F469319

General Info

Members Datasets Scaffolds Average Seq Length
614 181 614 302

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10016522|JGI24739J22299_100165222
Length 310
Sequence VIQPIRIAILGFGKIADDQHVPSIAANPKFELAAVSSRSGQGPQPVFXDWREMIRKVEGLDAVAITTPPSPRYDIARECILADLHCLLEKPPTDGTSEIADLDILAQERGVTLFTTWHAQHHSTVDAAERALAGKRIRSMKILWHEDVHKWHPGQKWIWEPSGFGVFDPGINAFSIATKIFPGALLVRDATLSVPENAQTPIAAEINFYSPQAEGPLTASLDWRRSKDEEWTIELEATDGTKVRLEEGGAKLYLNGTLHSDEWSGEYPHIYERFADLIDDHRSHVDVAPLRLVADCLLAGRRRTVEPVTM

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.44
Rhizosphere 97.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001942 3300001979 Bacteria 9463
2 JGI24740J21852_10004163 3300001979 Bacteria 6247
3 JGI24739J22299_10000129 3300001989 Bacteria 23885
4 JGI24739J22299_10009892 3300001989 Bacteria 3545
5 JGI24739J22299_10016522 3300001989 Bacteria 2669
6 JGI24737J22298_10000357 3300001990 Bacteria 15471
7 JGI24737J22298_10001447 3300001990 Bacteria 8469
8 JGI24737J22298_10011049 3300001990 Bacteria 2965
9 JGI24743J22301_10029843 3300001991 Bacteria 1071
10 JGI24735J21928_10001481 3300002067 Bacteria 8303
11 JGI24735J21928_10016264 3300002067 Bacteria 2311
12 JGI24738J21930_10001003 3300002075 Bacteria 8082
13 JGI24738J21930_10001350 3300002075 Bacteria 6807
14 Ga0065715_10013144 3300005293 Bacteria 2124
15 Ga0065715_10164070 3300005293 Bacteria 1584
16 Ga0070658_10015513 3300005327 Bacteria 6093
17 Ga0070658_10017280 3300005327 Bacteria 5773
18 Ga0070658_10020535 3300005327 Bacteria 5294
19 Ga0070658_10026163 3300005327 Bacteria 4681
20 Ga0070658_10034179 3300005327 Bacteria 4091
21 Ga0070658_10041456 3300005327 Bacteria 3714
22 Ga0070658_10055508 3300005327 Bacteria 3218
23 Ga0070658_10082818 3300005327 Bacteria 2637
24 Ga0070658_10085845 3300005327 Bacteria 2589
25 Ga0070658_10127089 3300005327 Bacteria 2122
26 Ga0070658_10144101 3300005327 Bacteria 1991
27 Ga0070676_10044071 3300005328 Bacteria 2595
28 Ga0070676_10056188 3300005328 Bacteria 2325
29 Ga0070676_10113994 3300005328 Bacteria 1687
30 Ga0070683_100000209 3300005329 Bacteria 39666
31 Ga0070683_100012234 3300005329 Bacteria 7452
32 Ga0070683_100021530 3300005329 Bacteria 5754
33 Ga0070683_100176596 3300005329 Bacteria 2027
34 Ga0070683_100183184 3300005329 Bacteria 1988
35 Ga0070690_100084999 3300005330 Bacteria 2075
36 Ga0070670_100000333 3300005331 Bacteria 39598
37 Ga0070670_100055618 3300005331 Bacteria 3397
38 Ga0070670_100065288 3300005331 Bacteria 3123
39 Ga0070670_100085425 3300005331 Bacteria 2711
40 Ga0070670_100160396 3300005331 Unclassified 1949
41 Ga0070670_100256827 3300005331 Bacteria 1523
42 Ga0068869_100000331 3300005334 Bacteria 25170
43 Ga0068869_100031646 3300005334 Bacteria 3722
44 Ga0070666_10148053 3300005335 Bacteria 1637
45 Ga0070680_100000641 3300005336 Bacteria 24333
46 Ga0070680_100013601 3300005336 Bacteria 6343
47 Ga0070680_100019131 3300005336 Bacteria 5423
48 Ga0070680_100019684 3300005336 Bacteria 5353
49 Ga0070680_100202739 3300005336 Bacteria 1673
50 Ga0070682_100070358 3300005337 Bacteria 2237
51 Ga0068868_100000156 3300005338 Bacteria 44526
52 Ga0068868_100041958 3300005338 Bacteria 3567
53 Ga0068868_100086653 3300005338 Bacteria 2517
54 Ga0070660_100012339 3300005339 Bacteria 6099
55 Ga0070660_100015863 3300005339 Bacteria 5453
56 Ga0070660_100022785 3300005339 Bacteria 4637
57 Ga0070660_100024242 3300005339 Bacteria 4501
58 Ga0070660_100045807 3300005339 Bacteria 3350
59 Ga0070660_100090087 3300005339 Bacteria 2418
60 Ga0070660_100099785 3300005339 Bacteria 2299
61 Ga0070660_100123959 3300005339 Bacteria 2064
62 Ga0070660_100162116 3300005339 Bacteria 1802
63 Ga0070691_10061772 3300005341 Bacteria 1803
64 Ga0070661_100000452 3300005344 Bacteria 31380
65 Ga0070661_100034706 3300005344 Bacteria 3659
66 Ga0070661_100048731 3300005344 Bacteria 3101
67 Ga0070661_100105326 3300005344 Bacteria 2102
68 Ga0070661_100258589 3300005344 Bacteria 1345
69 Ga0070692_10004588 3300005345 Bacteria 5786
70 Ga0070668_100011926 3300005347 Bacteria 6471
71 Ga0070668_100064634 3300005347 Bacteria 2837
72 Ga0070669_100013436 3300005353 Bacteria 5821
73 Ga0070669_100047901 3300005353 Bacteria 3119
74 Ga0070669_100065902 3300005353 Bacteria 2668
75 Ga0070669_100362111 3300005353 Bacteria 1179
76 Ga0070675_100096026 3300005354 Bacteria 2490
77 Ga0070675_100112604 3300005354 Bacteria 2304
78 Ga0070675_100231664 3300005354 Bacteria 1611
79 Ga0070671_100000322 3300005355 Bacteria 32627
80 Ga0070671_100013820 3300005355 Bacteria 6514
81 Ga0070671_100014229 3300005355 Bacteria 6425
82 Ga0070671_100016892 3300005355 Bacteria 5904
83 Ga0070671_100082537 3300005355 Bacteria 2687
84 Ga0070671_100134244 3300005355 Bacteria 2086
85 Ga0070671_100178128 3300005355 Bacteria 1799
86 Ga0070674_100080729 3300005356 Bacteria 2323
87 Ga0070673_100000249 3300005364 Bacteria 27281
88 Ga0070673_100019257 3300005364 Bacteria 4899
89 Ga0070688_100357021 3300005365 Bacteria 1071
90 Ga0070659_100000138 3300005366 Bacteria 56073
91 Ga0070659_100000814 3300005366 Bacteria 22773
92 Ga0070659_100001062 3300005366 Bacteria 20090
93 Ga0070659_100012745 3300005366 Bacteria 6240
94 Ga0070659_100026588 3300005366 Bacteria 4454
95 Ga0070659_100040055 3300005366 Bacteria 3661
96 Ga0070659_100048437 3300005366 Bacteria 3339
97 Ga0070659_100068828 3300005366 Bacteria 2809
98 Ga0070659_100111632 3300005366 Bacteria 2207
99 Ga0070667_100001760 3300005367 Bacteria 19301
100 Ga0070667_100016912 3300005367 Bacteria 6035
101 Ga0070667_100017413 3300005367 Bacteria 5956
102 Ga0070667_100098802 3300005367 Bacteria 2519
103 Ga0070667_100104929 3300005367 Bacteria 2445
104 Ga0070667_100167251 3300005367 Bacteria 1940
105 Ga0070667_100282185 3300005367 Bacteria 1491
106 Ga0070714_100083992 3300005435 Bacteria 2778
107 Ga0070694_100001882 3300005444 Bacteria 12423
108 Ga0070663_100002205 3300005455 Bacteria 10897
109 Ga0070663_100006862 3300005455 Bacteria 6890
110 Ga0070663_100009792 3300005455 Bacteria 5953
111 Ga0070663_100018372 3300005455 Bacteria 4584
112 Ga0070663_100019500 3300005455 Bacteria 4471
113 Ga0070663_100019779 3300005455 Bacteria 4446
114 Ga0070663_100269651 3300005455 Bacteria 1353
115 Ga0070678_100405436 3300005456 Bacteria 1185
116 Ga0070662_100001575 3300005457 Bacteria 14101
117 Ga0070662_100005377 3300005457 Bacteria 8178
118 Ga0070662_100030731 3300005457 Bacteria 3762
119 Ga0070662_100054024 3300005457 Bacteria 2910
120 Ga0070662_100061029 3300005457 Bacteria 2751
121 Ga0070681_10011820 3300005458 Bacteria 8654
122 Ga0070681_10063525 3300005458 Bacteria 3664
123 Ga0070681_10536926 3300005458 Bacteria 1083
124 Ga0068867_100007188 3300005459 Bacteria 7869
125 Ga0068867_100045458 3300005459 Bacteria 3220
126 Ga0068867_100047518 3300005459 Bacteria 3155
127 Ga0070685_10047238 3300005466 Bacteria 2475
128 Ga0070679_100035261 3300005530 Bacteria 4963
129 Ga0070679_100048080 3300005530 Bacteria 4251
130 Ga0070679_100062428 3300005530 Bacteria 3714
131 Ga0070684_100004466 3300005535 Bacteria 10652
132 Ga0070684_100133800 3300005535 Bacteria 2238
133 Ga0068853_100001793 3300005539 Bacteria 15788
134 Ga0068853_100003189 3300005539 Bacteria 12522
135 Ga0068853_100011467 3300005539 Bacteria 7205
136 Ga0068853_100016758 3300005539 Bacteria 6036
137 Ga0068853_100020437 3300005539 Bacteria 5507
138 Ga0068853_100039204 3300005539 Bacteria 4040
139 Ga0068853_100063622 3300005539 Bacteria 3195
140 Ga0068853_100171217 3300005539 Bacteria 1964
141 Ga0070672_100004112 3300005543 Bacteria 9500
142 Ga0070672_100004771 3300005543 Bacteria 8896
143 Ga0070672_100064557 3300005543 Bacteria 2893
144 Ga0070672_100097141 3300005543 Bacteria 2384
145 Ga0070693_100000703 3300005547 Bacteria 14759
146 Ga0070665_100004771 3300005548 Bacteria 14114
147 Ga0070665_100005560 3300005548 Bacteria 12965
148 Ga0070665_100011456 3300005548 Bacteria 8964
149 Ga0070665_100014746 3300005548 Bacteria 7843
150 Ga0070665_100016127 3300005548 Bacteria 7497
151 Ga0070665_100039747 3300005548 Bacteria 4728
152 Ga0070665_100072607 3300005548 Bacteria 3448
153 Ga0070665_100082307 3300005548 Bacteria 3224
154 Ga0068855_100000163 3300005563 Bacteria 85587
155 Ga0068855_100035645 3300005563 Bacteria 5926
156 Ga0068855_100065480 3300005563 Bacteria 4236
157 Ga0068855_100106172 3300005563 Bacteria 3228
158 Ga0068855_100156356 3300005563 Bacteria 2590
159 Ga0068855_100366802 3300005563 Bacteria 1584
160 Ga0068855_100559336 3300005563 Bacteria 1237
161 Ga0070664_100000544 3300005564 Bacteria 28761
162 Ga0070664_100003024 3300005564 Bacteria 13598
163 Ga0070664_100009377 3300005564 Bacteria 7936
164 Ga0070664_100014998 3300005564 Bacteria 6325
165 Ga0070664_100028729 3300005564 Bacteria 4629
166 Ga0070664_100072997 3300005564 Bacteria 2943
167 Ga0068857_100000282 3300005577 Bacteria 34844
168 Ga0068857_100006203 3300005577 Bacteria 10222
169 Ga0068857_100017928 3300005577 Bacteria 6209
170 Ga0068857_100023660 3300005577 Bacteria 5408
171 Ga0068857_100059364 3300005577 Bacteria 3398
172 Ga0068857_100102460 3300005577 Bacteria 2569
173 Ga0068857_100149693 3300005577 Bacteria 2114
174 Ga0068857_100186676 3300005577 Bacteria 1888
175 Ga0068854_100001188 3300005578 Bacteria 15628
176 Ga0068854_100005135 3300005578 Bacteria 8253
177 Ga0068854_100006117 3300005578 Bacteria 7636
178 Ga0068854_100012275 3300005578 Bacteria 5607
179 Ga0068854_100012524 3300005578 Bacteria 5558
180 Ga0068854_100031043 3300005578 Bacteria 3710
181 Ga0068854_100047019 3300005578 Bacteria 3075
182 Ga0068854_100179859 3300005578 Bacteria 1651
183 Ga0068856_100000829 3300005614 Bacteria 33313
184 Ga0068856_100008781 3300005614 Bacteria 9830
185 Ga0068856_100009193 3300005614 Bacteria 9608
186 Ga0068856_100054656 3300005614 Bacteria 3939
187 Ga0068852_100003260 3300005616 Bacteria 11333
188 Ga0068852_100004156 3300005616 Bacteria 10199
189 Ga0068852_100010367 3300005616 Bacteria 6961
190 Ga0068852_100013907 3300005616 Bacteria 6172
191 Ga0068852_100018232 3300005616 Bacteria 5527
192 Ga0068852_100033435 3300005616 Bacteria 4269
193 Ga0068852_100051622 3300005616 Bacteria 3530
194 Ga0068852_100083384 3300005616 Bacteria 2842
195 Ga0068852_100364541 3300005616 Bacteria 1414
196 Ga0068859_100000778 3300005617 Bacteria 32222
197 Ga0068859_100065652 3300005617 Bacteria 3662
198 Ga0068859_100231931 3300005617 Bacteria 1934
199 Ga0068864_100006905 3300005618 Bacteria 9309
200 Ga0068864_100032252 3300005618 Bacteria 4450
201 Ga0068864_100091493 3300005618 Bacteria 2684
202 Ga0068861_100302407 3300005719 Bacteria 1386
203 Ga0068851_10003637 3300005834 Bacteria 6881
204 Ga0068851_10012800 3300005834 Bacteria 3963
205 Ga0068851_10013684 3300005834 Bacteria 3841
206 Ga0068851_10033306 3300005834 Bacteria 2568
207 Ga0068851_10123421 3300005834 Bacteria 1394
208 Ga0068863_100003770 3300005841 Bacteria 14990
209 Ga0068863_100014935 3300005841 Bacteria 7459
210 Ga0068863_100097788 3300005841 Bacteria 2788
211 Ga0068863_100125321 3300005841 Bacteria 2450
212 Ga0068858_100025779 3300005842 Bacteria 5469
213 Ga0068858_100041345 3300005842 Bacteria 4275
214 Ga0068858_100061421 3300005842 Bacteria 3474
215 Ga0068858_100192228 3300005842 Bacteria 1928
216 Ga0068860_100001686 3300005843 Bacteria 23599
217 Ga0068860_100016439 3300005843 Bacteria 7214
218 Ga0068860_100115760 3300005843 Bacteria 2564
219 Ga0068862_100003296 3300005844 Bacteria 13962
220 Ga0068862_100028968 3300005844 Bacteria 4665
221 Ga0068862_100084683 3300005844 Bacteria 2755
222 Ga0068862_100101303 3300005844 Bacteria 2519
223 Ga0068862_100205961 3300005844 Bacteria 1775
224 Ga0097621_100248444 3300006237 Bacteria 1557
225 Ga0068871_100034709 3300006358 Bacteria 4004
226 Ga0068871_100275624 3300006358 Bacteria 1470
227 Ga0075433_10042385 3300006852 Bacteria 3948
228 Ga0075434_100493188 3300006871 Bacteria 1246
229 Ga0068865_100003247 3300006881 Bacteria 9738
230 Ga0097620_100000778 3300006931 Bacteria 32222
231 Ga0097620_100065654 3300006931 Bacteria 3662
232 Ga0097620_100231940 3300006931 Bacteria 1934
233 Ga0105240_10020736 3300009093 Bacteria 8756
234 Ga0105240_10020959 3300009093 Bacteria 8701
235 Ga0105240_10076614 3300009093 Bacteria 4122
236 Ga0105240_10117149 3300009093 Bacteria 3212
237 Ga0105240_10213278 3300009093 Bacteria 2254
238 Ga0105240_10451278 3300009093 Unclassified 1439
239 Ga0105245_10000326 3300009098 Bacteria 44899
240 Ga0105243_10073888 3300009148 Bacteria 2764
241 Ga0105243_10327085 3300009148 Bacteria 1399
242 Ga0105248_10000159 3300009177 Bacteria 78504
243 Ga0105248_10001489 3300009177 Bacteria 26067
244 Ga0105248_10002100 3300009177 Bacteria 22075
245 Ga0105248_10005569 3300009177 Bacteria 13842
246 Ga0105248_10028455 3300009177 Bacteria 6225
247 Ga0105248_10100588 3300009177 Bacteria 3258
248 Ga0105248_10181321 3300009177 Bacteria 2373
249 Ga0105248_10288955 3300009177 Bacteria 1846
250 Ga0105237_10010341 3300009545 Bacteria 9936
251 Ga0105237_10014626 3300009545 Bacteria 8197
252 Ga0105238_10015768 3300009551 Bacteria 7650
253 Ga0105238_10037553 3300009551 Bacteria 4923
254 Ga0105238_10879745 3300009551 Bacteria 914
255 Ga0105239_10290316 3300010375 Bacteria 1842
256 Ga0105239_10341130 3300010375 Bacteria 1691
257 Ga0105246_10027780 3300011119 Bacteria 3712
258 Ga0105246_10037164 3300011119 Bacteria 3267
259 Ga0157373_10008452 3300013100 Bacteria 7644
260 Ga0157373_10016885 3300013100 Bacteria 5323
261 Ga0157373_10018178 3300013100 Bacteria 5120
262 Ga0157373_10029984 3300013100 Bacteria 3915
263 Ga0157373_10105922 3300013100 Bacteria 1977
264 Ga0157371_10000784 3300013102 Bacteria 36573
265 Ga0157371_10018899 3300013102 Bacteria 5090
266 Ga0157371_10019495 3300013102 Bacteria 5002
267 Ga0157371_10026498 3300013102 Bacteria 4213
268 Ga0157371_10034504 3300013102 Bacteria 3628
269 Ga0157371_10037050 3300013102 Bacteria 3493
270 Ga0157370_10016872 3300013104 Bacteria 7381
271 Ga0157370_10040402 3300013104 Bacteria 4504
272 Ga0157370_10047042 3300013104 Bacteria 4136
273 Ga0157370_10051983 3300013104 Bacteria 3912
274 Ga0157369_10018890 3300013105 Bacteria 7724
275 Ga0157369_10033440 3300013105 Bacteria 5651
276 Ga0157369_10063148 3300013105 Bacteria 3991
277 Ga0157369_10067142 3300013105 Bacteria 3857
278 Ga0157369_10077710 3300013105 Bacteria 3557
279 Ga0157374_10080450 3300013296 Bacteria 3090
280 Ga0163162_10032032 3300013306 Bacteria 5218
281 Ga0163162_10256575 3300013306 Bacteria 1880
282 Ga0163162_10530305 3300013306 Bacteria 1307
283 Ga0157372_10007786 3300013307 Bacteria 11380
284 Ga0157372_10008989 3300013307 Bacteria 10620
285 Ga0157372_10135004 3300013307 Bacteria 2841
286 Ga0157372_10200313 3300013307 Bacteria 2312
287 Ga0157372_10375236 3300013307 Bacteria 1657
288 Ga0157372_10400669 3300013307 Unclassified 1599
289 Ga0157375_10066623 3300013308 Bacteria 3596
290 Ga0157375_10252211 3300013308 Bacteria 1925
291 Ga0163163_10000338 3300014325 Bacteria 45226
292 Ga0157377_10011474 3300014745 Bacteria 4424
293 Ga0157377_10031247 3300014745 Bacteria 2892
294 Ga0157379_10049930 3300014968 Bacteria 3735
295 Ga0157379_10174679 3300014968 Bacteria 1939
296 Ga0207697_10000584 3300025315 Bacteria 20797
297 Ga0207697_10015235 3300025315 Bacteria 3178
298 Ga0207656_10011341 3300025321 Bacteria 3366
299 Ga0207656_10054052 3300025321 Bacteria 1744
300 Ga0207656_10060834 3300025321 Bacteria 1656
301 Ga0207688_10004411 3300025901 Bacteria 7657
302 Ga0207680_10089196 3300025903 Bacteria 1957
303 Ga0207647_10000575 3300025904 Bacteria 28658
304 Ga0207647_10002145 3300025904 Bacteria 15075
305 Ga0207647_10002864 3300025904 Bacteria 12995
306 Ga0207647_10048512 3300025904 Bacteria 2636
307 Ga0207645_10001233 3300025907 Bacteria 21061
308 Ga0207645_10016623 3300025907 Bacteria 4867
309 Ga0207645_10127403 3300025907 Bacteria 1655
310 Ga0207705_10000260 3300025909 Bacteria 51366
311 Ga0207705_10011481 3300025909 Bacteria 6406
312 Ga0207705_10028624 3300025909 Bacteria 3971
313 Ga0207705_10058153 3300025909 Bacteria 2789
314 Ga0207705_10075537 3300025909 Bacteria 2448
315 Ga0207705_10091117 3300025909 Bacteria 2233
316 Ga0207705_10110629 3300025909 Bacteria 2029
317 Ga0207705_10188285 3300025909 Bacteria 1559
318 Ga0207705_10261340 3300025909 Bacteria 1322
319 Ga0207654_10044761 3300025911 Bacteria 2515
320 Ga0207654_10179262 3300025911 Bacteria 1381
321 Ga0207695_10030232 3300025913 Bacteria 5966
322 Ga0207695_10045302 3300025913 Bacteria 4670
323 Ga0207695_10098076 3300025913 Bacteria 2930
324 Ga0207695_10374386 3300025913 Unclassified 1310
325 Ga0207695_10379682 3300025913 Bacteria 1299
326 Ga0207660_10001336 3300025917 Bacteria 16498
327 Ga0207660_10007267 3300025917 Bacteria 7167
328 Ga0207660_10024318 3300025917 Bacteria 4101
329 Ga0207660_10047363 3300025917 Bacteria 3039
330 Ga0207657_10000031 3300025919 Bacteria 132167
331 Ga0207657_10009316 3300025919 Bacteria 9888
332 Ga0207657_10009915 3300025919 Bacteria 9533
333 Ga0207657_10018812 3300025919 Bacteria 6578
334 Ga0207657_10020134 3300025919 Bacteria 6313
335 Ga0207657_10024861 3300025919 Bacteria 5536
336 Ga0207657_10033201 3300025919 Bacteria 4654
337 Ga0207657_10048214 3300025919 Bacteria 3720
338 Ga0207657_10054956 3300025919 Bacteria 3441
339 Ga0207657_10068067 3300025919 Bacteria 3026
340 Ga0207657_10166895 3300025919 Bacteria 1785
341 Ga0207657_10249157 3300025919 Bacteria 1416
342 Ga0207649_10000394 3300025920 Bacteria 32788
343 Ga0207649_10045738 3300025920 Bacteria 2685
344 Ga0207649_10113254 3300025920 Bacteria 1817
345 Ga0207649_10125389 3300025920 Bacteria 1737
346 Ga0207652_10186861 3300025921 Bacteria 1863
347 Ga0207652_10216234 3300025921 Bacteria 1726
348 Ga0207681_10001333 3300025923 Bacteria 15917
349 Ga0207681_10096305 3300025923 Bacteria 2124
350 Ga0207694_10000526 3300025924 Bacteria 34586
351 Ga0207694_10003458 3300025924 Bacteria 12548
352 Ga0207650_10061475 3300025925 Bacteria 2805
353 Ga0207650_10147841 3300025925 Unclassified 1852
354 Ga0207650_10412426 3300025925 Bacteria 1120
355 Ga0207687_10007615 3300025927 Bacteria 7120
356 Ga0207644_10000941 3300025931 Bacteria 18539
357 Ga0207644_10000954 3300025931 Bacteria 18456
358 Ga0207644_10014636 3300025931 Bacteria 5254
359 Ga0207690_10000382 3300025932 Bacteria 29300
360 Ga0207690_10003206 3300025932 Bacteria 9816
361 Ga0207690_10046076 3300025932 Bacteria 2886
362 Ga0207690_10054025 3300025932 Bacteria 2698
363 Ga0207690_10054634 3300025932 Bacteria 2686
364 Ga0207690_10345503 3300025932 Bacteria 1175
365 Ga0207706_10000028 3300025933 Bacteria 149092
366 Ga0207706_10000171 3300025933 Bacteria 72122
367 Ga0207706_10005399 3300025933 Bacteria 11913
368 Ga0207706_10022887 3300025933 Bacteria 5608
369 Ga0207706_10037286 3300025933 Bacteria 4317
370 Ga0207706_10072220 3300025933 Bacteria 3035
371 Ga0207709_10103546 3300025935 Bacteria 1887
372 Ga0207670_10032192 3300025936 Bacteria 3370
373 Ga0207704_10006692 3300025938 Bacteria 5398
374 Ga0207691_10001864 3300025940 Bacteria 20610
375 Ga0207691_10045452 3300025940 Bacteria 4036
376 Ga0207691_10074323 3300025940 Bacteria 3066
377 Ga0207711_10001375 3300025941 Bacteria 22908
378 Ga0207711_10005966 3300025941 Bacteria 10298
379 Ga0207711_10027623 3300025941 Bacteria 4768
380 Ga0207711_10030857 3300025941 Bacteria 4522
381 Ga0207711_10039426 3300025941 Bacteria 4018
382 Ga0207711_10125412 3300025941 Bacteria 2296
383 Ga0207689_10000092 3300025942 Bacteria 73254
384 Ga0207689_10083550 3300025942 Bacteria 2625
385 Ga0207661_10003597 3300025944 Bacteria 10780
386 Ga0207661_10212496 3300025944 Bacteria 1706
387 Ga0207679_10000129 3300025945 Bacteria 61477
388 Ga0207679_10002034 3300025945 Bacteria 12542
389 Ga0207679_10017763 3300025945 Bacteria 4752
390 Ga0207679_10032098 3300025945 Bacteria 3683
391 Ga0207667_10000357 3300025949 Bacteria 62034
392 Ga0207667_10025870 3300025949 Bacteria 6420
393 Ga0207667_10047594 3300025949 Bacteria 4538
394 Ga0207667_10053034 3300025949 Bacteria 4268
395 Ga0207667_10056916 3300025949 Bacteria 4105
396 Ga0207667_10143983 3300025949 Bacteria 2454
397 Ga0207667_10153757 3300025949 Bacteria 2367
398 Ga0207667_10167848 3300025949 Bacteria 2256
399 Ga0207667_10326287 3300025949 Bacteria 1567
400 Ga0207651_10000176 3300025960 Bacteria 27858
401 Ga0207651_10026221 3300025960 Bacteria 3636
402 Ga0207651_10203266 3300025960 Bacteria 1589
403 Ga0207712_10000269 3300025961 Bacteria 50416
404 Ga0207668_10000080 3300025972 Bacteria 72198
405 Ga0207668_10116835 3300025972 Bacteria 2012
406 Ga0207640_10000922 3300025981 Bacteria 16485
407 Ga0207640_10001385 3300025981 Bacteria 13123
408 Ga0207640_10008786 3300025981 Bacteria 5622
409 Ga0207640_10128026 3300025981 Bacteria 1831
410 Ga0207640_10172026 3300025981 Unclassified 1615
411 Ga0207658_10006798 3300025986 Bacteria 7792
412 Ga0207658_10036095 3300025986 Bacteria 3543
413 Ga0207658_10060055 3300025986 Bacteria 2835
414 Ga0207658_10087251 3300025986 Bacteria 2409
415 Ga0207658_10117234 3300025986 Bacteria 2116
416 Ga0207677_10057650 3300026023 Bacteria 2668
417 Ga0207677_10248911 3300026023 Bacteria 1442
418 Ga0207703_10009105 3300026035 Bacteria 7817
419 Ga0207703_10046172 3300026035 Bacteria 3507
420 Ga0207703_10066349 3300026035 Bacteria 2969
421 Ga0207639_10000131 3300026041 Bacteria 54681
422 Ga0207639_10000608 3300026041 Bacteria 24669
423 Ga0207639_10003016 3300026041 Bacteria 11334
424 Ga0207639_10028417 3300026041 Bacteria 4083
425 Ga0207639_10156966 3300026041 Bacteria 1912
426 Ga0207639_10179217 3300026041 Bacteria 1801
427 Ga0207678_10000198 3300026067 Bacteria 52573
428 Ga0207678_10001415 3300026067 Bacteria 21990
429 Ga0207678_10017221 3300026067 Bacteria 6344
430 Ga0207678_10019267 3300026067 Bacteria 5992
431 Ga0207678_10025287 3300026067 Bacteria 5183
432 Ga0207678_10027353 3300026067 Bacteria 4974
433 Ga0207678_10114561 3300026067 Bacteria 2300
434 Ga0207702_10000247 3300026078 Bacteria 62873
435 Ga0207702_10044203 3300026078 Bacteria 3743
436 Ga0207702_10046137 3300026078 Bacteria 3667
437 Ga0207702_10377081 3300026078 Bacteria 1363
438 Ga0207702_10411854 3300026078 Bacteria 1305
439 Ga0207641_10046546 3300026088 Bacteria 3656
440 Ga0207641_10118141 3300026088 Bacteria 2362
441 Ga0207641_10152950 3300026088 Bacteria 2091
442 Ga0207648_10008297 3300026089 Bacteria 10086
443 Ga0207648_10008887 3300026089 Bacteria 9672
444 Ga0207648_10017502 3300026089 Bacteria 6518
445 Ga0207676_10004385 3300026095 Bacteria 9979
446 Ga0207676_10269919 3300026095 Bacteria 1540
447 Ga0207676_10297382 3300026095 Unclassified 1472
448 Ga0207674_10010569 3300026116 Bacteria 10444
449 Ga0207674_10014969 3300026116 Bacteria 8544
450 Ga0207674_10016447 3300026116 Bacteria 8097
451 Ga0207674_10018937 3300026116 Bacteria 7464
452 Ga0207674_10020590 3300026116 Bacteria 7122
453 Ga0207674_10053575 3300026116 Bacteria 4111
454 Ga0207674_10064490 3300026116 Bacteria 3695
455 Ga0207674_10064900 3300026116 Bacteria 3682
456 Ga0207674_10068894 3300026116 Bacteria 3559
457 Ga0207674_10160076 3300026116 Bacteria 2206
458 Ga0207674_10297793 3300026116 Bacteria 1562
459 Ga0207675_100378306 3300026118 Bacteria 1392
460 Ga0207698_10001888 3300026142 Bacteria 12271
461 Ga0207698_10006575 3300026142 Bacteria 7267
462 Ga0207698_10014500 3300026142 Bacteria 5242
463 Ga0207698_10030984 3300026142 Bacteria 3855
464 Ga0207698_10108543 3300026142 Bacteria 2320
465 Ga0268266_10000433 3300028379 Bacteria 62887
466 Ga0268266_10010715 3300028379 Bacteria 7988
467 Ga0268266_10026216 3300028379 Bacteria 4959
468 Ga0268266_10040393 3300028379 Bacteria 3976
469 Ga0268266_10052988 3300028379 Bacteria 3485
470 Ga0268266_10078633 3300028379 Bacteria 2870
471 Ga0268266_10162543 3300028379 Bacteria 2021
472 Ga0268265_10002770 3300028380 Bacteria 12931
473 Ga0268265_10026121 3300028380 Bacteria 4152
474 Ga0268265_10073709 3300028380 Bacteria 2667
475 Ga0268265_10156824 3300028380 Bacteria 1927
476 Ga0268265_10182676 3300028380 Bacteria 1803
477 Ga0268264_10000567 3300028381 Bacteria 45270
478 Ga0268264_10003351 3300028381 Bacteria 13846
479 Ga0268264_10005259 3300028381 Bacteria 10956
480 Ga0268264_10143383 3300028381 Bacteria 2133
481 Ga0307410_10003819 3300031852 Bacteria 7656
482 Ga0307410_10262960 3300031852 Bacteria 1346
483 Ga0307406_10018726 3300031901 Bacteria 4050
484 Ga0307407_10004615 3300031903 Bacteria 5877
485 Ga0307412_10067038 3300031911 Bacteria 2435
486 Ga0307409_100002843 3300031995 Bacteria 9157
487 Ga0307409_100028700 3300031995 Bacteria 3969
488 Ga0307409_100090561 3300031995 Bacteria 2504
489 Ga0307409_100152813 3300031995 Bacteria 2007
490 Ga0307416_100043719 3300032002 Bacteria 3510
491 Ga0307414_10015027 3300032004 Bacteria 4663
492 Ga0307414_10044338 3300032004 Bacteria 3036
493 Ga0307411_10011439 3300032005 Bacteria 4790
494 Ga0307411_10011531 3300032005 Bacteria 4777
495 Ga0307411_10122113 3300032005 Bacteria 1887
496 Ga0307415_100017152 3300032126 Bacteria 4335
497 Ga0307415_100018950 3300032126 Bacteria 4168
498 Ga0373928_0026956 3300035084 Bacteria 1248
499 Ga0373934_0080594 3300035086 Bacteria 1308
500 Ga0373949_0034273 3300035090 Bacteria 1223
501 Ga0373954_0013710 3300035118 Bacteria 3612
502 Ga0373960_0003919 3300035121 Bacteria 3393
503 Ga0373943_0003195 3300035170 Bacteria 7432
504 Ga0373955_0017242 3300035172 Bacteria 3570
505 Ga0373933_0117916 3300035724 Bacteria 1660
506 Ga0373937_0004086 3300036401 Bacteria 12375
507 Ga0395899_0004324 3300037312 Bacteria 11091
508 Ga0395899_0012008 3300037312 Bacteria 6636
509 Ga0395899_0015712 3300037312 Bacteria 5772
510 Ga0395899_0017880 3300037312 Bacteria 5396
511 Ga0395899_0019845 3300037312 Bacteria 5100
512 Ga0395899_0052302 3300037312 Bacteria 3028
513 Ga0395899_0083237 3300037312 Bacteria 2327
514 Ga0395899_0101568 3300037312 Bacteria 2075
515 Ga0395899_0113890 3300037312 Bacteria 1942
516 Ga0395899_0227087 3300037312 Bacteria 1291
517 Ga0395900_0008912 3300037418 Bacteria 10293
518 Ga0395900_0016439 3300037418 Bacteria 7544
519 Ga0395900_0020464 3300037418 Bacteria 6754
520 Ga0395900_0023784 3300037418 Bacteria 6268
521 Ga0395900_0032306 3300037418 Bacteria 5381
522 Ga0395900_0051071 3300037418 Bacteria 4259
523 Ga0395900_0073975 3300037418 Bacteria 3503
524 Ga0395900_0147255 3300037418 Bacteria 2407
525 Ga0395900_0207884 3300037418 Bacteria 1977
526 Ga0395900_0259880 3300037418 Bacteria 1735
527 Ga0395900_0647020 3300037418 Bacteria 994
528 Ga0395898_0013212 3300037466 Bacteria 8506
529 Ga0395898_0045666 3300037466 Bacteria 4305
530 Ga0395898_0086695 3300037466 Bacteria 3017
531 Ga0395898_0107895 3300037466 Bacteria 2670
532 Ga0395898_0113668 3300037466 Bacteria 2594
533 Ga0395898_0171290 3300037466 Bacteria 2075
534 Ga0395898_0217232 3300037466 Bacteria 1824
535 Ga0395905_0000104 3300037471 Bacteria 141965
536 Ga0395905_0000974 3300037471 Bacteria 36725
537 Ga0395905_0010192 3300037471 Bacteria 9158
538 Ga0395905_0011956 3300037471 Bacteria 8368
539 Ga0395905_0037894 3300037471 Bacteria 4524
540 Ga0395905_0044957 3300037471 Bacteria 4142
541 Ga0395905_0070723 3300037471 Bacteria 3270
542 Ga0395905_0106127 3300037471 Bacteria 2638
543 Ga0395905_0126104 3300037471 Bacteria 2407
544 Ga0395905_0165732 3300037471 Bacteria 2076
545 Ga0395905_0272820 3300037471 Bacteria 1577
546 Ga0395905_0286183 3300037471 Bacteria 1535
547 Ga0395905_0305990 3300037471 Bacteria 1477
548 Ga0395905_0585597 3300037471 Bacteria 1017
549 Ga0395901_0000276 3300038443 Bacteria 63580
550 Ga0395901_0010013 3300038443 Bacteria 9610
551 Ga0395901_0028542 3300038443 Bacteria 5738
552 Ga0395901_0043484 3300038443 Bacteria 4660
553 Ga0395901_0102924 3300038443 Bacteria 2996
554 Ga0395901_0130050 3300038443 Bacteria 2645
555 Ga0395901_0165053 3300038443 Bacteria 2325
556 Ga0395901_0295097 3300038443 Bacteria 1681
557 Ga0439464_0005747 3300042439 Bacteria 3217
558 Ga0466966_0030220 3300044684 Bacteria 3518
559 Ga0466966_0213391 3300044684 Bacteria 1166
560 Ga0466966_0215016 3300044684 Bacteria 1161
561 Ga0466961_0007560 3300044693 Bacteria 6917
562 Ga0466961_0115074 3300044693 Bacteria 1690
563 Ga0466963_0000971 3300044694 Bacteria 14730
564 Ga0466963_0009670 3300044694 Bacteria 5813
565 Ga0466963_0014808 3300044694 Bacteria 4816
566 Ga0466963_0015010 3300044694 Bacteria 4787
567 Ga0466963_0031383 3300044694 Bacteria 3435
568 Ga0466963_0070932 3300044694 Bacteria 2344
569 Ga0466963_0092802 3300044694 Bacteria 2057
570 Ga0466963_0214913 3300044694 Bacteria 1346
571 Ga0466964_0102420 3300044706 Bacteria 1264
572 Ga0466971_0093278 3300044719 Bacteria 1379
573 Ga0466957_0002813 3300044842 Bacteria 9412
574 Ga0466957_0011404 3300044842 Bacteria 5128
575 Ga0466957_0184479 3300044842 Bacteria 1364
576 Ga0466959_0078525 3300045049 Bacteria 2380
577 Ga0466959_0204287 3300045049 Bacteria 1375
578 Ga0466967_0000483 3300045976 Bacteria 19324
579 Ga0466967_0002578 3300045976 Bacteria 11378
580 Ga0466967_0005574 3300045976 Bacteria 8749
581 Ga0466967_0021495 3300045976 Bacteria 5243
582 Ga0466967_0023653 3300045976 Bacteria 5039
583 Ga0466967_0052339 3300045976 Bacteria 3583
584 Ga0466967_0089806 3300045976 Bacteria 2790
585 Ga0466967_0154388 3300045976 Bacteria 2149
586 Ga0466967_0367706 3300045976 Bacteria 1394
587 Ga0495585_0094446 3300046492 Bacteria 1607
588 Ga0495668_0009438 3300046616 Bacteria 5994
589 Ga0495669_0041904 3300046684 Bacteria 2034
590 Ga0495669_0059759 3300046684 Bacteria 1722
591 Ga0495669_0092321 3300046684 Bacteria 1399
592 Ga0495669_0107845 3300046684 Unclassified 1298
593 Ga0495677_0022636 3300047445 Bacteria 2280
594 Ga0495602_0051913 3300048088 Bacteria 3647
595 Ga0496101_0368104 3300048904 Bacteria 1130
596 Ga0496104_0441116 3300048907 Bacteria 1214
597 Ga0496106_0090688 3300048909 Bacteria 2359
598 Ga0496107_0132781 3300048910 Bacteria 1838
599 Ga0496108_0217863 3300048911 Bacteria 1658
600 Ga0496109_0158233 3300048912 Bacteria 2122
601 Ga0496110_0023530 3300048913 Bacteria 5241
602 Ga0496110_0038404 3300048913 Bacteria 4166
603 Ga0496110_0119677 3300048913 Bacteria 2372
604 Ga0496110_0394851 3300048913 Bacteria 1261
605 Ga0496111_0009804 3300048914 Bacteria 6402
606 Ga0496112_0004292 3300048915 Bacteria 12040
607 Ga0496112_0018585 3300048915 Bacteria 6549
608 Ga0496113_0002271 3300048916 Bacteria 11088
609 Ga0496113_0049274 3300048916 Bacteria 3136
610 Ga0501070_0044033 3300049586 Bacteria 3714
611 nmdc:mga09592_248854_c1 3300050508 Bacteria 1540
612 Ga0466962_0003571 3300061719 Bacteria 7408
613 Ga0466962_0008051 3300061719 Bacteria 5053
614 Ga0466962_0031717 3300061719 Bacteria 2530

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10879745 Ga0105238_108797452 236
2 3300025923 Ga0207681_10001333 Ga0207681_1000133312 263
3 3300005339 Ga0070660_100162116 Ga0070660_1001621162 280
4 3300005455 Ga0070663_100269651 Ga0070663_1002696511 280
5 3300005616 Ga0068852_100083384 Ga0068852_1000833843 280
6 3300025919 Ga0207657_10054956 Ga0207657_100549564 280
7 3300037418 Ga0395900_0259880 Ga0395900_0259880_150_1082 280
8 3300026035 Ga0207703_10066349 Ga0207703_100663494 286
9 3300031995 Ga0307409_100028700 Ga0307409_1000287005 291
10 3300005328 Ga0070676_10113994 Ga0070676_101139942 294
11 3300014745 Ga0157377_10031247 Ga0157377_100312471 294
12 3300037418 Ga0395900_0647020 Ga0395900_0647020_38_958 294
13 3300005327 Ga0070658_10144101 Ga0070658_101441012 295
14 3300005331 Ga0070670_100085425 Ga0070670_1000854252 295
15 3300005337 Ga0070682_100070358 Ga0070682_1000703583 295
16 3300005339 Ga0070660_100090087 Ga0070660_1000900871 295
17 3300005344 Ga0070661_100105326 Ga0070661_1001053261 295
18 3300005455 Ga0070663_100006862 Ga0070663_1000068626 295
19 3300005539 Ga0068853_100171217 Ga0068853_1001712173 295
20 3300005564 Ga0070664_100003024 Ga0070664_1000030245 295
21 3300005578 Ga0068854_100031043 Ga0068854_1000310435 295
22 3300005616 Ga0068852_100033435 Ga0068852_1000334354 295
23 3300005834 Ga0068851_10003637 Ga0068851_100036375 295
24 3300009177 Ga0105248_10288955 Ga0105248_102889552 295
25 3300025321 Ga0207656_10054052 Ga0207656_100540521 295
26 3300025909 Ga0207705_10011481 Ga0207705_100114816 295
27 3300025919 Ga0207657_10009316 Ga0207657_100093165 295
28 3300025920 Ga0207649_10045738 Ga0207649_100457383 295
29 3300025925 Ga0207650_10061475 Ga0207650_100614753 295
30 3300025932 Ga0207690_10054634 Ga0207690_100546342 295
31 3300025945 Ga0207679_10002034 Ga0207679_1000203411 295
32 3300025981 Ga0207640_10128026 Ga0207640_101280262 295
33 3300026067 Ga0207678_10001415 Ga0207678_1000141523 295
34 3300044694 Ga0466963_0070932 Ga0466963_0070932_37_960 295
35 3300005344 Ga0070661_100258589 Ga0070661_1002585892 296
36 3300025949 Ga0207667_10153757 Ga0207667_101537572 296
37 3300037312 Ga0395899_0113890 Ga0395899_0113890_604_1530 296
38 3300037418 Ga0395900_0051071 Ga0395900_0051071_2153_3079 296
39 3300037471 Ga0395905_0070723 Ga0395905_0070723_229_1155 296
40 3300038443 Ga0395901_0295097 Ga0395901_0295097_155_1081 296
41 3300042439 Ga0439464_0005747 Ga0439464_0005747_1487_2422 296
42 3300001979 JGI24740J21852_10001942 JGI24740J21852_100019429 297
43 3300001979 JGI24740J21852_10004163 JGI24740J21852_100041634 297
44 3300001989 JGI24739J22299_10000129 JGI24739J22299_1000012910 297
45 3300001989 JGI24739J22299_10009892 JGI24739J22299_100098922 297
46 3300001989 JGI24739J22299_10016522 JGI24739J22299_100165222 297
47 3300001990 JGI24737J22298_10000357 JGI24737J22298_100003579 297
48 3300001990 JGI24737J22298_10001447 JGI24737J22298_100014474 297
49 3300001990 JGI24737J22298_10011049 JGI24737J22298_100110492 297
50 3300001991 JGI24743J22301_10029843 JGI24743J22301_100298431 297
51 3300002067 JGI24735J21928_10001481 JGI24735J21928_100014811 297
52 3300002067 JGI24735J21928_10016264 JGI24735J21928_100162641 297
53 3300002075 JGI24738J21930_10001003 JGI24738J21930_100010032 297
54 3300002075 JGI24738J21930_10001350 JGI24738J21930_100013504 297
55 3300005293 Ga0065715_10013144 Ga0065715_100131442 297
56 3300005293 Ga0065715_10164070 Ga0065715_101640702 297
57 3300005327 Ga0070658_10015513 Ga0070658_100155136 297
58 3300005327 Ga0070658_10017280 Ga0070658_100172804 297
59 3300005327 Ga0070658_10020535 Ga0070658_100205357 297
60 3300005327 Ga0070658_10026163 Ga0070658_100261635 297
61 3300005327 Ga0070658_10034179 Ga0070658_100341794 297
62 3300005327 Ga0070658_10041456 Ga0070658_100414564 297
63 3300005327 Ga0070658_10055508 Ga0070658_100555083 297
64 3300005327 Ga0070658_10082818 Ga0070658_100828181 297
65 3300005327 Ga0070658_10085845 Ga0070658_100858452 297
66 3300005327 Ga0070658_10127089 Ga0070658_101270893 297
67 3300005328 Ga0070676_10044071 Ga0070676_100440712 297
68 3300005328 Ga0070676_10056188 Ga0070676_100561882 297
69 3300005329 Ga0070683_100000209 Ga0070683_10000020934 297
70 3300005329 Ga0070683_100012234 Ga0070683_1000122344 297
71 3300005329 Ga0070683_100021530 Ga0070683_1000215305 297
72 3300005329 Ga0070683_100176596 Ga0070683_1001765962 297
73 3300005329 Ga0070683_100183184 Ga0070683_1001831842 297
74 3300005330 Ga0070690_100084999 Ga0070690_1000849993 297
75 3300005331 Ga0070670_100000333 Ga0070670_10000033331 297
76 3300005331 Ga0070670_100055618 Ga0070670_1000556183 297
77 3300005331 Ga0070670_100065288 Ga0070670_1000652883 297
78 3300005331 Ga0070670_100160396 Ga0070670_1001603962 297
79 3300005331 Ga0070670_100256827 Ga0070670_1002568272 297
80 3300005334 Ga0068869_100000331 Ga0068869_10000033111 297
81 3300005334 Ga0068869_100031646 Ga0068869_1000316463 297
82 3300005335 Ga0070666_10148053 Ga0070666_101480532 297
83 3300005336 Ga0070680_100000641 Ga0070680_10000064115 297
84 3300005336 Ga0070680_100013601 Ga0070680_1000136012 297
85 3300005336 Ga0070680_100019131 Ga0070680_1000191314 297
86 3300005336 Ga0070680_100019684 Ga0070680_1000196843 297
87 3300005336 Ga0070680_100202739 Ga0070680_1002027392 297
88 3300005338 Ga0068868_100000156 Ga0068868_10000015633 297
89 3300005338 Ga0068868_100041958 Ga0068868_1000419584 297
90 3300005338 Ga0068868_100086653 Ga0068868_1000866532 297
91 3300005339 Ga0070660_100012339 Ga0070660_1000123392 297
92 3300005339 Ga0070660_100015863 Ga0070660_1000158634 297
93 3300005339 Ga0070660_100022785 Ga0070660_1000227853 297
94 3300005339 Ga0070660_100024242 Ga0070660_1000242423 297
95 3300005339 Ga0070660_100045807 Ga0070660_1000458074 297
96 3300005339 Ga0070660_100099785 Ga0070660_1000997852 297
97 3300005339 Ga0070660_100123959 Ga0070660_1001239592 297
98 3300005341 Ga0070691_10061772 Ga0070691_100617722 297
99 3300005344 Ga0070661_100000452 Ga0070661_1000004522 297
100 3300005344 Ga0070661_100034706 Ga0070661_1000347064 297
101 3300005344 Ga0070661_100048731 Ga0070661_1000487314 297
102 3300005345 Ga0070692_10004588 Ga0070692_100045884 297
103 3300005347 Ga0070668_100011926 Ga0070668_1000119262 297
104 3300005347 Ga0070668_100064634 Ga0070668_1000646343 297
105 3300005353 Ga0070669_100013436 Ga0070669_1000134363 297
106 3300005353 Ga0070669_100047901 Ga0070669_1000479013 297
107 3300005353 Ga0070669_100065902 Ga0070669_1000659022 297
108 3300005353 Ga0070669_100362111 Ga0070669_1003621111 297
109 3300005354 Ga0070675_100096026 Ga0070675_1000960263 297
110 3300005354 Ga0070675_100112604 Ga0070675_1001126043 297
111 3300005354 Ga0070675_100231664 Ga0070675_1002316642 297
112 3300005355 Ga0070671_100000322 Ga0070671_1000003224 297
113 3300005355 Ga0070671_100013820 Ga0070671_1000138207 297
114 3300005355 Ga0070671_100014229 Ga0070671_1000142294 297
115 3300005355 Ga0070671_100016892 Ga0070671_1000168924 297
116 3300005355 Ga0070671_100082537 Ga0070671_1000825372 297
117 3300005355 Ga0070671_100134244 Ga0070671_1001342443 297
118 3300005355 Ga0070671_100178128 Ga0070671_1001781282 297
119 3300005356 Ga0070674_100080729 Ga0070674_1000807292 297
120 3300005364 Ga0070673_100000249 Ga0070673_10000024923 297
121 3300005364 Ga0070673_100019257 Ga0070673_1000192574 297
122 3300005365 Ga0070688_100357021 Ga0070688_1003570211 297
123 3300005366 Ga0070659_100000138 Ga0070659_10000013830 297
124 3300005366 Ga0070659_100000814 Ga0070659_1000008147 297
125 3300005366 Ga0070659_100001062 Ga0070659_1000010629 297
126 3300005366 Ga0070659_100012745 Ga0070659_1000127455 297
127 3300005366 Ga0070659_100026588 Ga0070659_1000265884 297
128 3300005366 Ga0070659_100040055 Ga0070659_1000400551 297
129 3300005366 Ga0070659_100048437 Ga0070659_1000484372 297
130 3300005366 Ga0070659_100068828 Ga0070659_1000688283 297
131 3300005366 Ga0070659_100111632 Ga0070659_1001116323 297
132 3300005367 Ga0070667_100001760 Ga0070667_10000176016 297
133 3300005367 Ga0070667_100016912 Ga0070667_1000169125 297
134 3300005367 Ga0070667_100017413 Ga0070667_1000174134 297
135 3300005367 Ga0070667_100098802 Ga0070667_1000988023 297
136 3300005367 Ga0070667_100104929 Ga0070667_1001049293 297
137 3300005367 Ga0070667_100167251 Ga0070667_1001672512 297
138 3300005367 Ga0070667_100282185 Ga0070667_1002821852 297
139 3300005435 Ga0070714_100083992 Ga0070714_1000839923 297
140 3300005444 Ga0070694_100001882 Ga0070694_1000018823 297
141 3300005455 Ga0070663_100002205 Ga0070663_10000220511 297
142 3300005455 Ga0070663_100009792 Ga0070663_1000097921 297
143 3300005455 Ga0070663_100018372 Ga0070663_1000183724 297
144 3300005455 Ga0070663_100019500 Ga0070663_1000195003 297
145 3300005455 Ga0070663_100019779 Ga0070663_1000197794 297
146 3300005456 Ga0070678_100405436 Ga0070678_1004054362 297
147 3300005457 Ga0070662_100001575 Ga0070662_10000157515 297
148 3300005457 Ga0070662_100005377 Ga0070662_1000053777 297
149 3300005457 Ga0070662_100030731 Ga0070662_1000307312 297
150 3300005457 Ga0070662_100054024 Ga0070662_1000540243 297
151 3300005457 Ga0070662_100061029 Ga0070662_1000610292 297
152 3300005458 Ga0070681_10011820 Ga0070681_100118209 297
153 3300005458 Ga0070681_10063525 Ga0070681_100635253 297
154 3300005458 Ga0070681_10536926 Ga0070681_105369261 297
155 3300005459 Ga0068867_100007188 Ga0068867_1000071886 297
156 3300005459 Ga0068867_100045458 Ga0068867_1000454582 297
157 3300005459 Ga0068867_100047518 Ga0068867_1000475183 297
158 3300005466 Ga0070685_10047238 Ga0070685_100472383 297
159 3300005530 Ga0070679_100035261 Ga0070679_1000352614 297
160 3300005530 Ga0070679_100048080 Ga0070679_1000480804 297
161 3300005530 Ga0070679_100062428 Ga0070679_1000624282 297
162 3300005535 Ga0070684_100004466 Ga0070684_10000446612 297
163 3300005535 Ga0070684_100133800 Ga0070684_1001338002 297
164 3300005539 Ga0068853_100001793 Ga0068853_10000179316 297
165 3300005539 Ga0068853_100003189 Ga0068853_10000318911 297
166 3300005539 Ga0068853_100011467 Ga0068853_1000114674 297
167 3300005539 Ga0068853_100016758 Ga0068853_1000167583 297
168 3300005539 Ga0068853_100020437 Ga0068853_1000204372 297
169 3300005539 Ga0068853_100039204 Ga0068853_1000392044 297
170 3300005539 Ga0068853_100063622 Ga0068853_1000636224 297
171 3300005543 Ga0070672_100004112 Ga0070672_10000411210 297
172 3300005543 Ga0070672_100004771 Ga0070672_1000047716 297
173 3300005543 Ga0070672_100064557 Ga0070672_1000645572 297
174 3300005543 Ga0070672_100097141 Ga0070672_1000971412 297
175 3300005547 Ga0070693_100000703 Ga0070693_10000070313 297
176 3300005548 Ga0070665_100004771 Ga0070665_1000047713 297
177 3300005548 Ga0070665_100005560 Ga0070665_10000556012 297
178 3300005548 Ga0070665_100011456 Ga0070665_1000114568 297
179 3300005548 Ga0070665_100014746 Ga0070665_1000147465 297
180 3300005548 Ga0070665_100016127 Ga0070665_1000161277 297
181 3300005548 Ga0070665_100039747 Ga0070665_1000397474 297
182 3300005548 Ga0070665_100072607 Ga0070665_1000726074 297
183 3300005548 Ga0070665_100082307 Ga0070665_1000823072 297
184 3300005563 Ga0068855_100000163 Ga0068855_10000016326 297
185 3300005563 Ga0068855_100035645 Ga0068855_1000356457 297
186 3300005563 Ga0068855_100065480 Ga0068855_1000654803 297
187 3300005563 Ga0068855_100106172 Ga0068855_1001061722 297
188 3300005563 Ga0068855_100156356 Ga0068855_1001563562 297
189 3300005563 Ga0068855_100366802 Ga0068855_1003668021 297
190 3300005563 Ga0068855_100559336 Ga0068855_1005593362 297
191 3300005564 Ga0070664_100000544 Ga0070664_1000005446 297
192 3300005564 Ga0070664_100009377 Ga0070664_1000093774 297
193 3300005564 Ga0070664_100014998 Ga0070664_1000149982 297
194 3300005564 Ga0070664_100028729 Ga0070664_1000287295 297
195 3300005564 Ga0070664_100072997 Ga0070664_1000729972 297
196 3300005577 Ga0068857_100000282 Ga0068857_10000028235 297
197 3300005577 Ga0068857_100006203 Ga0068857_1000062034 297
198 3300005577 Ga0068857_100017928 Ga0068857_1000179282 297
199 3300005577 Ga0068857_100023660 Ga0068857_1000236605 297
200 3300005577 Ga0068857_100059364 Ga0068857_1000593644 297
201 3300005577 Ga0068857_100102460 Ga0068857_1001024603 297
202 3300005577 Ga0068857_100149693 Ga0068857_1001496933 297
203 3300005577 Ga0068857_100186676 Ga0068857_1001866762 297
204 3300005578 Ga0068854_100001188 Ga0068854_1000011885 297
205 3300005578 Ga0068854_100005135 Ga0068854_1000051358 297
206 3300005578 Ga0068854_100006117 Ga0068854_1000061178 297
207 3300005578 Ga0068854_100012275 Ga0068854_1000122755 297
208 3300005578 Ga0068854_100012524 Ga0068854_1000125245 297
209 3300005578 Ga0068854_100047019 Ga0068854_1000470192 297
210 3300005578 Ga0068854_100179859 Ga0068854_1001798591 297
211 3300005614 Ga0068856_100000829 Ga0068856_10000082936 297
212 3300005614 Ga0068856_100008781 Ga0068856_1000087819 297
213 3300005614 Ga0068856_100009193 Ga0068856_1000091933 297
214 3300005614 Ga0068856_100054656 Ga0068856_1000546565 297
215 3300005616 Ga0068852_100003260 Ga0068852_10000326010 297
216 3300005616 Ga0068852_100004156 Ga0068852_1000041563 297
217 3300005616 Ga0068852_100010367 Ga0068852_1000103675 297
218 3300005616 Ga0068852_100013907 Ga0068852_1000139077 297
219 3300005616 Ga0068852_100018232 Ga0068852_1000182328 297
220 3300005616 Ga0068852_100051622 Ga0068852_1000516224 297
221 3300005616 Ga0068852_100364541 Ga0068852_1003645412 297
222 3300005617 Ga0068859_100000778 Ga0068859_10000077831 297
223 3300005617 Ga0068859_100065652 Ga0068859_1000656524 297
224 3300005617 Ga0068859_100231931 Ga0068859_1002319312 297
225 3300005618 Ga0068864_100006905 Ga0068864_10000690511 297
226 3300005618 Ga0068864_100032252 Ga0068864_1000322524 297
227 3300005618 Ga0068864_100091493 Ga0068864_1000914932 297
228 3300005719 Ga0068861_100302407 Ga0068861_1003024072 297
229 3300005834 Ga0068851_10012800 Ga0068851_100128002 297
230 3300005834 Ga0068851_10013684 Ga0068851_100136843 297
231 3300005834 Ga0068851_10033306 Ga0068851_100333062 297
232 3300005834 Ga0068851_10123421 Ga0068851_101234212 297
233 3300005841 Ga0068863_100003770 Ga0068863_1000037708 297
234 3300005841 Ga0068863_100014935 Ga0068863_1000149357 297
235 3300005841 Ga0068863_100097788 Ga0068863_1000977882 297
236 3300005841 Ga0068863_100125321 Ga0068863_1001253213 297
237 3300005842 Ga0068858_100025779 Ga0068858_1000257792 297
238 3300005842 Ga0068858_100041345 Ga0068858_1000413455 297
239 3300005842 Ga0068858_100061421 Ga0068858_1000614213 297
240 3300005842 Ga0068858_100192228 Ga0068858_1001922282 297
241 3300005843 Ga0068860_100001686 Ga0068860_1000016862 297
242 3300005843 Ga0068860_100016439 Ga0068860_1000164392 297
243 3300005843 Ga0068860_100115760 Ga0068860_1001157601 297
244 3300005844 Ga0068862_100003296 Ga0068862_10000329618 297
245 3300005844 Ga0068862_100028968 Ga0068862_1000289683 297
246 3300005844 Ga0068862_100084683 Ga0068862_1000846833 297
247 3300005844 Ga0068862_100101303 Ga0068862_1001013032 297
248 3300005844 Ga0068862_100205961 Ga0068862_1002059612 297
249 3300006237 Ga0097621_100248444 Ga0097621_1002484442 297
250 3300006358 Ga0068871_100034709 Ga0068871_1000347094 297
251 3300006358 Ga0068871_100275624 Ga0068871_1002756242 297
252 3300006852 Ga0075433_10042385 Ga0075433_100423853 297
253 3300006871 Ga0075434_100493188 Ga0075434_1004931882 297
254 3300006881 Ga0068865_100003247 Ga0068865_1000032475 297
255 3300006931 Ga0097620_100000778 Ga0097620_1000007785 297
256 3300006931 Ga0097620_100065654 Ga0097620_1000656544 297
257 3300006931 Ga0097620_100231940 Ga0097620_1002319402 297
258 3300009093 Ga0105240_10020736 Ga0105240_100207367 297
259 3300009093 Ga0105240_10020959 Ga0105240_100209599 297
260 3300009093 Ga0105240_10076614 Ga0105240_100766144 297
261 3300009093 Ga0105240_10117149 Ga0105240_101171494 297
262 3300009093 Ga0105240_10213278 Ga0105240_102132782 297
263 3300009093 Ga0105240_10451278 Ga0105240_104512782 297
264 3300009098 Ga0105245_10000326 Ga0105245_1000032618 297
265 3300009148 Ga0105243_10073888 Ga0105243_100738882 297
266 3300009148 Ga0105243_10327085 Ga0105243_103270852 297
267 3300009177 Ga0105248_10000159 Ga0105248_1000015960 297
268 3300009177 Ga0105248_10001489 Ga0105248_1000148922 297
269 3300009177 Ga0105248_10002100 Ga0105248_100021008 297
270 3300009177 Ga0105248_10005569 Ga0105248_1000556912 297
271 3300009177 Ga0105248_10028455 Ga0105248_100284554 297
272 3300009177 Ga0105248_10100588 Ga0105248_101005884 297
273 3300009177 Ga0105248_10181321 Ga0105248_101813213 297
274 3300009545 Ga0105237_10010341 Ga0105237_1001034111 297
275 3300009545 Ga0105237_10014626 Ga0105237_100146265 297
276 3300009551 Ga0105238_10015768 Ga0105238_100157689 297
277 3300009551 Ga0105238_10037553 Ga0105238_100375535 297
278 3300010375 Ga0105239_10290316 Ga0105239_102903162 297
279 3300010375 Ga0105239_10341130 Ga0105239_103411301 297
280 3300011119 Ga0105246_10027780 Ga0105246_100277802 297
281 3300011119 Ga0105246_10037164 Ga0105246_100371642 297
282 3300013100 Ga0157373_10008452 Ga0157373_100084525 297
283 3300013100 Ga0157373_10016885 Ga0157373_100168854 297
284 3300013100 Ga0157373_10018178 Ga0157373_100181784 297
285 3300013100 Ga0157373_10029984 Ga0157373_100299842 297
286 3300013100 Ga0157373_10105922 Ga0157373_101059222 297
287 3300013102 Ga0157371_10000784 Ga0157371_1000078438 297
288 3300013102 Ga0157371_10018899 Ga0157371_100188993 297
289 3300013102 Ga0157371_10019495 Ga0157371_100194954 297
290 3300013102 Ga0157371_10026498 Ga0157371_100264984 297
291 3300013102 Ga0157371_10034504 Ga0157371_100345043 297
292 3300013102 Ga0157371_10037050 Ga0157371_100370501 297
293 3300013104 Ga0157370_10016872 Ga0157370_100168723 297
294 3300013104 Ga0157370_10040402 Ga0157370_100404024 297
295 3300013104 Ga0157370_10047042 Ga0157370_100470422 297
296 3300013104 Ga0157370_10051983 Ga0157370_100519832 297
297 3300013105 Ga0157369_10018890 Ga0157369_100188908 297
298 3300013105 Ga0157369_10033440 Ga0157369_100334405 297
299 3300013105 Ga0157369_10063148 Ga0157369_100631482 297
300 3300013105 Ga0157369_10067142 Ga0157369_100671422 297
301 3300013105 Ga0157369_10077710 Ga0157369_100777103 297
302 3300013296 Ga0157374_10080450 Ga0157374_100804502 297
303 3300013306 Ga0163162_10032032 Ga0163162_100320323 297
304 3300013306 Ga0163162_10256575 Ga0163162_102565751 297
305 3300013306 Ga0163162_10530305 Ga0163162_105303052 297
306 3300013307 Ga0157372_10007786 Ga0157372_100077867 297
307 3300013307 Ga0157372_10008989 Ga0157372_1000898913 297
308 3300013307 Ga0157372_10135004 Ga0157372_101350042 297
309 3300013307 Ga0157372_10200313 Ga0157372_102003132 297
310 3300013307 Ga0157372_10375236 Ga0157372_103752362 297
311 3300013307 Ga0157372_10400669 Ga0157372_104006691 297
312 3300013308 Ga0157375_10066623 Ga0157375_100666234 297
313 3300013308 Ga0157375_10252211 Ga0157375_102522112 297
314 3300014325 Ga0163163_10000338 Ga0163163_1000033835 297
315 3300014745 Ga0157377_10011474 Ga0157377_100114743 297
316 3300014968 Ga0157379_10049930 Ga0157379_100499303 297
317 3300014968 Ga0157379_10174679 Ga0157379_101746792 297
318 3300025315 Ga0207697_10000584 Ga0207697_1000058410 297
319 3300025315 Ga0207697_10015235 Ga0207697_100152353 297
320 3300025321 Ga0207656_10011341 Ga0207656_100113413 297
321 3300025321 Ga0207656_10060834 Ga0207656_100608342 297
322 3300025901 Ga0207688_10004411 Ga0207688_100044117 297
323 3300025903 Ga0207680_10089196 Ga0207680_100891962 297
324 3300025904 Ga0207647_10000575 Ga0207647_1000057517 297
325 3300025904 Ga0207647_10002145 Ga0207647_100021459 297
326 3300025904 Ga0207647_10002864 Ga0207647_100028647 297
327 3300025904 Ga0207647_10048512 Ga0207647_100485123 297
328 3300025907 Ga0207645_10001233 Ga0207645_1000123318 297
329 3300025907 Ga0207645_10016623 Ga0207645_100166233 297
330 3300025907 Ga0207645_10127403 Ga0207645_101274032 297
331 3300025909 Ga0207705_10000260 Ga0207705_1000026034 297
332 3300025909 Ga0207705_10028624 Ga0207705_100286244 297
333 3300025909 Ga0207705_10058153 Ga0207705_100581532 297
334 3300025909 Ga0207705_10075537 Ga0207705_100755372 297
335 3300025909 Ga0207705_10091117 Ga0207705_100911173 297
336 3300025909 Ga0207705_10110629 Ga0207705_101106292 297
337 3300025909 Ga0207705_10188285 Ga0207705_101882852 297
338 3300025909 Ga0207705_10261340 Ga0207705_102613402 297
339 3300025911 Ga0207654_10044761 Ga0207654_100447612 297
340 3300025911 Ga0207654_10179262 Ga0207654_101792622 297
341 3300025913 Ga0207695_10030232 Ga0207695_100302323 297
342 3300025913 Ga0207695_10045302 Ga0207695_100453025 297
343 3300025913 Ga0207695_10098076 Ga0207695_100980762 297
344 3300025913 Ga0207695_10374386 Ga0207695_103743862 297
345 3300025913 Ga0207695_10379682 Ga0207695_103796822 297
346 3300025917 Ga0207660_10001336 Ga0207660_1000133613 297
347 3300025917 Ga0207660_10007267 Ga0207660_100072673 297
348 3300025917 Ga0207660_10024318 Ga0207660_100243182 297
349 3300025917 Ga0207660_10047363 Ga0207660_100473633 297
350 3300025919 Ga0207657_10000031 Ga0207657_10000031120 297
351 3300025919 Ga0207657_10009915 Ga0207657_1000991510 297
352 3300025919 Ga0207657_10018812 Ga0207657_100188127 297
353 3300025919 Ga0207657_10020134 Ga0207657_100201345 297
354 3300025919 Ga0207657_10024861 Ga0207657_100248614 297
355 3300025919 Ga0207657_10033201 Ga0207657_100332012 297
356 3300025919 Ga0207657_10048214 Ga0207657_100482143 297
357 3300025919 Ga0207657_10068067 Ga0207657_100680672 297
358 3300025919 Ga0207657_10166895 Ga0207657_101668952 297
359 3300025919 Ga0207657_10249157 Ga0207657_102491572 297
360 3300025920 Ga0207649_10000394 Ga0207649_1000039429 297
361 3300025920 Ga0207649_10113254 Ga0207649_101132542 297
362 3300025920 Ga0207649_10125389 Ga0207649_101253892 297
363 3300025921 Ga0207652_10186861 Ga0207652_101868612 297
364 3300025921 Ga0207652_10216234 Ga0207652_102162343 297
365 3300025923 Ga0207681_10096305 Ga0207681_100963052 297
366 3300025924 Ga0207694_10000526 Ga0207694_1000052627 297
367 3300025924 Ga0207694_10003458 Ga0207694_1000345816 297
368 3300025925 Ga0207650_10147841 Ga0207650_101478412 297
369 3300025925 Ga0207650_10412426 Ga0207650_104124261 297
370 3300025927 Ga0207687_10007615 Ga0207687_100076154 297
371 3300025931 Ga0207644_10000941 Ga0207644_1000094115 297
372 3300025931 Ga0207644_10000954 Ga0207644_1000095415 297
373 3300025931 Ga0207644_10014636 Ga0207644_100146365 297
374 3300025932 Ga0207690_10000382 Ga0207690_1000038220 297
375 3300025932 Ga0207690_10003206 Ga0207690_100032062 297
376 3300025932 Ga0207690_10046076 Ga0207690_100460763 297
377 3300025932 Ga0207690_10054025 Ga0207690_100540253 297
378 3300025932 Ga0207690_10345503 Ga0207690_103455031 297
379 3300025933 Ga0207706_10000028 Ga0207706_10000028138 297
380 3300025933 Ga0207706_10000171 Ga0207706_1000017162 297
381 3300025933 Ga0207706_10005399 Ga0207706_1000539910 297
382 3300025933 Ga0207706_10022887 Ga0207706_100228872 297
383 3300025933 Ga0207706_10037286 Ga0207706_100372864 297
384 3300025933 Ga0207706_10072220 Ga0207706_100722202 297
385 3300025935 Ga0207709_10103546 Ga0207709_101035462 297
386 3300025936 Ga0207670_10032192 Ga0207670_100321923 297
387 3300025938 Ga0207704_10006692 Ga0207704_100066925 297
388 3300025940 Ga0207691_10001864 Ga0207691_1000186422 297
389 3300025940 Ga0207691_10045452 Ga0207691_100454523 297
390 3300025940 Ga0207691_10074323 Ga0207691_100743232 297
391 3300025941 Ga0207711_10001375 Ga0207711_1000137511 297
392 3300025941 Ga0207711_10005966 Ga0207711_100059663 297
393 3300025941 Ga0207711_10027623 Ga0207711_100276232 297
394 3300025941 Ga0207711_10030857 Ga0207711_100308573 297
395 3300025941 Ga0207711_10039426 Ga0207711_100394261 297
396 3300025941 Ga0207711_10125412 Ga0207711_101254123 297
397 3300025942 Ga0207689_10000092 Ga0207689_1000009240 297
398 3300025942 Ga0207689_10083550 Ga0207689_100835503 297
399 3300025944 Ga0207661_10003597 Ga0207661_1000359711 297
400 3300025944 Ga0207661_10212496 Ga0207661_102124961 297
401 3300025945 Ga0207679_10000129 Ga0207679_100001296 297
402 3300025945 Ga0207679_10017763 Ga0207679_100177632 297
403 3300025945 Ga0207679_10032098 Ga0207679_100320983 297
404 3300025949 Ga0207667_10000357 Ga0207667_1000035767 297
405 3300025949 Ga0207667_10025870 Ga0207667_100258706 297
406 3300025949 Ga0207667_10047594 Ga0207667_100475944 297
407 3300025949 Ga0207667_10053034 Ga0207667_100530345 297
408 3300025949 Ga0207667_10056916 Ga0207667_100569164 297
409 3300025949 Ga0207667_10143983 Ga0207667_101439833 297
410 3300025949 Ga0207667_10167848 Ga0207667_101678482 297
411 3300025949 Ga0207667_10326287 Ga0207667_103262871 297
412 3300025960 Ga0207651_10000176 Ga0207651_100001769 297
413 3300025960 Ga0207651_10026221 Ga0207651_100262213 297
414 3300025960 Ga0207651_10203266 Ga0207651_102032662 297
415 3300025961 Ga0207712_10000269 Ga0207712_1000026928 297
416 3300025972 Ga0207668_10000080 Ga0207668_1000008035 297
417 3300025972 Ga0207668_10116835 Ga0207668_101168352 297
418 3300025981 Ga0207640_10000922 Ga0207640_100009224 297
419 3300025981 Ga0207640_10001385 Ga0207640_1000138515 297
420 3300025981 Ga0207640_10008786 Ga0207640_100087863 297
421 3300025981 Ga0207640_10172026 Ga0207640_101720262 297
422 3300025986 Ga0207658_10006798 Ga0207658_100067989 297
423 3300025986 Ga0207658_10036095 Ga0207658_100360954 297
424 3300025986 Ga0207658_10060055 Ga0207658_100600553 297
425 3300025986 Ga0207658_10087251 Ga0207658_100872513 297
426 3300025986 Ga0207658_10117234 Ga0207658_101172342 297
427 3300026023 Ga0207677_10057650 Ga0207677_100576503 297
428 3300026023 Ga0207677_10248911 Ga0207677_102489112 297
429 3300026035 Ga0207703_10009105 Ga0207703_100091053 297
430 3300026035 Ga0207703_10046172 Ga0207703_100461723 297
431 3300026041 Ga0207639_10000131 Ga0207639_1000013130 297
432 3300026041 Ga0207639_10000608 Ga0207639_1000060821 297
433 3300026041 Ga0207639_10003016 Ga0207639_100030165 297
434 3300026041 Ga0207639_10028417 Ga0207639_100284173 297
435 3300026041 Ga0207639_10156966 Ga0207639_101569663 297
436 3300026041 Ga0207639_10179217 Ga0207639_101792172 297
437 3300026067 Ga0207678_10000198 Ga0207678_100001989 297
438 3300026067 Ga0207678_10017221 Ga0207678_100172212 297
439 3300026067 Ga0207678_10019267 Ga0207678_100192674 297
440 3300026067 Ga0207678_10025287 Ga0207678_100252877 297
441 3300026067 Ga0207678_10027353 Ga0207678_100273535 297
442 3300026067 Ga0207678_10114561 Ga0207678_101145613 297
443 3300026078 Ga0207702_10000247 Ga0207702_1000024734 297
444 3300026078 Ga0207702_10044203 Ga0207702_100442034 297
445 3300026078 Ga0207702_10046137 Ga0207702_100461372 297
446 3300026078 Ga0207702_10377081 Ga0207702_103770812 297
447 3300026078 Ga0207702_10411854 Ga0207702_104118542 297
448 3300026088 Ga0207641_10046546 Ga0207641_100465463 297
449 3300026088 Ga0207641_10118141 Ga0207641_101181413 297
450 3300026088 Ga0207641_10152950 Ga0207641_101529503 297
451 3300026089 Ga0207648_10008297 Ga0207648_100082974 297
452 3300026089 Ga0207648_10008887 Ga0207648_100088879 297
453 3300026089 Ga0207648_10017502 Ga0207648_100175023 297
454 3300026095 Ga0207676_10004385 Ga0207676_100043853 297
455 3300026095 Ga0207676_10269919 Ga0207676_102699192 297
456 3300026095 Ga0207676_10297382 Ga0207676_102973822 297
457 3300026116 Ga0207674_10010569 Ga0207674_100105694 297
458 3300026116 Ga0207674_10014969 Ga0207674_100149699 297
459 3300026116 Ga0207674_10016447 Ga0207674_100164473 297
460 3300026116 Ga0207674_10018937 Ga0207674_100189379 297
461 3300026116 Ga0207674_10020590 Ga0207674_100205908 297
462 3300026116 Ga0207674_10053575 Ga0207674_100535752 297
463 3300026116 Ga0207674_10064490 Ga0207674_100644903 297
464 3300026116 Ga0207674_10064900 Ga0207674_100649002 297
465 3300026116 Ga0207674_10068894 Ga0207674_100688944 297
466 3300026116 Ga0207674_10160076 Ga0207674_101600762 297
467 3300026116 Ga0207674_10297793 Ga0207674_102977932 297
468 3300026118 Ga0207675_100378306 Ga0207675_1003783062 297
469 3300026142 Ga0207698_10001888 Ga0207698_1000188816 297
470 3300026142 Ga0207698_10006575 Ga0207698_100065757 297
471 3300026142 Ga0207698_10014500 Ga0207698_100145003 297
472 3300026142 Ga0207698_10030984 Ga0207698_100309844 297
473 3300026142 Ga0207698_10108543 Ga0207698_101085432 297
474 3300028379 Ga0268266_10000433 Ga0268266_1000043331 297
475 3300028379 Ga0268266_10010715 Ga0268266_100107157 297
476 3300028379 Ga0268266_10026216 Ga0268266_100262167 297
477 3300028379 Ga0268266_10040393 Ga0268266_100403933 297
478 3300028379 Ga0268266_10052988 Ga0268266_100529881 297
479 3300028379 Ga0268266_10078633 Ga0268266_100786333 297
480 3300028379 Ga0268266_10162543 Ga0268266_101625432 297
481 3300028380 Ga0268265_10002770 Ga0268265_100027705 297
482 3300028380 Ga0268265_10026121 Ga0268265_100261214 297
483 3300028380 Ga0268265_10073709 Ga0268265_100737093 297
484 3300028380 Ga0268265_10156824 Ga0268265_101568242 297
485 3300028380 Ga0268265_10182676 Ga0268265_101826762 297
486 3300028381 Ga0268264_10000567 Ga0268264_1000056740 297
487 3300028381 Ga0268264_10003351 Ga0268264_100033515 297
488 3300028381 Ga0268264_10005259 Ga0268264_1000525911 297
489 3300028381 Ga0268264_10143383 Ga0268264_101433832 297
490 3300031852 Ga0307410_10003819 Ga0307410_100038192 297
491 3300031852 Ga0307410_10262960 Ga0307410_102629602 297
492 3300031901 Ga0307406_10018726 Ga0307406_100187263 297
493 3300031903 Ga0307407_10004615 Ga0307407_100046154 297
494 3300031911 Ga0307412_10067038 Ga0307412_100670383 297
495 3300031995 Ga0307409_100002843 Ga0307409_1000028433 297
496 3300031995 Ga0307409_100090561 Ga0307409_1000905613 297
497 3300031995 Ga0307409_100152813 Ga0307409_1001528132 297
498 3300032002 Ga0307416_100043719 Ga0307416_1000437194 297
499 3300032004 Ga0307414_10015027 Ga0307414_100150274 297
500 3300032004 Ga0307414_10044338 Ga0307414_100443383 297
501 3300032005 Ga0307411_10011439 Ga0307411_100114394 297
502 3300032005 Ga0307411_10011531 Ga0307411_100115312 297
503 3300032005 Ga0307411_10122113 Ga0307411_101221133 297
504 3300032126 Ga0307415_100017152 Ga0307415_1000171521 297
505 3300032126 Ga0307415_100018950 Ga0307415_1000189504 297
506 3300035084 Ga0373928_0026956 Ga0373928_0026956_130_1059 297
507 3300035086 Ga0373934_0080594 Ga0373934_0080594_106_1035 297
508 3300035090 Ga0373949_0034273 Ga0373949_0034273_78_1007 297
509 3300035118 Ga0373954_0013710 Ga0373954_0013710_595_1524 297
510 3300035121 Ga0373960_0003919 Ga0373960_0003919_705_1634 297
511 3300035170 Ga0373943_0003195 Ga0373943_0003195_1037_1969 297
512 3300035172 Ga0373955_0017242 Ga0373955_0017242_2120_3049 297
513 3300035724 Ga0373933_0117916 Ga0373933_0117916_447_1376 297
514 3300036401 Ga0373937_0004086 Ga0373937_0004086_5522_6451 297
515 3300037312 Ga0395899_0004324 Ga0395899_0004324_4529_5461 297
516 3300037312 Ga0395899_0012008 Ga0395899_0012008_2998_3927 297
517 3300037312 Ga0395899_0015712 Ga0395899_0015712_617_1546 297
518 3300037312 Ga0395899_0017880 Ga0395899_0017880_3944_4873 297
519 3300037312 Ga0395899_0019845 Ga0395899_0019845_1988_2917 297
520 3300037312 Ga0395899_0052302 Ga0395899_0052302_158_1087 297
521 3300037312 Ga0395899_0083237 Ga0395899_0083237_920_1849 297
522 3300037312 Ga0395899_0101568 Ga0395899_0101568_521_1450 297
523 3300037312 Ga0395899_0227087 Ga0395899_0227087_113_1042 297
524 3300037418 Ga0395900_0008912 Ga0395900_0008912_7384_8313 297
525 3300037418 Ga0395900_0016439 Ga0395900_0016439_2931_3860 297
526 3300037418 Ga0395900_0020464 Ga0395900_0020464_23_952 297
527 3300037418 Ga0395900_0023784 Ga0395900_0023784_4347_5276 297
528 3300037418 Ga0395900_0032306 Ga0395900_0032306_2172_3101 297
529 3300037418 Ga0395900_0073975 Ga0395900_0073975_2069_2998 297
530 3300037418 Ga0395900_0147255 Ga0395900_0147255_838_1767 297
531 3300037418 Ga0395900_0207884 Ga0395900_0207884_279_1211 297
532 3300037466 Ga0395898_0013212 Ga0395898_0013212_894_1826 297
533 3300037466 Ga0395898_0045666 Ga0395898_0045666_2282_3211 297
534 3300037466 Ga0395898_0086695 Ga0395898_0086695_1241_2170 297
535 3300037466 Ga0395898_0107895 Ga0395898_0107895_1028_1957 297
536 3300037466 Ga0395898_0113668 Ga0395898_0113668_1184_2113 297
537 3300037466 Ga0395898_0171290 Ga0395898_0171290_649_1578 297
538 3300037466 Ga0395898_0217232 Ga0395898_0217232_552_1481 297
539 3300037471 Ga0395905_0000104 Ga0395905_0000104_5958_6887 297
540 3300037471 Ga0395905_0000974 Ga0395905_0000974_29036_29965 297
541 3300037471 Ga0395905_0010192 Ga0395905_0010192_5560_6489 297
542 3300037471 Ga0395905_0011956 Ga0395905_0011956_329_1261 297
543 3300037471 Ga0395905_0037894 Ga0395905_0037894_473_1402 297
544 3300037471 Ga0395905_0044957 Ga0395905_0044957_2209_3138 297
545 3300037471 Ga0395905_0106127 Ga0395905_0106127_839_1768 297
546 3300037471 Ga0395905_0126104 Ga0395905_0126104_1157_2086 297
547 3300037471 Ga0395905_0165732 Ga0395905_0165732_1083_2012 297
548 3300037471 Ga0395905_0272820 Ga0395905_0272820_79_1008 297
549 3300037471 Ga0395905_0286183 Ga0395905_0286183_547_1476 297
550 3300037471 Ga0395905_0305990 Ga0395905_0305990_365_1294 297
551 3300037471 Ga0395905_0585597 Ga0395905_0585597_40_969 297
552 3300038443 Ga0395901_0000276 Ga0395901_0000276_33566_34495 297
553 3300038443 Ga0395901_0010013 Ga0395901_0010013_4335_5264 297
554 3300038443 Ga0395901_0028542 Ga0395901_0028542_3235_4164 297
555 3300038443 Ga0395901_0043484 Ga0395901_0043484_757_1686 297
556 3300038443 Ga0395901_0102924 Ga0395901_0102924_1997_2926 297
557 3300038443 Ga0395901_0130050 Ga0395901_0130050_1619_2548 297
558 3300038443 Ga0395901_0165053 Ga0395901_0165053_627_1559 297
559 3300044684 Ga0466966_0030220 Ga0466966_0030220_1046_1975 297
560 3300044684 Ga0466966_0213391 Ga0466966_0213391_170_1099 297
561 3300044684 Ga0466966_0215016 Ga0466966_0215016_56_985 297
562 3300044693 Ga0466961_0007560 Ga0466961_0007560_1009_1938 297
563 3300044693 Ga0466961_0115074 Ga0466961_0115074_481_1410 297
564 3300044694 Ga0466963_0000971 Ga0466963_0000971_10630_11559 297
565 3300044694 Ga0466963_0009670 Ga0466963_0009670_4247_5176 297
566 3300044694 Ga0466963_0014808 Ga0466963_0014808_78_1007 297
567 3300044694 Ga0466963_0015010 Ga0466963_0015010_2735_3667 297
568 3300044694 Ga0466963_0031383 Ga0466963_0031383_1331_2260 297
569 3300044694 Ga0466963_0092802 Ga0466963_0092802_1005_1934 297
570 3300044694 Ga0466963_0214913 Ga0466963_0214913_79_1008 297
571 3300044706 Ga0466964_0102420 Ga0466964_0102420_319_1248 297
572 3300044719 Ga0466971_0093278 Ga0466971_0093278_204_1133 297
573 3300044842 Ga0466957_0002813 Ga0466957_0002813_7146_8075 297
574 3300044842 Ga0466957_0011404 Ga0466957_0011404_365_1294 297
575 3300044842 Ga0466957_0184479 Ga0466957_0184479_15_944 297
576 3300045049 Ga0466959_0078525 Ga0466959_0078525_1428_2357 297
577 3300045049 Ga0466959_0204287 Ga0466959_0204287_126_1055 297
578 3300045976 Ga0466967_0000483 Ga0466967_0000483_7881_8810 297
579 3300045976 Ga0466967_0002578 Ga0466967_0002578_5211_6140 297
580 3300045976 Ga0466967_0005574 Ga0466967_0005574_339_1268 297
581 3300045976 Ga0466967_0021495 Ga0466967_0021495_2228_3157 297
582 3300045976 Ga0466967_0023653 Ga0466967_0023653_1867_2796 297
583 3300045976 Ga0466967_0052339 Ga0466967_0052339_847_1776 297
584 3300045976 Ga0466967_0089806 Ga0466967_0089806_307_1236 297
585 3300045976 Ga0466967_0154388 Ga0466967_0154388_1101_2030 297
586 3300045976 Ga0466967_0367706 Ga0466967_0367706_198_1127 297
587 3300046492 Ga0495585_0094446 Ga0495585_0094446_96_1025 297
588 3300046616 Ga0495668_0009438 Ga0495668_0009438_3636_4565 297
589 3300046684 Ga0495669_0041904 Ga0495669_0041904_919_1848 297
590 3300046684 Ga0495669_0059759 Ga0495669_0059759_194_1123 297
591 3300046684 Ga0495669_0092321 Ga0495669_0092321_407_1336 297
592 3300046684 Ga0495669_0107845 Ga0495669_0107845_145_1074 297
593 3300047445 Ga0495677_0022636 Ga0495677_0022636_72_1001 297
594 3300048088 Ga0495602_0051913 Ga0495602_0051913_161_1090 297
595 3300048904 Ga0496101_0368104 Ga0496101_0368104_144_1073 297
596 3300048907 Ga0496104_0441116 Ga0496104_0441116_72_1001 297
597 3300048909 Ga0496106_0090688 Ga0496106_0090688_975_1904 297
598 3300048910 Ga0496107_0132781 Ga0496107_0132781_772_1701 297
599 3300048911 Ga0496108_0217863 Ga0496108_0217863_660_1589 297
600 3300048912 Ga0496109_0158233 Ga0496109_0158233_563_1492 297
601 3300048913 Ga0496110_0023530 Ga0496110_0023530_627_1556 297
602 3300048913 Ga0496110_0038404 Ga0496110_0038404_871_1800 297
603 3300048913 Ga0496110_0119677 Ga0496110_0119677_167_1096 297
604 3300048913 Ga0496110_0394851 Ga0496110_0394851_272_1201 297
605 3300048914 Ga0496111_0009804 Ga0496111_0009804_3131_4060 297
606 3300048915 Ga0496112_0004292 Ga0496112_0004292_10182_11111 297
607 3300048915 Ga0496112_0018585 Ga0496112_0018585_5390_6319 297
608 3300048916 Ga0496113_0002271 Ga0496113_0002271_73_1005 297
609 3300048916 Ga0496113_0049274 Ga0496113_0049274_313_1242 297
610 3300049586 Ga0501070_0044033 Ga0501070_0044033_2245_3174 297
611 3300050508 nmdc:mga09592_248854_c1 nmdc:mga09592_248854_c1_456_1385 297
612 3300061719 Ga0466962_0003571 Ga0466962_0003571_364_1293 297
613 3300061719 Ga0466962_0008051 Ga0466962_0008051_1470_2399 297
614 3300061719 Ga0466962_0031717 Ga0466962_0031717_747_1676 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

5

117

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgr-assembly1.cif.gz_B crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and glycerol bound form) 0.9484 4 295
7cgq-assembly1.cif.gz_B crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and l-arabinose bound form) 0.9472 4 295
7cgr-assembly1.cif.gz_B crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and glycerol bound form) 0.9298 4 295
7cgq-assembly1.cif.gz_B crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and l-arabinose bound form) 0.9287 4 295
4ew6-assembly1.cif.gz_A-2 crystal structure of d-galactose-1-dehydrogenase protein from rhizobium etli 0.9262 1 296
ID Description Score Start End Superfamily
6jnkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9583 4 115 3.40.50.720
6jnkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9339 4 115 3.40.50.720
3fhlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8946 1 112 3.40.50.720
af_P77376_2_121_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8919 1 112 3.90.1150.10
af_P46853_1_121_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8902 2 112 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A2U1G007-F1-model_v4 deleted 0.9611 1 297
AF-A0A2U1G007-F1-model_v4 deleted 0.958 1 297
AF-A0A529XHK6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9573 1 114 GO:0000166
AF-A0A435AKU1-F1-model_v4 deleted 0.9562 1 137
AF-A0A455UJI4-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9365 1 117 GO:0000166

Feature Viewer

pLDDT pTM Quality
93.62 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map