 Ga0530510_0520052 3300061734 Bacteria 903
605 2513566160 2513237083 Bacteria 8410967
606 2935917004 2935916978 Bacteria 9113783
607 2935933011 2935926038 Bacteria 8601059
608 2935941679 2935934488 Bacteria 8602579
609 2935949985 2935942939 Bacteria 8599779
610 2935958473 2935951376 Bacteria 8602333
611 2935974561 2935967501 Bacteria 8603075
612 8003962305 8003955200 Bacteria 8601927
613 8016603822 8016603502 Bacteria 8731218
614 8055270532 8055266321 Bacteria 7999742
615 nmdc:mga0qj67_209081_c1
616 Ga0070676_11085216
617 Ga0070683_100534187
618 Ga0070670_100523330
619 Ga0068869_100294343
620 Ga0070680_100388050
621 Ga0070668_100050825
622 Ga0070669_100210711
623 Ga0070675_100053201
624 Ga0070671_100444055
625 Ga0070671_100697666
626 Ga0070674_100230984
627 Ga0070688_100367791
628 Ga0070659_100403099
629 Ga0070709_10135622
630 Ga0070709_10766741
631 Ga0070714_100237618
632 Ga0070714_100492911
633 Ga0070713_100100284
634 Ga0070713_100113973
635 Ga0070713_100308929
636 Ga0070711_100753408
637 Ga0070694_100309195
638 Ga0070708_100009735
639 Ga0070663_100034828
640 Ga0070681_10007680
641 Ga0070681_10211650
642 Ga0068867_100041820
643 Ga0068867_100244408
644 Ga0070685_10501609
645 Ga0070706_100061768
646 Ga0070707_100276512
647 Ga0070707_101246782
648 Ga0070698_100041231
649 Ga0070698_100349809
650 Ga0070698_100842623
651 Ga0070699_100036497
652 Ga0070699_100382363
653 Ga0070699_101135551
654 Ga0070679_100016065
655 Ga0070684_100257896
656 Ga0070697_100042524
657 Ga0070697_100445136
658 Ga0070665_100217886
659 Ga0068855_100684531
660 Ga0070664_100813094
661 Ga0068854_100436558
662 Ga0068854_101046244
663 Ga0068856_100305774
664 Ga0070702_100022723
665 Ga0068852_100020506
666 Ga0068859_100103873
667 Ga0068859_100641803
668 Ga0068859_100663844
669 Ga0068864_100981169
670 Ga0068861_100045490
671 Ga0068870_10129423
672 Ga0068858_100519347
673 Ga0068860_100082135
674 Ga0068860_100145550
675 Ga0068860_101391181
676 Ga0081455_10021804
677 Ga0081455_10053760
678 Ga0081455_10057332
679 Ga0081540_1013246
680 Ga0070717_10001490
681 Ga0070717_10160725
682 Ga0070717_10445481
683 Ga0075365_10015729
684 Ga0075365_10144169
685 Ga0075365_10147544
686 Ga0075368_10178348
687 Ga0070715_10247037
688 Ga0070712_100019532
689 Ga0070712_100098494
690 Ga0070712_100100735
691 Ga0070712_100651281
692 Ga0075367_10038765
693 Ga0075367_10166639
694 Ga0097621_100384015
695 Ga0075428_100003188
696 Ga0075428_100064505
697 Ga0075428_100804917
698 Ga0075428_100808065
699 Ga0075431_100993188
700 Ga0075433_10274109
701 Ga0075434_100064867
702 Ga0075434_100885397
703 Ga0068865_100047589
704 Ga0097620_100103875
705 Ga0097620_100641788
706 Ga0097620_100663768
707 Ga0099795_10009697
708 Ga0099795_10017480
709 Ga0099795_10230272
710 Ga0099795_10274032
711 Ga0105251_10165339
712 Ga0105240_10048855
713 Ga0105240_10168532
714 Ga0105240_10702910
715 Ga0111539_10016828
716 Ga0111539_10047271
717 Ga0111539_11114516
718 Ga0105245_10573473
719 Ga0105245_10608762
720 Ga0105247_10222729
721 Ga0114129_10020829
722 Ga0114129_10251686
723 Ga0114129_10285595
724 Ga0114129_11683490
725 Ga0105243_10054395
726 Ga0105242_10066418
727 Ga0105242_10587821
728 Ga0105248_10788317
729 Ga0105237_10052255
730 Ga0105237_10174498
731 Ga0105237_10829811
732 Ga0105238_10006074
733 Ga0105238_10346086
734 Ga0105249_10062684
735 Ga0105249_12375952
736 Ga0099796_10001194
737 Ga0099796_10002395
738 Ga0099796_10049783
739 Ga0099796_10290816
740 Ga0105239_10050276
741 Ga0105239_10051994
742 Ga0105239_10275502
743 Ga0105239_10466863
744 Ga0105246_10029834
745 Ga0105246_10040145
746 Ga0105246_10801799
747 Ga0157370_10009155
748 Ga0157370_10247240
749 Ga0157369_10347641
750 Ga0157374_10028792
751 Ga0157378_10799335
752 Ga0163162_10472830
753 Ga0163162_10939796
754 Ga0163162_11187865
755 Ga0157375_10038296
756 Ga0157375_10264628
757 Ga0157375_10358693
758 Ga0157375_12311752
759 Ga0163163_10044437
760 Ga0163163_10185180
761 Ga0163163_10195867
762 Ga0157380_10038209
763 Ga0157380_11521480
764 Ga0182008_10018418
765 Ga0182008_10163776
766 Ga0157379_10066286
767 Ga0157379_10955843
768 Ga0157376_10038920
769 Ga0163161_10032842
770 Ga0206352_10122515
771 Ga0213875_10001977
772 Ga0207710_10137203
773 Ga0207710_10166576
774 Ga0207688_10021737
775 Ga0207699_10078531
776 Ga0207645_10392475
777 Ga0207684_10045471
778 Ga0207707_10033089
779 Ga0207695_10167961
780 Ga0207695_10250187
781 Ga0207695_10456372
782 Ga0207671_10037292
783 Ga0207671_10594231
784 Ga0207693_10062621
785 Ga0207693_10215996
786 Ga0207693_10564557
787 Ga0207693_10567466
788 Ga0207693_10587940
789 Ga0207693_10776217
790 Ga0207660_10212247
791 Ga0207652_10067576
792 Ga0207646_10005075
793 Ga0207646_10181524
794 Ga0207681_10423227
795 Ga0207650_10013312
796 Ga0207650_10109218
797 Ga0207659_10041760
798 Ga0207700_10068355
799 Ga0207700_10125655
800 Ga0207700_10736834
801 Ga0207700_10762299
802 Ga0207700_10919602
803 Ga0207664_10195883
804 Ga0207664_10260406
805 Ga0207690_10217132
806 Ga0207706_10056600
807 Ga0207686_10056071
808 Ga0207686_10059183
809 Ga0207670_10057621
810 Ga0207670_10926698
811 Ga0207669_10027880
812 Ga0207704_10049860
813 Ga0207691_10333407
814 Ga0207689_10198808
815 Ga0207679_10720656
816 Ga0207712_10131359
817 Ga0207668_10693146
818 Ga0207658_10128562
819 Ga0207677_10378629
820 Ga0207703_10104470
821 Ga0207703_10468733
822 Ga0207639_11216677
823 Ga0207702_10049504
824 Ga0207702_10263796
825 Ga0207702_11613612
826 Ga0207648_10265419
827 Ga0207676_10965841
828 Ga0207675_100010399
829 Ga0207683_10015526
830 Ga0207698_10543897
831 Ga0207698_10668033
832 Ga0209179_1004643
833 Ga0209179_1041063
834 Ga0209813_10052222
835 Ga0209813_10168923
836 Ga0207428_10219989
837 Ga0268266_10390806
838 Ga0268266_10812532
839 Ga0268265_10437813
840 Ga0268264_10361815
841 Ga0268264_10402841
842 Ga0307511_10124757
843 Ga0265339_10133150
844 Ga0307513_10384027
845 Ga0307509_10027631
846 Ga0265314_10029860
847 Ga0265342_10004708
848 Ga0316576_10147147
849 Ga0307507_10144872
850 Ga0373926_0005962
851 Ga0373926_0015131
852 Ga0373934_0033787
853 Ga0373944_0029885
854 Ga0373923_0041539
855 Ga0373923_0135928
856 Ga0373936_0066040
857 Ga0373936_0072928
858 Ga0373936_0314534
859 Ga0373945_0020047
860 Ga0373945_0154233
861 Ga0373945_0191949
862 Ga0373953_0000839
863 Ga0373953_0007284
864 Ga0373954_0086262
865 Ga0373954_0097652
866 Ga0373954_0166206
867 Ga0373956_0086008
868 Ga0373957_0079908
869 Ga0373957_0122689
870 Ga0373943_0036173
871 Ga0373943_0046290
872 Ga0373943_0113476
873 Ga0373946_0333941
874 Ga0373955_0131824
875 Ga0373942_0043207
876 Ga0373924_0040293
877 Ga0373931_0014744
878 Ga0373931_0026346
879 Ga0373931_0275847
880 Ga0373935_0010353
881 Ga0373935_0054109
882 Ga0373935_0110192
883 Ga0373935_0216453
884 Ga0373935_0271216
885 Ga0373935_0564943
886 Ga0373927_0029708
887 Ga0373927_0107761
888 Ga0373927_0110980
889 Ga0373927_0134797
890 Ga0373927_0144026
891 Ga0373927_0162121
892 Ga0373927_0166133
893 Ga0373927_0222055
894 Ga0373927_0491045
895 Ga0373927_0506841
896 Ga0373933_0039489
897 Ga0373933_0089116
898 Ga0373933_0148162
899 Ga0373947_0016115
900 Ga0373947_0030721
901 Ga0373947_0163613
902 Ga0373947_0222958
903 Ga0373947_0443041
904 Ga0373947_0732341
905 Ga0373947_0849929
906 Ga0373937_0002643
907 Ga0373937_0005774
908 Ga0373937_0006153
909 Ga0373937_0013955
910 Ga0373937_0027133
911 Ga0373937_0031949
912 Ga0373937_0038392
913 Ga0373937_0041880
914 Ga0373937_0370926
915 Ga0373937_0576702
916 Ga0373925_0060713
917 Ga0373925_0120635
918 Ga0373925_0152310
919 Ga0373925_0228508
920 Ga0373925_0234100
921 Ga0373925_0362693
922 Ga0373925_0454613
923 Ga0373925_0711331
924 Ga0373925_0749392
925 Ga0373925_0816962
926 Ga0436364_0683287
927 Ga0436365_0276230
928 Ga0436360_0114051
929 Ga0466972_0065454
930 Ga0466963_0589337
931 Ga0495592_0024361
932 Ga0495592_0074434
933 Ga0495592_0088969
934 Ga0495592_0116272
935 Ga0495592_0438290
936 Ga0495629_0114685
937 Ga0495629_0150604
938 Ga0495638_0471183
939 Ga0495651_0055996
940 Ga0495651_0363365
941 Ga0495651_0701725
942 Ga0495653_0001158
943 Ga0495653_0127662
944 Ga0495653_0208694
945 Ga0495653_0294479
946 Ga0495580_0062802
947 Ga0495580_0086035
948 Ga0495582_0002687
949 Ga0495639_0073134
950 Ga0495639_0104115
951 Ga0495639_0227539
952 Ga0495662_0165912
953 Ga0495664_0033595
954 Ga0495664_0034010
955 Ga0495664_0038674
956 Ga0495664_0088200
957 Ga0495664_0098868
958 Ga0495664_0150479
959 Ga0495585_0170871
960 Ga0495608_0052598
961 Ga0495608_0085417
962 Ga0495608_0160347
963 Ga0495618_0065088
964 Ga0495620_0081851
965 Ga0495628_0107746
966 Ga0495628_0122546
967 Ga0495630_0034159
968 Ga0495630_0230869
969 Ga0495630_0269108
970 Ga0495630_0375826
971 Ga0495630_0908227
972 Ga0495666_0002592
973 Ga0495652_0097638
974 Ga0495652_0217045
975 Ga0495640_0021432
976 Ga0495640_0083556
977 Ga0495640_0319876
978 Ga0495586_0058771
979 Ga0495586_0064415
980 Ga0495586_0127741
981 Ga0495586_0499818
982 Ga0495587_0006219
983 Ga0495587_0015985
984 Ga0495587_0056449
985 Ga0495587_0158530
986 Ga0495587_0323066
987 Ga0495587_0432218
988 Ga0495645_0001603
989 Ga0495645_0065206
990 Ga0495645_0087844
991 Ga0495645_0547308
992 Ga0495622_0083923
993 Ga0495633_0109789
994 Ga0495667_0026941
995 Ga0495667_0059670
996 Ga0495667_0066950
997 Ga0495667_0140792
998 Ga0495667_0148341
999 Ga0495667_0216782
1000 Ga0495656_0056520
1001 Ga0495656_0527372
1002 Ga0495634_0046600
1003 Ga0495634_0054601
1004 Ga0495635_0014645
1005 Ga0495635_0305783
1006 Ga0495635_0425740
1007 Ga0495657_0071259
1008 Ga0495657_0117614
1009 Ga0495657_0441428
1010 Ga0495657_0610983
1011 Ga0495599_0003833
1012 Ga0495599_0027110
1013 Ga0495599_0183885
1014 Ga0495623_0013717
1015 Ga0495623_0032412
1016 Ga0495623_0275296
1017 Ga0495646_0011073
1018 Ga0495646_0080832
1019 Ga0495646_0162653
1020 Ga0495646_0547439
1021 Ga0495647_0282515
1022 Ga0495658_0213633
1023 Ga0495658_0443410
1024 Ga0495613_0079298
1025 Ga0495613_0341573
1026 Ga0495624_0319671
1027 Ga0495671_0122107
1028 Ga0495589_0088571
1029 Ga0495600_0162312
1030 Ga0495600_0214327
1031 Ga0495660_0160529
1032 Ga0495581_0253858
1033 Ga0495604_0091792
1034 Ga0495604_0325046
1035 Ga0495604_0538629
1036 Ga0495674_0006348
1037 Ga0495674_0082848
1038 Ga0495674_0178439
1039 Ga0495674_0191161
1040 Ga0495674_0266769
1041 Ga0495674_0796754
1042 Ga0495676_0305134
1043 Ga0495680_0024106
1044 Ga0495680_0038563
1045 Ga0495680_0185738
1046 Ga0495680_0201437
1047 Ga0495675_0012058
1048 Ga0495675_0103321
1049 Ga0495675_0171292
1050 Ga0495675_0287780
1051 Ga0495685_132343
1052 Ga0495684_0070195
1053 Ga0495684_0111596
1054 Ga0495684_0190958
1055 Ga0495684_0197830
1056 Ga0495593_0073645
1057 Ga0495602_0004532
1058 Ga0495602_0099575
1059 Ga0495602_0244521
1060 Ga0495602_0275582
1061 Ga0495602_0309487
1062 Ga0495626_0173162
1063 Ga0496100_0020594
1064 Ga0496100_1030013
1065 Ga0496101_0036685
1066 Ga0496101_0076622
1067 Ga0496101_0139570
1068 Ga0496102_0006559
1069 Ga0496102_0071867
1070 Ga0496102_0085453
1071 Ga0496102_0392844
1072 Ga0496103_0008311
1073 Ga0496103_0051671
1074 Ga0496103_0270902
1075 Ga0496104_0024150
1076 Ga0496104_0029047
1077 Ga0496104_0066796
1078 Ga0496104_0119237
1079 Ga0496105_0016392
1080 Ga0496105_0045104
1081 Ga0496105_0054089
1082 Ga0496105_0807682
1083 Ga0496106_0004636
1084 Ga0496106_0042806
1085 Ga0496106_0043236
1086 Ga0496106_0103657
1087 Ga0496106_0130243
1088 Ga0496106_0261233
1089 Ga0496107_0017590
1090 Ga0496107_0051008
1091 Ga0496107_0074819
1092 Ga0496108_0037683
1093 Ga0496108_0193866
1094 Ga0496108_0360762
1095 Ga0496109_0020035
1096 Ga0496109_0032574
1097 Ga0496109_0075750
1098 Ga0496109_0141846
1099 Ga0496109_0223025
1100 Ga0496109_0739270
1101 Ga0496110_0033213
1102 Ga0496110_0058899
1103 Ga0496110_0069092
1104 Ga0496110_0200608
1105 Ga0496111_0015945
1106 Ga0496111_0034126
1107 Ga0496111_0084178
1108 Ga0496111_0744464
1109 Ga0496112_0000117
1110 Ga0496112_0021715
1111 Ga0496112_0033178
1112 Ga0496112_0064393
1113 Ga0496112_0122934
1114 Ga0496112_0126487
1115 Ga0496112_0135862
1116 Ga0496113_0013075
1117 Ga0496113_0014435
1118 Ga0496113_0057039
1119 Ga0496113_0111020
1120 Ga0496113_0249742
1121 Ga0496114_0038914
1122 Ga0496114_0084435
1123 Ga0496114_0107939
1124 Ga0496114_0131760
1125 Ga0496115_0035307
1126 Ga0496115_0063602
1127 Ga0496115_0867536
1128 Ga0496117_0004243
1129 Ga0496117_0172256
1130 Ga0496117_0327275
1131 Ga0496118_0003772
1132 Ga0496118_0006987
1133 Ga0496118_0268231
1134 Ga0496121_0000302
1135 Ga0496121_0003316
1136 Ga0496124_0003179
1137 Ga0496126_0000064
1138 Ga0496126_0016919
1139 Ga0501290_002082
1140 Ga0501292_000017
1141 Ga0501296_042930
1142 Ga0501300_000460
1143 Ga0501302_001443
1144 Ga0501032_0026834
1145 Ga0501034_0150319
1146 Ga0501037_0212437
1147 Ga0501038_0694232
1148 Ga0501039_0501662
1149 Ga0501040_0127185
1150 Ga0501041_0198612
1151 Ga0501042_0599027
1152 Ga0501047_0315482
1153 Ga0501073_0369771
1154 Ga0501074_0462287
1155 Ga0501075_0532268
1156 Ga0501079_0294106
1157 Ga0501079_1214693
1158 Ga0501080_0661054
1159 Ga0501081_0128362
1160 Ga0501081_0531898
1161 Ga0501279_000019
1162 Ga0501280_000837
1163 Ga0501283_000524
1164 Ga0501044_0071169
1165 Ga0501045_0138965
1166 nmdc:mga0yw44_247414_c1
1167 nmdc:mga0yw44_8587_c1
1168 nmdc:mga06z11_112704_c1
1169 nmdc:mga04h51_196521_c1
1170 nmdc:mga04h51_20957_c1
1171 nmdc:mga05p37_325052_c1
1172 nmdc:mga05p37_415188_c1
1173 nmdc:mga05p37_65807_c1
1174 nmdc:mga09592_250535_c1
1175 nmdc:mga06r32_942424_c1
1176 nmdc:mga08y16_38677_c1
1177 nmdc:mga08y16_76282_c1
1178 nmdc:mga0n895_739346_c1
1179 nmdc:mga0n895_813010_c1
1180 nmdc:mga0n895_84354_c1
1181 nmdc:mga0a205_275403_c1
1182 Ga0495601_0007248
1183 Ga0495601_0009347
1184 Ga0495601_0027025
1185 Ga0495601_0031204
1186 Ga0495601_0040817
1187 Ga0495601_0109698
1188 Ga0495612_0003568
1189 Ga0495612_0036886
1190 Ga0495612_0099180
1191 Ga0495655_0012873
1192 Ga0495595_0005643
1193 Ga0495595_0028862
1194 Ga0495595_0055220
1195 Ga0495595_0142703
1196 Ga0495595_0199316
1197 Ga0495619_0008745
1198 Ga0495619_0018321
1199 Ga0495619_0035609
1200 Ga0495619_0152867
1201 Ga0495619_0167122
1202 Ga0495619_0394951
1203 Ga0495619_0477666
1204 Ga0500647_0207050
1205 Ga0500566_0234467
1206 Ga0500566_0328591
1207 Ga0500595_014412
1208 Ga0500590_090338
1209 Ga0500603_034501
1210 Ga0500638_125575
1211 Ga0500636_0162331
1212 Ga0500637_0058616
1213 Ga0501084_0377910
1214 Ga0501084_0591397
1215 Ga0501082_0091419
1216 Ga0501082_0241972
1217 Ga0501082_0806086
1218 Ga0530510_0520052
1219 2513566160
1220 2935917004
1221 2935933011
1222 2935941679
1223 2935949985
1224 2935958473
1225 2935974561
1226 8003962305
1227 8016603822
1228 8055270532

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

106

210

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2opl-assembly1.cif.gz_A crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution 0.9453 11 188
2opl-assembly1.cif.gz_A crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution 0.9253 11 188
1ml8-assembly1.cif.gz_A-2 structural genomics 0.8784 40 178
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8584 38 178
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.8356 41 176
ID Description Score Start End Superfamily
2oplB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9228 12 177 3.30.300.20
2oplB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9071 12 177 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.901 87 178 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8661 87 178 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8512 87 177 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A0U3A1L4-F1-model_v4 OsmC-like protein 0.9866 45 190
AF-A0A1V8M0L4-F1-model_v4 Osmotically inducible protein C 0.9863 12 190
AF-A0A0D8CVT4-F1-model_v4 deleted 0.9834 12 190
AF-A0A544TKA7-F1-model_v4 OsmC family protein 0.9816 12 190
AF-A0A0U3A1L4-F1-model_v4 OsmC-like protein 0.98 45 190

Map