F469319
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 614 | 181 | 614 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300001989|JGI24739J22299_10016522|JGI24739J22299_100165222 |
| Length | 310 |
| Sequence | VIQPIRIAILGFGKIADDQHVPSIAANPKFELAAVSSRSGQGPQPVFXDWREMIRKVEGLDAVAITTPPSPRYDIARECILADLHCLLEKPPTDGTSEIADLDILAQERGVTLFTTWHAQHHSTVDAAERALAGKRIRSMKILWHEDVHKWHPGQKWIWEPSGFGVFDPGINAFSIATKIFPGALLVRDATLSVPENAQTPIAAEINFYSPQAEGPLTASLDWRRSKDEEWTIELEATDGTKVRLEEGGAKLYLNGTLHSDEWSGEYPHIYERFADLIDDHRSHVDVAPLRLVADCLLAGRRRTVEPVTM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 142 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 146 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 147 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 156 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 157 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 158 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 159 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 160 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 171 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 172 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 173 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 176 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 177 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 178 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 179 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.44 |
| Rhizosphere | 97.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001942 | 3300001979 | Bacteria | 9463 |
| 2 | JGI24740J21852_10004163 | 3300001979 | Bacteria | 6247 |
| 3 | JGI24739J22299_10000129 | 3300001989 | Bacteria | 23885 |
| 4 | JGI24739J22299_10009892 | 3300001989 | Bacteria | 3545 |
| 5 | JGI24739J22299_10016522 | 3300001989 | Bacteria | 2669 |
| 6 | JGI24737J22298_10000357 | 3300001990 | Bacteria | 15471 |
| 7 | JGI24737J22298_10001447 | 3300001990 | Bacteria | 8469 |
| 8 | JGI24737J22298_10011049 | 3300001990 | Bacteria | 2965 |
| 9 | JGI24743J22301_10029843 | 3300001991 | Bacteria | 1071 |
| 10 | JGI24735J21928_10001481 | 3300002067 | Bacteria | 8303 |
| 11 | JGI24735J21928_10016264 | 3300002067 | Bacteria | 2311 |
| 12 | JGI24738J21930_10001003 | 3300002075 | Bacteria | 8082 |
| 13 | JGI24738J21930_10001350 | 3300002075 | Bacteria | 6807 |
| 14 | Ga0065715_10013144 | 3300005293 | Bacteria | 2124 |
| 15 | Ga0065715_10164070 | 3300005293 | Bacteria | 1584 |
| 16 | Ga0070658_10015513 | 3300005327 | Bacteria | 6093 |
| 17 | Ga0070658_10017280 | 3300005327 | Bacteria | 5773 |
| 18 | Ga0070658_10020535 | 3300005327 | Bacteria | 5294 |
| 19 | Ga0070658_10026163 | 3300005327 | Bacteria | 4681 |
| 20 | Ga0070658_10034179 | 3300005327 | Bacteria | 4091 |
| 21 | Ga0070658_10041456 | 3300005327 | Bacteria | 3714 |
| 22 | Ga0070658_10055508 | 3300005327 | Bacteria | 3218 |
| 23 | Ga0070658_10082818 | 3300005327 | Bacteria | 2637 |
| 24 | Ga0070658_10085845 | 3300005327 | Bacteria | 2589 |
| 25 | Ga0070658_10127089 | 3300005327 | Bacteria | 2122 |
| 26 | Ga0070658_10144101 | 3300005327 | Bacteria | 1991 |
| 27 | Ga0070676_10044071 | 3300005328 | Bacteria | 2595 |
| 28 | Ga0070676_10056188 | 3300005328 | Bacteria | 2325 |
| 29 | Ga0070676_10113994 | 3300005328 | Bacteria | 1687 |
| 30 | Ga0070683_100000209 | 3300005329 | Bacteria | 39666 |
| 31 | Ga0070683_100012234 | 3300005329 | Bacteria | 7452 |
| 32 | Ga0070683_100021530 | 3300005329 | Bacteria | 5754 |
| 33 | Ga0070683_100176596 | 3300005329 | Bacteria | 2027 |
| 34 | Ga0070683_100183184 | 3300005329 | Bacteria | 1988 |
| 35 | Ga0070690_100084999 | 3300005330 | Bacteria | 2075 |
| 36 | Ga0070670_100000333 | 3300005331 | Bacteria | 39598 |
| 37 | Ga0070670_100055618 | 3300005331 | Bacteria | 3397 |
| 38 | Ga0070670_100065288 | 3300005331 | Bacteria | 3123 |
| 39 | Ga0070670_100085425 | 3300005331 | Bacteria | 2711 |
| 40 | Ga0070670_100160396 | 3300005331 | Unclassified | 1949 |
| 41 | Ga0070670_100256827 | 3300005331 | Bacteria | 1523 |
| 42 | Ga0068869_100000331 | 3300005334 | Bacteria | 25170 |
| 43 | Ga0068869_100031646 | 3300005334 | Bacteria | 3722 |
| 44 | Ga0070666_10148053 | 3300005335 | Bacteria | 1637 |
| 45 | Ga0070680_100000641 | 3300005336 | Bacteria | 24333 |
| 46 | Ga0070680_100013601 | 3300005336 | Bacteria | 6343 |
| 47 | Ga0070680_100019131 | 3300005336 | Bacteria | 5423 |
| 48 | Ga0070680_100019684 | 3300005336 | Bacteria | 5353 |
| 49 | Ga0070680_100202739 | 3300005336 | Bacteria | 1673 |
| 50 | Ga0070682_100070358 | 3300005337 | Bacteria | 2237 |
| 51 | Ga0068868_100000156 | 3300005338 | Bacteria | 44526 |
| 52 | Ga0068868_100041958 | 3300005338 | Bacteria | 3567 |
| 53 | Ga0068868_100086653 | 3300005338 | Bacteria | 2517 |
| 54 | Ga0070660_100012339 | 3300005339 | Bacteria | 6099 |
| 55 | Ga0070660_100015863 | 3300005339 | Bacteria | 5453 |
| 56 | Ga0070660_100022785 | 3300005339 | Bacteria | 4637 |
| 57 | Ga0070660_100024242 | 3300005339 | Bacteria | 4501 |
| 58 | Ga0070660_100045807 | 3300005339 | Bacteria | 3350 |
| 59 | Ga0070660_100090087 | 3300005339 | Bacteria | 2418 |
| 60 | Ga0070660_100099785 | 3300005339 | Bacteria | 2299 |
| 61 | Ga0070660_100123959 | 3300005339 | Bacteria | 2064 |
| 62 | Ga0070660_100162116 | 3300005339 | Bacteria | 1802 |
| 63 | Ga0070691_10061772 | 3300005341 | Bacteria | 1803 |
| 64 | Ga0070661_100000452 | 3300005344 | Bacteria | 31380 |
| 65 | Ga0070661_100034706 | 3300005344 | Bacteria | 3659 |
| 66 | Ga0070661_100048731 | 3300005344 | Bacteria | 3101 |
| 67 | Ga0070661_100105326 | 3300005344 | Bacteria | 2102 |
| 68 | Ga0070661_100258589 | 3300005344 | Bacteria | 1345 |
| 69 | Ga0070692_10004588 | 3300005345 | Bacteria | 5786 |
| 70 | Ga0070668_100011926 | 3300005347 | Bacteria | 6471 |
| 71 | Ga0070668_100064634 | 3300005347 | Bacteria | 2837 |
| 72 | Ga0070669_100013436 | 3300005353 | Bacteria | 5821 |
| 73 | Ga0070669_100047901 | 3300005353 | Bacteria | 3119 |
| 74 | Ga0070669_100065902 | 3300005353 | Bacteria | 2668 |
| 75 | Ga0070669_100362111 | 3300005353 | Bacteria | 1179 |
| 76 | Ga0070675_100096026 | 3300005354 | Bacteria | 2490 |
| 77 | Ga0070675_100112604 | 3300005354 | Bacteria | 2304 |
| 78 | Ga0070675_100231664 | 3300005354 | Bacteria | 1611 |
| 79 | Ga0070671_100000322 | 3300005355 | Bacteria | 32627 |
| 80 | Ga0070671_100013820 | 3300005355 | Bacteria | 6514 |
| 81 | Ga0070671_100014229 | 3300005355 | Bacteria | 6425 |
| 82 | Ga0070671_100016892 | 3300005355 | Bacteria | 5904 |
| 83 | Ga0070671_100082537 | 3300005355 | Bacteria | 2687 |
| 84 | Ga0070671_100134244 | 3300005355 | Bacteria | 2086 |
| 85 | Ga0070671_100178128 | 3300005355 | Bacteria | 1799 |
| 86 | Ga0070674_100080729 | 3300005356 | Bacteria | 2323 |
| 87 | Ga0070673_100000249 | 3300005364 | Bacteria | 27281 |
| 88 | Ga0070673_100019257 | 3300005364 | Bacteria | 4899 |
| 89 | Ga0070688_100357021 | 3300005365 | Bacteria | 1071 |
| 90 | Ga0070659_100000138 | 3300005366 | Bacteria | 56073 |
| 91 | Ga0070659_100000814 | 3300005366 | Bacteria | 22773 |
| 92 | Ga0070659_100001062 | 3300005366 | Bacteria | 20090 |
| 93 | Ga0070659_100012745 | 3300005366 | Bacteria | 6240 |
| 94 | Ga0070659_100026588 | 3300005366 | Bacteria | 4454 |
| 95 | Ga0070659_100040055 | 3300005366 | Bacteria | 3661 |
| 96 | Ga0070659_100048437 | 3300005366 | Bacteria | 3339 |
| 97 | Ga0070659_100068828 | 3300005366 | Bacteria | 2809 |
| 98 | Ga0070659_100111632 | 3300005366 | Bacteria | 2207 |
| 99 | Ga0070667_100001760 | 3300005367 | Bacteria | 19301 |
| 100 | Ga0070667_100016912 | 3300005367 | Bacteria | 6035 |
| 101 | Ga0070667_100017413 | 3300005367 | Bacteria | 5956 |
| 102 | Ga0070667_100098802 | 3300005367 | Bacteria | 2519 |
| 103 | Ga0070667_100104929 | 3300005367 | Bacteria | 2445 |
| 104 | Ga0070667_100167251 | 3300005367 | Bacteria | 1940 |
| 105 | Ga0070667_100282185 | 3300005367 | Bacteria | 1491 |
| 106 | Ga0070714_100083992 | 3300005435 | Bacteria | 2778 |
| 107 | Ga0070694_100001882 | 3300005444 | Bacteria | 12423 |
| 108 | Ga0070663_100002205 | 3300005455 | Bacteria | 10897 |
| 109 | Ga0070663_100006862 | 3300005455 | Bacteria | 6890 |
| 110 | Ga0070663_100009792 | 3300005455 | Bacteria | 5953 |
| 111 | Ga0070663_100018372 | 3300005455 | Bacteria | 4584 |
| 112 | Ga0070663_100019500 | 3300005455 | Bacteria | 4471 |
| 113 | Ga0070663_100019779 | 3300005455 | Bacteria | 4446 |
| 114 | Ga0070663_100269651 | 3300005455 | Bacteria | 1353 |
| 115 | Ga0070678_100405436 | 3300005456 | Bacteria | 1185 |
| 116 | Ga0070662_100001575 | 3300005457 | Bacteria | 14101 |
| 117 | Ga0070662_100005377 | 3300005457 | Bacteria | 8178 |
| 118 | Ga0070662_100030731 | 3300005457 | Bacteria | 3762 |
| 119 | Ga0070662_100054024 | 3300005457 | Bacteria | 2910 |
| 120 | Ga0070662_100061029 | 3300005457 | Bacteria | 2751 |
| 121 | Ga0070681_10011820 | 3300005458 | Bacteria | 8654 |
| 122 | Ga0070681_10063525 | 3300005458 | Bacteria | 3664 |
| 123 | Ga0070681_10536926 | 3300005458 | Bacteria | 1083 |
| 124 | Ga0068867_100007188 | 3300005459 | Bacteria | 7869 |
| 125 | Ga0068867_100045458 | 3300005459 | Bacteria | 3220 |
| 126 | Ga0068867_100047518 | 3300005459 | Bacteria | 3155 |
| 127 | Ga0070685_10047238 | 3300005466 | Bacteria | 2475 |
| 128 | Ga0070679_100035261 | 3300005530 | Bacteria | 4963 |
| 129 | Ga0070679_100048080 | 3300005530 | Bacteria | 4251 |
| 130 | Ga0070679_100062428 | 3300005530 | Bacteria | 3714 |
| 131 | Ga0070684_100004466 | 3300005535 | Bacteria | 10652 |
| 132 | Ga0070684_100133800 | 3300005535 | Bacteria | 2238 |
| 133 | Ga0068853_100001793 | 3300005539 | Bacteria | 15788 |
| 134 | Ga0068853_100003189 | 3300005539 | Bacteria | 12522 |
| 135 | Ga0068853_100011467 | 3300005539 | Bacteria | 7205 |
| 136 | Ga0068853_100016758 | 3300005539 | Bacteria | 6036 |
| 137 | Ga0068853_100020437 | 3300005539 | Bacteria | 5507 |
| 138 | Ga0068853_100039204 | 3300005539 | Bacteria | 4040 |
| 139 | Ga0068853_100063622 | 3300005539 | Bacteria | 3195 |
| 140 | Ga0068853_100171217 | 3300005539 | Bacteria | 1964 |
| 141 | Ga0070672_100004112 | 3300005543 | Bacteria | 9500 |
| 142 | Ga0070672_100004771 | 3300005543 | Bacteria | 8896 |
| 143 | Ga0070672_100064557 | 3300005543 | Bacteria | 2893 |
| 144 | Ga0070672_100097141 | 3300005543 | Bacteria | 2384 |
| 145 | Ga0070693_100000703 | 3300005547 | Bacteria | 14759 |
| 146 | Ga0070665_100004771 | 3300005548 | Bacteria | 14114 |
| 147 | Ga0070665_100005560 | 3300005548 | Bacteria | 12965 |
| 148 | Ga0070665_100011456 | 3300005548 | Bacteria | 8964 |
| 149 | Ga0070665_100014746 | 3300005548 | Bacteria | 7843 |
| 150 | Ga0070665_100016127 | 3300005548 | Bacteria | 7497 |
| 151 | Ga0070665_100039747 | 3300005548 | Bacteria | 4728 |
| 152 | Ga0070665_100072607 | 3300005548 | Bacteria | 3448 |
| 153 | Ga0070665_100082307 | 3300005548 | Bacteria | 3224 |
| 154 | Ga0068855_100000163 | 3300005563 | Bacteria | 85587 |
| 155 | Ga0068855_100035645 | 3300005563 | Bacteria | 5926 |
| 156 | Ga0068855_100065480 | 3300005563 | Bacteria | 4236 |
| 157 | Ga0068855_100106172 | 3300005563 | Bacteria | 3228 |
| 158 | Ga0068855_100156356 | 3300005563 | Bacteria | 2590 |
| 159 | Ga0068855_100366802 | 3300005563 | Bacteria | 1584 |
| 160 | Ga0068855_100559336 | 3300005563 | Bacteria | 1237 |
| 161 | Ga0070664_100000544 | 3300005564 | Bacteria | 28761 |
| 162 | Ga0070664_100003024 | 3300005564 | Bacteria | 13598 |
| 163 | Ga0070664_100009377 | 3300005564 | Bacteria | 7936 |
| 164 | Ga0070664_100014998 | 3300005564 | Bacteria | 6325 |
| 165 | Ga0070664_100028729 | 3300005564 | Bacteria | 4629 |
| 166 | Ga0070664_100072997 | 3300005564 | Bacteria | 2943 |
| 167 | Ga0068857_100000282 | 3300005577 | Bacteria | 34844 |
| 168 | Ga0068857_100006203 | 3300005577 | Bacteria | 10222 |
| 169 | Ga0068857_100017928 | 3300005577 | Bacteria | 6209 |
| 170 | Ga0068857_100023660 | 3300005577 | Bacteria | 5408 |
| 171 | Ga0068857_100059364 | 3300005577 | Bacteria | 3398 |
| 172 | Ga0068857_100102460 | 3300005577 | Bacteria | 2569 |
| 173 | Ga0068857_100149693 | 3300005577 | Bacteria | 2114 |
| 174 | Ga0068857_100186676 | 3300005577 | Bacteria | 1888 |
| 175 | Ga0068854_100001188 | 3300005578 | Bacteria | 15628 |
| 176 | Ga0068854_100005135 | 3300005578 | Bacteria | 8253 |
| 177 | Ga0068854_100006117 | 3300005578 | Bacteria | 7636 |
| 178 | Ga0068854_100012275 | 3300005578 | Bacteria | 5607 |
| 179 | Ga0068854_100012524 | 3300005578 | Bacteria | 5558 |
| 180 | Ga0068854_100031043 | 3300005578 | Bacteria | 3710 |
| 181 | Ga0068854_100047019 | 3300005578 | Bacteria | 3075 |
| 182 | Ga0068854_100179859 | 3300005578 | Bacteria | 1651 |
| 183 | Ga0068856_100000829 | 3300005614 | Bacteria | 33313 |
| 184 | Ga0068856_100008781 | 3300005614 | Bacteria | 9830 |
| 185 | Ga0068856_100009193 | 3300005614 | Bacteria | 9608 |
| 186 | Ga0068856_100054656 | 3300005614 | Bacteria | 3939 |
| 187 | Ga0068852_100003260 | 3300005616 | Bacteria | 11333 |
| 188 | Ga0068852_100004156 | 3300005616 | Bacteria | 10199 |
| 189 | Ga0068852_100010367 | 3300005616 | Bacteria | 6961 |
| 190 | Ga0068852_100013907 | 3300005616 | Bacteria | 6172 |
| 191 | Ga0068852_100018232 | 3300005616 | Bacteria | 5527 |
| 192 | Ga0068852_100033435 | 3300005616 | Bacteria | 4269 |
| 193 | Ga0068852_100051622 | 3300005616 | Bacteria | 3530 |
| 194 | Ga0068852_100083384 | 3300005616 | Bacteria | 2842 |
| 195 | Ga0068852_100364541 | 3300005616 | Bacteria | 1414 |
| 196 | Ga0068859_100000778 | 3300005617 | Bacteria | 32222 |
| 197 | Ga0068859_100065652 | 3300005617 | Bacteria | 3662 |
| 198 | Ga0068859_100231931 | 3300005617 | Bacteria | 1934 |
| 199 | Ga0068864_100006905 | 3300005618 | Bacteria | 9309 |
| 200 | Ga0068864_100032252 | 3300005618 | Bacteria | 4450 |
| 201 | Ga0068864_100091493 | 3300005618 | Bacteria | 2684 |
| 202 | Ga0068861_100302407 | 3300005719 | Bacteria | 1386 |
| 203 | Ga0068851_10003637 | 3300005834 | Bacteria | 6881 |
| 204 | Ga0068851_10012800 | 3300005834 | Bacteria | 3963 |
| 205 | Ga0068851_10013684 | 3300005834 | Bacteria | 3841 |
| 206 | Ga0068851_10033306 | 3300005834 | Bacteria | 2568 |
| 207 | Ga0068851_10123421 | 3300005834 | Bacteria | 1394 |
| 208 | Ga0068863_100003770 | 3300005841 | Bacteria | 14990 |
| 209 | Ga0068863_100014935 | 3300005841 | Bacteria | 7459 |
| 210 | Ga0068863_100097788 | 3300005841 | Bacteria | 2788 |
| 211 | Ga0068863_100125321 | 3300005841 | Bacteria | 2450 |
| 212 | Ga0068858_100025779 | 3300005842 | Bacteria | 5469 |
| 213 | Ga0068858_100041345 | 3300005842 | Bacteria | 4275 |
| 214 | Ga0068858_100061421 | 3300005842 | Bacteria | 3474 |
| 215 | Ga0068858_100192228 | 3300005842 | Bacteria | 1928 |
| 216 | Ga0068860_100001686 | 3300005843 | Bacteria | 23599 |
| 217 | Ga0068860_100016439 | 3300005843 | Bacteria | 7214 |
| 218 | Ga0068860_100115760 | 3300005843 | Bacteria | 2564 |
| 219 | Ga0068862_100003296 | 3300005844 | Bacteria | 13962 |
| 220 | Ga0068862_100028968 | 3300005844 | Bacteria | 4665 |
| 221 | Ga0068862_100084683 | 3300005844 | Bacteria | 2755 |
| 222 | Ga0068862_100101303 | 3300005844 | Bacteria | 2519 |
| 223 | Ga0068862_100205961 | 3300005844 | Bacteria | 1775 |
| 224 | Ga0097621_100248444 | 3300006237 | Bacteria | 1557 |
| 225 | Ga0068871_100034709 | 3300006358 | Bacteria | 4004 |
| 226 | Ga0068871_100275624 | 3300006358 | Bacteria | 1470 |
| 227 | Ga0075433_10042385 | 3300006852 | Bacteria | 3948 |
| 228 | Ga0075434_100493188 | 3300006871 | Bacteria | 1246 |
| 229 | Ga0068865_100003247 | 3300006881 | Bacteria | 9738 |
| 230 | Ga0097620_100000778 | 3300006931 | Bacteria | 32222 |
| 231 | Ga0097620_100065654 | 3300006931 | Bacteria | 3662 |
| 232 | Ga0097620_100231940 | 3300006931 | Bacteria | 1934 |
| 233 | Ga0105240_10020736 | 3300009093 | Bacteria | 8756 |
| 234 | Ga0105240_10020959 | 3300009093 | Bacteria | 8701 |
| 235 | Ga0105240_10076614 | 3300009093 | Bacteria | 4122 |
| 236 | Ga0105240_10117149 | 3300009093 | Bacteria | 3212 |
| 237 | Ga0105240_10213278 | 3300009093 | Bacteria | 2254 |
| 238 | Ga0105240_10451278 | 3300009093 | Unclassified | 1439 |
| 239 | Ga0105245_10000326 | 3300009098 | Bacteria | 44899 |
| 240 | Ga0105243_10073888 | 3300009148 | Bacteria | 2764 |
| 241 | Ga0105243_10327085 | 3300009148 | Bacteria | 1399 |
| 242 | Ga0105248_10000159 | 3300009177 | Bacteria | 78504 |
| 243 | Ga0105248_10001489 | 3300009177 | Bacteria | 26067 |
| 244 | Ga0105248_10002100 | 3300009177 | Bacteria | 22075 |
| 245 | Ga0105248_10005569 | 3300009177 | Bacteria | 13842 |
| 246 | Ga0105248_10028455 | 3300009177 | Bacteria | 6225 |
| 247 | Ga0105248_10100588 | 3300009177 | Bacteria | 3258 |
| 248 | Ga0105248_10181321 | 3300009177 | Bacteria | 2373 |
| 249 | Ga0105248_10288955 | 3300009177 | Bacteria | 1846 |
| 250 | Ga0105237_10010341 | 3300009545 | Bacteria | 9936 |
| 251 | Ga0105237_10014626 | 3300009545 | Bacteria | 8197 |
| 252 | Ga0105238_10015768 | 3300009551 | Bacteria | 7650 |
| 253 | Ga0105238_10037553 | 3300009551 | Bacteria | 4923 |
| 254 | Ga0105238_10879745 | 3300009551 | Bacteria | 914 |
| 255 | Ga0105239_10290316 | 3300010375 | Bacteria | 1842 |
| 256 | Ga0105239_10341130 | 3300010375 | Bacteria | 1691 |
| 257 | Ga0105246_10027780 | 3300011119 | Bacteria | 3712 |
| 258 | Ga0105246_10037164 | 3300011119 | Bacteria | 3267 |
| 259 | Ga0157373_10008452 | 3300013100 | Bacteria | 7644 |
| 260 | Ga0157373_10016885 | 3300013100 | Bacteria | 5323 |
| 261 | Ga0157373_10018178 | 3300013100 | Bacteria | 5120 |
| 262 | Ga0157373_10029984 | 3300013100 | Bacteria | 3915 |
| 263 | Ga0157373_10105922 | 3300013100 | Bacteria | 1977 |
| 264 | Ga0157371_10000784 | 3300013102 | Bacteria | 36573 |
| 265 | Ga0157371_10018899 | 3300013102 | Bacteria | 5090 |
| 266 | Ga0157371_10019495 | 3300013102 | Bacteria | 5002 |
| 267 | Ga0157371_10026498 | 3300013102 | Bacteria | 4213 |
| 268 | Ga0157371_10034504 | 3300013102 | Bacteria | 3628 |
| 269 | Ga0157371_10037050 | 3300013102 | Bacteria | 3493 |
| 270 | Ga0157370_10016872 | 3300013104 | Bacteria | 7381 |
| 271 | Ga0157370_10040402 | 3300013104 | Bacteria | 4504 |
| 272 | Ga0157370_10047042 | 3300013104 | Bacteria | 4136 |
| 273 | Ga0157370_10051983 | 3300013104 | Bacteria | 3912 |
| 274 | Ga0157369_10018890 | 3300013105 | Bacteria | 7724 |
| 275 | Ga0157369_10033440 | 3300013105 | Bacteria | 5651 |
| 276 | Ga0157369_10063148 | 3300013105 | Bacteria | 3991 |
| 277 | Ga0157369_10067142 | 3300013105 | Bacteria | 3857 |
| 278 | Ga0157369_10077710 | 3300013105 | Bacteria | 3557 |
| 279 | Ga0157374_10080450 | 3300013296 | Bacteria | 3090 |
| 280 | Ga0163162_10032032 | 3300013306 | Bacteria | 5218 |
| 281 | Ga0163162_10256575 | 3300013306 | Bacteria | 1880 |
| 282 | Ga0163162_10530305 | 3300013306 | Bacteria | 1307 |
| 283 | Ga0157372_10007786 | 3300013307 | Bacteria | 11380 |
| 284 | Ga0157372_10008989 | 3300013307 | Bacteria | 10620 |
| 285 | Ga0157372_10135004 | 3300013307 | Bacteria | 2841 |
| 286 | Ga0157372_10200313 | 3300013307 | Bacteria | 2312 |
| 287 | Ga0157372_10375236 | 3300013307 | Bacteria | 1657 |
| 288 | Ga0157372_10400669 | 3300013307 | Unclassified | 1599 |
| 289 | Ga0157375_10066623 | 3300013308 | Bacteria | 3596 |
| 290 | Ga0157375_10252211 | 3300013308 | Bacteria | 1925 |
| 291 | Ga0163163_10000338 | 3300014325 | Bacteria | 45226 |
| 292 | Ga0157377_10011474 | 3300014745 | Bacteria | 4424 |
| 293 | Ga0157377_10031247 | 3300014745 | Bacteria | 2892 |
| 294 | Ga0157379_10049930 | 3300014968 | Bacteria | 3735 |
| 295 | Ga0157379_10174679 | 3300014968 | Bacteria | 1939 |
| 296 | Ga0207697_10000584 | 3300025315 | Bacteria | 20797 |
| 297 | Ga0207697_10015235 | 3300025315 | Bacteria | 3178 |
| 298 | Ga0207656_10011341 | 3300025321 | Bacteria | 3366 |
| 299 | Ga0207656_10054052 | 3300025321 | Bacteria | 1744 |
| 300 | Ga0207656_10060834 | 3300025321 | Bacteria | 1656 |
| 301 | Ga0207688_10004411 | 3300025901 | Bacteria | 7657 |
| 302 | Ga0207680_10089196 | 3300025903 | Bacteria | 1957 |
| 303 | Ga0207647_10000575 | 3300025904 | Bacteria | 28658 |
| 304 | Ga0207647_10002145 | 3300025904 | Bacteria | 15075 |
| 305 | Ga0207647_10002864 | 3300025904 | Bacteria | 12995 |
| 306 | Ga0207647_10048512 | 3300025904 | Bacteria | 2636 |
| 307 | Ga0207645_10001233 | 3300025907 | Bacteria | 21061 |
| 308 | Ga0207645_10016623 | 3300025907 | Bacteria | 4867 |
| 309 | Ga0207645_10127403 | 3300025907 | Bacteria | 1655 |
| 310 | Ga0207705_10000260 | 3300025909 | Bacteria | 51366 |
| 311 | Ga0207705_10011481 | 3300025909 | Bacteria | 6406 |
| 312 | Ga0207705_10028624 | 3300025909 | Bacteria | 3971 |
| 313 | Ga0207705_10058153 | 3300025909 | Bacteria | 2789 |
| 314 | Ga0207705_10075537 | 3300025909 | Bacteria | 2448 |
| 315 | Ga0207705_10091117 | 3300025909 | Bacteria | 2233 |
| 316 | Ga0207705_10110629 | 3300025909 | Bacteria | 2029 |
| 317 | Ga0207705_10188285 | 3300025909 | Bacteria | 1559 |
| 318 | Ga0207705_10261340 | 3300025909 | Bacteria | 1322 |
| 319 | Ga0207654_10044761 | 3300025911 | Bacteria | 2515 |
| 320 | Ga0207654_10179262 | 3300025911 | Bacteria | 1381 |
| 321 | Ga0207695_10030232 | 3300025913 | Bacteria | 5966 |
| 322 | Ga0207695_10045302 | 3300025913 | Bacteria | 4670 |
| 323 | Ga0207695_10098076 | 3300025913 | Bacteria | 2930 |
| 324 | Ga0207695_10374386 | 3300025913 | Unclassified | 1310 |
| 325 | Ga0207695_10379682 | 3300025913 | Bacteria | 1299 |
| 326 | Ga0207660_10001336 | 3300025917 | Bacteria | 16498 |
| 327 | Ga0207660_10007267 | 3300025917 | Bacteria | 7167 |
| 328 | Ga0207660_10024318 | 3300025917 | Bacteria | 4101 |
| 329 | Ga0207660_10047363 | 3300025917 | Bacteria | 3039 |
| 330 | Ga0207657_10000031 | 3300025919 | Bacteria | 132167 |
| 331 | Ga0207657_10009316 | 3300025919 | Bacteria | 9888 |
| 332 | Ga0207657_10009915 | 3300025919 | Bacteria | 9533 |
| 333 | Ga0207657_10018812 | 3300025919 | Bacteria | 6578 |
| 334 | Ga0207657_10020134 | 3300025919 | Bacteria | 6313 |
| 335 | Ga0207657_10024861 | 3300025919 | Bacteria | 5536 |
| 336 | Ga0207657_10033201 | 3300025919 | Bacteria | 4654 |
| 337 | Ga0207657_10048214 | 3300025919 | Bacteria | 3720 |
| 338 | Ga0207657_10054956 | 3300025919 | Bacteria | 3441 |
| 339 | Ga0207657_10068067 | 3300025919 | Bacteria | 3026 |
| 340 | Ga0207657_10166895 | 3300025919 | Bacteria | 1785 |
| 341 | Ga0207657_10249157 | 3300025919 | Bacteria | 1416 |
| 342 | Ga0207649_10000394 | 3300025920 | Bacteria | 32788 |
| 343 | Ga0207649_10045738 | 3300025920 | Bacteria | 2685 |
| 344 | Ga0207649_10113254 | 3300025920 | Bacteria | 1817 |
| 345 | Ga0207649_10125389 | 3300025920 | Bacteria | 1737 |
| 346 | Ga0207652_10186861 | 3300025921 | Bacteria | 1863 |
| 347 | Ga0207652_10216234 | 3300025921 | Bacteria | 1726 |
| 348 | Ga0207681_10001333 | 3300025923 | Bacteria | 15917 |
| 349 | Ga0207681_10096305 | 3300025923 | Bacteria | 2124 |
| 350 | Ga0207694_10000526 | 3300025924 | Bacteria | 34586 |
| 351 | Ga0207694_10003458 | 3300025924 | Bacteria | 12548 |
| 352 | Ga0207650_10061475 | 3300025925 | Bacteria | 2805 |
| 353 | Ga0207650_10147841 | 3300025925 | Unclassified | 1852 |
| 354 | Ga0207650_10412426 | 3300025925 | Bacteria | 1120 |
| 355 | Ga0207687_10007615 | 3300025927 | Bacteria | 7120 |
| 356 | Ga0207644_10000941 | 3300025931 | Bacteria | 18539 |
| 357 | Ga0207644_10000954 | 3300025931 | Bacteria | 18456 |
| 358 | Ga0207644_10014636 | 3300025931 | Bacteria | 5254 |
| 359 | Ga0207690_10000382 | 3300025932 | Bacteria | 29300 |
| 360 | Ga0207690_10003206 | 3300025932 | Bacteria | 9816 |
| 361 | Ga0207690_10046076 | 3300025932 | Bacteria | 2886 |
| 362 | Ga0207690_10054025 | 3300025932 | Bacteria | 2698 |
| 363 | Ga0207690_10054634 | 3300025932 | Bacteria | 2686 |
| 364 | Ga0207690_10345503 | 3300025932 | Bacteria | 1175 |
| 365 | Ga0207706_10000028 | 3300025933 | Bacteria | 149092 |
| 366 | Ga0207706_10000171 | 3300025933 | Bacteria | 72122 |
| 367 | Ga0207706_10005399 | 3300025933 | Bacteria | 11913 |
| 368 | Ga0207706_10022887 | 3300025933 | Bacteria | 5608 |
| 369 | Ga0207706_10037286 | 3300025933 | Bacteria | 4317 |
| 370 | Ga0207706_10072220 | 3300025933 | Bacteria | 3035 |
| 371 | Ga0207709_10103546 | 3300025935 | Bacteria | 1887 |
| 372 | Ga0207670_10032192 | 3300025936 | Bacteria | 3370 |
| 373 | Ga0207704_10006692 | 3300025938 | Bacteria | 5398 |
| 374 | Ga0207691_10001864 | 3300025940 | Bacteria | 20610 |
| 375 | Ga0207691_10045452 | 3300025940 | Bacteria | 4036 |
| 376 | Ga0207691_10074323 | 3300025940 | Bacteria | 3066 |
| 377 | Ga0207711_10001375 | 3300025941 | Bacteria | 22908 |
| 378 | Ga0207711_10005966 | 3300025941 | Bacteria | 10298 |
| 379 | Ga0207711_10027623 | 3300025941 | Bacteria | 4768 |
| 380 | Ga0207711_10030857 | 3300025941 | Bacteria | 4522 |
| 381 | Ga0207711_10039426 | 3300025941 | Bacteria | 4018 |
| 382 | Ga0207711_10125412 | 3300025941 | Bacteria | 2296 |
| 383 | Ga0207689_10000092 | 3300025942 | Bacteria | 73254 |
| 384 | Ga0207689_10083550 | 3300025942 | Bacteria | 2625 |
| 385 | Ga0207661_10003597 | 3300025944 | Bacteria | 10780 |
| 386 | Ga0207661_10212496 | 3300025944 | Bacteria | 1706 |
| 387 | Ga0207679_10000129 | 3300025945 | Bacteria | 61477 |
| 388 | Ga0207679_10002034 | 3300025945 | Bacteria | 12542 |
| 389 | Ga0207679_10017763 | 3300025945 | Bacteria | 4752 |
| 390 | Ga0207679_10032098 | 3300025945 | Bacteria | 3683 |
| 391 | Ga0207667_10000357 | 3300025949 | Bacteria | 62034 |
| 392 | Ga0207667_10025870 | 3300025949 | Bacteria | 6420 |
| 393 | Ga0207667_10047594 | 3300025949 | Bacteria | 4538 |
| 394 | Ga0207667_10053034 | 3300025949 | Bacteria | 4268 |
| 395 | Ga0207667_10056916 | 3300025949 | Bacteria | 4105 |
| 396 | Ga0207667_10143983 | 3300025949 | Bacteria | 2454 |
| 397 | Ga0207667_10153757 | 3300025949 | Bacteria | 2367 |
| 398 | Ga0207667_10167848 | 3300025949 | Bacteria | 2256 |
| 399 | Ga0207667_10326287 | 3300025949 | Bacteria | 1567 |
| 400 | Ga0207651_10000176 | 3300025960 | Bacteria | 27858 |
| 401 | Ga0207651_10026221 | 3300025960 | Bacteria | 3636 |
| 402 | Ga0207651_10203266 | 3300025960 | Bacteria | 1589 |
| 403 | Ga0207712_10000269 | 3300025961 | Bacteria | 50416 |
| 404 | Ga0207668_10000080 | 3300025972 | Bacteria | 72198 |
| 405 | Ga0207668_10116835 | 3300025972 | Bacteria | 2012 |
| 406 | Ga0207640_10000922 | 3300025981 | Bacteria | 16485 |
| 407 | Ga0207640_10001385 | 3300025981 | Bacteria | 13123 |
| 408 | Ga0207640_10008786 | 3300025981 | Bacteria | 5622 |
| 409 | Ga0207640_10128026 | 3300025981 | Bacteria | 1831 |
| 410 | Ga0207640_10172026 | 3300025981 | Unclassified | 1615 |
| 411 | Ga0207658_10006798 | 3300025986 | Bacteria | 7792 |
| 412 | Ga0207658_10036095 | 3300025986 | Bacteria | 3543 |
| 413 | Ga0207658_10060055 | 3300025986 | Bacteria | 2835 |
| 414 | Ga0207658_10087251 | 3300025986 | Bacteria | 2409 |
| 415 | Ga0207658_10117234 | 3300025986 | Bacteria | 2116 |
| 416 | Ga0207677_10057650 | 3300026023 | Bacteria | 2668 |
| 417 | Ga0207677_10248911 | 3300026023 | Bacteria | 1442 |
| 418 | Ga0207703_10009105 | 3300026035 | Bacteria | 7817 |
| 419 | Ga0207703_10046172 | 3300026035 | Bacteria | 3507 |
| 420 | Ga0207703_10066349 | 3300026035 | Bacteria | 2969 |
| 421 | Ga0207639_10000131 | 3300026041 | Bacteria | 54681 |
| 422 | Ga0207639_10000608 | 3300026041 | Bacteria | 24669 |
| 423 | Ga0207639_10003016 | 3300026041 | Bacteria | 11334 |
| 424 | Ga0207639_10028417 | 3300026041 | Bacteria | 4083 |
| 425 | Ga0207639_10156966 | 3300026041 | Bacteria | 1912 |
| 426 | Ga0207639_10179217 | 3300026041 | Bacteria | 1801 |
| 427 | Ga0207678_10000198 | 3300026067 | Bacteria | 52573 |
| 428 | Ga0207678_10001415 | 3300026067 | Bacteria | 21990 |
| 429 | Ga0207678_10017221 | 3300026067 | Bacteria | 6344 |
| 430 | Ga0207678_10019267 | 3300026067 | Bacteria | 5992 |
| 431 | Ga0207678_10025287 | 3300026067 | Bacteria | 5183 |
| 432 | Ga0207678_10027353 | 3300026067 | Bacteria | 4974 |
| 433 | Ga0207678_10114561 | 3300026067 | Bacteria | 2300 |
| 434 | Ga0207702_10000247 | 3300026078 | Bacteria | 62873 |
| 435 | Ga0207702_10044203 | 3300026078 | Bacteria | 3743 |
| 436 | Ga0207702_10046137 | 3300026078 | Bacteria | 3667 |
| 437 | Ga0207702_10377081 | 3300026078 | Bacteria | 1363 |
| 438 | Ga0207702_10411854 | 3300026078 | Bacteria | 1305 |
| 439 | Ga0207641_10046546 | 3300026088 | Bacteria | 3656 |
| 440 | Ga0207641_10118141 | 3300026088 | Bacteria | 2362 |
| 441 | Ga0207641_10152950 | 3300026088 | Bacteria | 2091 |
| 442 | Ga0207648_10008297 | 3300026089 | Bacteria | 10086 |
| 443 | Ga0207648_10008887 | 3300026089 | Bacteria | 9672 |
| 444 | Ga0207648_10017502 | 3300026089 | Bacteria | 6518 |
| 445 | Ga0207676_10004385 | 3300026095 | Bacteria | 9979 |
| 446 | Ga0207676_10269919 | 3300026095 | Bacteria | 1540 |
| 447 | Ga0207676_10297382 | 3300026095 | Unclassified | 1472 |
| 448 | Ga0207674_10010569 | 3300026116 | Bacteria | 10444 |
| 449 | Ga0207674_10014969 | 3300026116 | Bacteria | 8544 |
| 450 | Ga0207674_10016447 | 3300026116 | Bacteria | 8097 |
| 451 | Ga0207674_10018937 | 3300026116 | Bacteria | 7464 |
| 452 | Ga0207674_10020590 | 3300026116 | Bacteria | 7122 |
| 453 | Ga0207674_10053575 | 3300026116 | Bacteria | 4111 |
| 454 | Ga0207674_10064490 | 3300026116 | Bacteria | 3695 |
| 455 | Ga0207674_10064900 | 3300026116 | Bacteria | 3682 |
| 456 | Ga0207674_10068894 | 3300026116 | Bacteria | 3559 |
| 457 | Ga0207674_10160076 | 3300026116 | Bacteria | 2206 |
| 458 | Ga0207674_10297793 | 3300026116 | Bacteria | 1562 |
| 459 | Ga0207675_100378306 | 3300026118 | Bacteria | 1392 |
| 460 | Ga0207698_10001888 | 3300026142 | Bacteria | 12271 |
| 461 | Ga0207698_10006575 | 3300026142 | Bacteria | 7267 |
| 462 | Ga0207698_10014500 | 3300026142 | Bacteria | 5242 |
| 463 | Ga0207698_10030984 | 3300026142 | Bacteria | 3855 |
| 464 | Ga0207698_10108543 | 3300026142 | Bacteria | 2320 |
| 465 | Ga0268266_10000433 | 3300028379 | Bacteria | 62887 |
| 466 | Ga0268266_10010715 | 3300028379 | Bacteria | 7988 |
| 467 | Ga0268266_10026216 | 3300028379 | Bacteria | 4959 |
| 468 | Ga0268266_10040393 | 3300028379 | Bacteria | 3976 |
| 469 | Ga0268266_10052988 | 3300028379 | Bacteria | 3485 |
| 470 | Ga0268266_10078633 | 3300028379 | Bacteria | 2870 |
| 471 | Ga0268266_10162543 | 3300028379 | Bacteria | 2021 |
| 472 | Ga0268265_10002770 | 3300028380 | Bacteria | 12931 |
| 473 | Ga0268265_10026121 | 3300028380 | Bacteria | 4152 |
| 474 | Ga0268265_10073709 | 3300028380 | Bacteria | 2667 |
| 475 | Ga0268265_10156824 | 3300028380 | Bacteria | 1927 |
| 476 | Ga0268265_10182676 | 3300028380 | Bacteria | 1803 |
| 477 | Ga0268264_10000567 | 3300028381 | Bacteria | 45270 |
| 478 | Ga0268264_10003351 | 3300028381 | Bacteria | 13846 |
| 479 | Ga0268264_10005259 | 3300028381 | Bacteria | 10956 |
| 480 | Ga0268264_10143383 | 3300028381 | Bacteria | 2133 |
| 481 | Ga0307410_10003819 | 3300031852 | Bacteria | 7656 |
| 482 | Ga0307410_10262960 | 3300031852 | Bacteria | 1346 |
| 483 | Ga0307406_10018726 | 3300031901 | Bacteria | 4050 |
| 484 | Ga0307407_10004615 | 3300031903 | Bacteria | 5877 |
| 485 | Ga0307412_10067038 | 3300031911 | Bacteria | 2435 |
| 486 | Ga0307409_100002843 | 3300031995 | Bacteria | 9157 |
| 487 | Ga0307409_100028700 | 3300031995 | Bacteria | 3969 |
| 488 | Ga0307409_100090561 | 3300031995 | Bacteria | 2504 |
| 489 | Ga0307409_100152813 | 3300031995 | Bacteria | 2007 |
| 490 | Ga0307416_100043719 | 3300032002 | Bacteria | 3510 |
| 491 | Ga0307414_10015027 | 3300032004 | Bacteria | 4663 |
| 492 | Ga0307414_10044338 | 3300032004 | Bacteria | 3036 |
| 493 | Ga0307411_10011439 | 3300032005 | Bacteria | 4790 |
| 494 | Ga0307411_10011531 | 3300032005 | Bacteria | 4777 |
| 495 | Ga0307411_10122113 | 3300032005 | Bacteria | 1887 |
| 496 | Ga0307415_100017152 | 3300032126 | Bacteria | 4335 |
| 497 | Ga0307415_100018950 | 3300032126 | Bacteria | 4168 |
| 498 | Ga0373928_0026956 | 3300035084 | Bacteria | 1248 |
| 499 | Ga0373934_0080594 | 3300035086 | Bacteria | 1308 |
| 500 | Ga0373949_0034273 | 3300035090 | Bacteria | 1223 |
| 501 | Ga0373954_0013710 | 3300035118 | Bacteria | 3612 |
| 502 | Ga0373960_0003919 | 3300035121 | Bacteria | 3393 |
| 503 | Ga0373943_0003195 | 3300035170 | Bacteria | 7432 |
| 504 | Ga0373955_0017242 | 3300035172 | Bacteria | 3570 |
| 505 | Ga0373933_0117916 | 3300035724 | Bacteria | 1660 |
| 506 | Ga0373937_0004086 | 3300036401 | Bacteria | 12375 |
| 507 | Ga0395899_0004324 | 3300037312 | Bacteria | 11091 |
| 508 | Ga0395899_0012008 | 3300037312 | Bacteria | 6636 |
| 509 | Ga0395899_0015712 | 3300037312 | Bacteria | 5772 |
| 510 | Ga0395899_0017880 | 3300037312 | Bacteria | 5396 |
| 511 | Ga0395899_0019845 | 3300037312 | Bacteria | 5100 |
| 512 | Ga0395899_0052302 | 3300037312 | Bacteria | 3028 |
| 513 | Ga0395899_0083237 | 3300037312 | Bacteria | 2327 |
| 514 | Ga0395899_0101568 | 3300037312 | Bacteria | 2075 |
| 515 | Ga0395899_0113890 | 3300037312 | Bacteria | 1942 |
| 516 | Ga0395899_0227087 | 3300037312 | Bacteria | 1291 |
| 517 | Ga0395900_0008912 | 3300037418 | Bacteria | 10293 |
| 518 | Ga0395900_0016439 | 3300037418 | Bacteria | 7544 |
| 519 | Ga0395900_0020464 | 3300037418 | Bacteria | 6754 |
| 520 | Ga0395900_0023784 | 3300037418 | Bacteria | 6268 |
| 521 | Ga0395900_0032306 | 3300037418 | Bacteria | 5381 |
| 522 | Ga0395900_0051071 | 3300037418 | Bacteria | 4259 |
| 523 | Ga0395900_0073975 | 3300037418 | Bacteria | 3503 |
| 524 | Ga0395900_0147255 | 3300037418 | Bacteria | 2407 |
| 525 | Ga0395900_0207884 | 3300037418 | Bacteria | 1977 |
| 526 | Ga0395900_0259880 | 3300037418 | Bacteria | 1735 |
| 527 | Ga0395900_0647020 | 3300037418 | Bacteria | 994 |
| 528 | Ga0395898_0013212 | 3300037466 | Bacteria | 8506 |
| 529 | Ga0395898_0045666 | 3300037466 | Bacteria | 4305 |
| 530 | Ga0395898_0086695 | 3300037466 | Bacteria | 3017 |
| 531 | Ga0395898_0107895 | 3300037466 | Bacteria | 2670 |
| 532 | Ga0395898_0113668 | 3300037466 | Bacteria | 2594 |
| 533 | Ga0395898_0171290 | 3300037466 | Bacteria | 2075 |
| 534 | Ga0395898_0217232 | 3300037466 | Bacteria | 1824 |
| 535 | Ga0395905_0000104 | 3300037471 | Bacteria | 141965 |
| 536 | Ga0395905_0000974 | 3300037471 | Bacteria | 36725 |
| 537 | Ga0395905_0010192 | 3300037471 | Bacteria | 9158 |
| 538 | Ga0395905_0011956 | 3300037471 | Bacteria | 8368 |
| 539 | Ga0395905_0037894 | 3300037471 | Bacteria | 4524 |
| 540 | Ga0395905_0044957 | 3300037471 | Bacteria | 4142 |
| 541 | Ga0395905_0070723 | 3300037471 | Bacteria | 3270 |
| 542 | Ga0395905_0106127 | 3300037471 | Bacteria | 2638 |
| 543 | Ga0395905_0126104 | 3300037471 | Bacteria | 2407 |
| 544 | Ga0395905_0165732 | 3300037471 | Bacteria | 2076 |
| 545 | Ga0395905_0272820 | 3300037471 | Bacteria | 1577 |
| 546 | Ga0395905_0286183 | 3300037471 | Bacteria | 1535 |
| 547 | Ga0395905_0305990 | 3300037471 | Bacteria | 1477 |
| 548 | Ga0395905_0585597 | 3300037471 | Bacteria | 1017 |
| 549 | Ga0395901_0000276 | 3300038443 | Bacteria | 63580 |
| 550 | Ga0395901_0010013 | 3300038443 | Bacteria | 9610 |
| 551 | Ga0395901_0028542 | 3300038443 | Bacteria | 5738 |
| 552 | Ga0395901_0043484 | 3300038443 | Bacteria | 4660 |
| 553 | Ga0395901_0102924 | 3300038443 | Bacteria | 2996 |
| 554 | Ga0395901_0130050 | 3300038443 | Bacteria | 2645 |
| 555 | Ga0395901_0165053 | 3300038443 | Bacteria | 2325 |
| 556 | Ga0395901_0295097 | 3300038443 | Bacteria | 1681 |
| 557 | Ga0439464_0005747 | 3300042439 | Bacteria | 3217 |
| 558 | Ga0466966_0030220 | 3300044684 | Bacteria | 3518 |
| 559 | Ga0466966_0213391 | 3300044684 | Bacteria | 1166 |
| 560 | Ga0466966_0215016 | 3300044684 | Bacteria | 1161 |
| 561 | Ga0466961_0007560 | 3300044693 | Bacteria | 6917 |
| 562 | Ga0466961_0115074 | 3300044693 | Bacteria | 1690 |
| 563 | Ga0466963_0000971 | 3300044694 | Bacteria | 14730 |
| 564 | Ga0466963_0009670 | 3300044694 | Bacteria | 5813 |
| 565 | Ga0466963_0014808 | 3300044694 | Bacteria | 4816 |
| 566 | Ga0466963_0015010 | 3300044694 | Bacteria | 4787 |
| 567 | Ga0466963_0031383 | 3300044694 | Bacteria | 3435 |
| 568 | Ga0466963_0070932 | 3300044694 | Bacteria | 2344 |
| 569 | Ga0466963_0092802 | 3300044694 | Bacteria | 2057 |
| 570 | Ga0466963_0214913 | 3300044694 | Bacteria | 1346 |
| 571 | Ga0466964_0102420 | 3300044706 | Bacteria | 1264 |
| 572 | Ga0466971_0093278 | 3300044719 | Bacteria | 1379 |
| 573 | Ga0466957_0002813 | 3300044842 | Bacteria | 9412 |
| 574 | Ga0466957_0011404 | 3300044842 | Bacteria | 5128 |
| 575 | Ga0466957_0184479 | 3300044842 | Bacteria | 1364 |
| 576 | Ga0466959_0078525 | 3300045049 | Bacteria | 2380 |
| 577 | Ga0466959_0204287 | 3300045049 | Bacteria | 1375 |
| 578 | Ga0466967_0000483 | 3300045976 | Bacteria | 19324 |
| 579 | Ga0466967_0002578 | 3300045976 | Bacteria | 11378 |
| 580 | Ga0466967_0005574 | 3300045976 | Bacteria | 8749 |
| 581 | Ga0466967_0021495 | 3300045976 | Bacteria | 5243 |
| 582 | Ga0466967_0023653 | 3300045976 | Bacteria | 5039 |
| 583 | Ga0466967_0052339 | 3300045976 | Bacteria | 3583 |
| 584 | Ga0466967_0089806 | 3300045976 | Bacteria | 2790 |
| 585 | Ga0466967_0154388 | 3300045976 | Bacteria | 2149 |
| 586 | Ga0466967_0367706 | 3300045976 | Bacteria | 1394 |
| 587 | Ga0495585_0094446 | 3300046492 | Bacteria | 1607 |
| 588 | Ga0495668_0009438 | 3300046616 | Bacteria | 5994 |
| 589 | Ga0495669_0041904 | 3300046684 | Bacteria | 2034 |
| 590 | Ga0495669_0059759 | 3300046684 | Bacteria | 1722 |
| 591 | Ga0495669_0092321 | 3300046684 | Bacteria | 1399 |
| 592 | Ga0495669_0107845 | 3300046684 | Unclassified | 1298 |
| 593 | Ga0495677_0022636 | 3300047445 | Bacteria | 2280 |
| 594 | Ga0495602_0051913 | 3300048088 | Bacteria | 3647 |
| 595 | Ga0496101_0368104 | 3300048904 | Bacteria | 1130 |
| 596 | Ga0496104_0441116 | 3300048907 | Bacteria | 1214 |
| 597 | Ga0496106_0090688 | 3300048909 | Bacteria | 2359 |
| 598 | Ga0496107_0132781 | 3300048910 | Bacteria | 1838 |
| 599 | Ga0496108_0217863 | 3300048911 | Bacteria | 1658 |
| 600 | Ga0496109_0158233 | 3300048912 | Bacteria | 2122 |
| 601 | Ga0496110_0023530 | 3300048913 | Bacteria | 5241 |
| 602 | Ga0496110_0038404 | 3300048913 | Bacteria | 4166 |
| 603 | Ga0496110_0119677 | 3300048913 | Bacteria | 2372 |
| 604 | Ga0496110_0394851 | 3300048913 | Bacteria | 1261 |
| 605 | Ga0496111_0009804 | 3300048914 | Bacteria | 6402 |
| 606 | Ga0496112_0004292 | 3300048915 | Bacteria | 12040 |
| 607 | Ga0496112_0018585 | 3300048915 | Bacteria | 6549 |
| 608 | Ga0496113_0002271 | 3300048916 | Bacteria | 11088 |
| 609 | Ga0496113_0049274 | 3300048916 | Bacteria | 3136 |
| 610 | Ga0501070_0044033 | 3300049586 | Bacteria | 3714 |
| 611 | nmdc:mga09592_248854_c1 | 3300050508 | Bacteria | 1540 |
| 612 | Ga0466962_0003571 | 3300061719 | Bacteria | 7408 |
| 613 | Ga0466962_0008051 | 3300061719 | Bacteria | 5053 |
| 614 | Ga0466962_0031717 | 3300061719 | Bacteria | 2530 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_10879745 | Ga0105238_108797452 | 236 |
| 2 | 3300025923 | Ga0207681_10001333 | Ga0207681_1000133312 | 263 |
| 3 | 3300005339 | Ga0070660_100162116 | Ga0070660_1001621162 | 280 |
| 4 | 3300005455 | Ga0070663_100269651 | Ga0070663_1002696511 | 280 |
| 5 | 3300005616 | Ga0068852_100083384 | Ga0068852_1000833843 | 280 |
| 6 | 3300025919 | Ga0207657_10054956 | Ga0207657_100549564 | 280 |
| 7 | 3300037418 | Ga0395900_0259880 | Ga0395900_0259880_150_1082 | 280 |
| 8 | 3300026035 | Ga0207703_10066349 | Ga0207703_100663494 | 286 |
| 9 | 3300031995 | Ga0307409_100028700 | Ga0307409_1000287005 | 291 |
| 10 | 3300005328 | Ga0070676_10113994 | Ga0070676_101139942 | 294 |
| 11 | 3300014745 | Ga0157377_10031247 | Ga0157377_100312471 | 294 |
| 12 | 3300037418 | Ga0395900_0647020 | Ga0395900_0647020_38_958 | 294 |
| 13 | 3300005327 | Ga0070658_10144101 | Ga0070658_101441012 | 295 |
| 14 | 3300005331 | Ga0070670_100085425 | Ga0070670_1000854252 | 295 |
| 15 | 3300005337 | Ga0070682_100070358 | Ga0070682_1000703583 | 295 |
| 16 | 3300005339 | Ga0070660_100090087 | Ga0070660_1000900871 | 295 |
| 17 | 3300005344 | Ga0070661_100105326 | Ga0070661_1001053261 | 295 |
| 18 | 3300005455 | Ga0070663_100006862 | Ga0070663_1000068626 | 295 |
| 19 | 3300005539 | Ga0068853_100171217 | Ga0068853_1001712173 | 295 |
| 20 | 3300005564 | Ga0070664_100003024 | Ga0070664_1000030245 | 295 |
| 21 | 3300005578 | Ga0068854_100031043 | Ga0068854_1000310435 | 295 |
| 22 | 3300005616 | Ga0068852_100033435 | Ga0068852_1000334354 | 295 |
| 23 | 3300005834 | Ga0068851_10003637 | Ga0068851_100036375 | 295 |
| 24 | 3300009177 | Ga0105248_10288955 | Ga0105248_102889552 | 295 |
| 25 | 3300025321 | Ga0207656_10054052 | Ga0207656_100540521 | 295 |
| 26 | 3300025909 | Ga0207705_10011481 | Ga0207705_100114816 | 295 |
| 27 | 3300025919 | Ga0207657_10009316 | Ga0207657_100093165 | 295 |
| 28 | 3300025920 | Ga0207649_10045738 | Ga0207649_100457383 | 295 |
| 29 | 3300025925 | Ga0207650_10061475 | Ga0207650_100614753 | 295 |
| 30 | 3300025932 | Ga0207690_10054634 | Ga0207690_100546342 | 295 |
| 31 | 3300025945 | Ga0207679_10002034 | Ga0207679_1000203411 | 295 |
| 32 | 3300025981 | Ga0207640_10128026 | Ga0207640_101280262 | 295 |
| 33 | 3300026067 | Ga0207678_10001415 | Ga0207678_1000141523 | 295 |
| 34 | 3300044694 | Ga0466963_0070932 | Ga0466963_0070932_37_960 | 295 |
| 35 | 3300005344 | Ga0070661_100258589 | Ga0070661_1002585892 | 296 |
| 36 | 3300025949 | Ga0207667_10153757 | Ga0207667_101537572 | 296 |
| 37 | 3300037312 | Ga0395899_0113890 | Ga0395899_0113890_604_1530 | 296 |
| 38 | 3300037418 | Ga0395900_0051071 | Ga0395900_0051071_2153_3079 | 296 |
| 39 | 3300037471 | Ga0395905_0070723 | Ga0395905_0070723_229_1155 | 296 |
| 40 | 3300038443 | Ga0395901_0295097 | Ga0395901_0295097_155_1081 | 296 |
| 41 | 3300042439 | Ga0439464_0005747 | Ga0439464_0005747_1487_2422 | 296 |
| 42 | 3300001979 | JGI24740J21852_10001942 | JGI24740J21852_100019429 | 297 |
| 43 | 3300001979 | JGI24740J21852_10004163 | JGI24740J21852_100041634 | 297 |
| 44 | 3300001989 | JGI24739J22299_10000129 | JGI24739J22299_1000012910 | 297 |
| 45 | 3300001989 | JGI24739J22299_10009892 | JGI24739J22299_100098922 | 297 |
| 46 | 3300001989 | JGI24739J22299_10016522 | JGI24739J22299_100165222 | 297 |
| 47 | 3300001990 | JGI24737J22298_10000357 | JGI24737J22298_100003579 | 297 |
| 48 | 3300001990 | JGI24737J22298_10001447 | JGI24737J22298_100014474 | 297 |
| 49 | 3300001990 | JGI24737J22298_10011049 | JGI24737J22298_100110492 | 297 |
| 50 | 3300001991 | JGI24743J22301_10029843 | JGI24743J22301_100298431 | 297 |
| 51 | 3300002067 | JGI24735J21928_10001481 | JGI24735J21928_100014811 | 297 |
| 52 | 3300002067 | JGI24735J21928_10016264 | JGI24735J21928_100162641 | 297 |
| 53 | 3300002075 | JGI24738J21930_10001003 | JGI24738J21930_100010032 | 297 |
| 54 | 3300002075 | JGI24738J21930_10001350 | JGI24738J21930_100013504 | 297 |
| 55 | 3300005293 | Ga0065715_10013144 | Ga0065715_100131442 | 297 |
| 56 | 3300005293 | Ga0065715_10164070 | Ga0065715_101640702 | 297 |
| 57 | 3300005327 | Ga0070658_10015513 | Ga0070658_100155136 | 297 |
| 58 | 3300005327 | Ga0070658_10017280 | Ga0070658_100172804 | 297 |
| 59 | 3300005327 | Ga0070658_10020535 | Ga0070658_100205357 | 297 |
| 60 | 3300005327 | Ga0070658_10026163 | Ga0070658_100261635 | 297 |
| 61 | 3300005327 | Ga0070658_10034179 | Ga0070658_100341794 | 297 |
| 62 | 3300005327 | Ga0070658_10041456 | Ga0070658_100414564 | 297 |
| 63 | 3300005327 | Ga0070658_10055508 | Ga0070658_100555083 | 297 |
| 64 | 3300005327 | Ga0070658_10082818 | Ga0070658_100828181 | 297 |
| 65 | 3300005327 | Ga0070658_10085845 | Ga0070658_100858452 | 297 |
| 66 | 3300005327 | Ga0070658_10127089 | Ga0070658_101270893 | 297 |
| 67 | 3300005328 | Ga0070676_10044071 | Ga0070676_100440712 | 297 |
| 68 | 3300005328 | Ga0070676_10056188 | Ga0070676_100561882 | 297 |
| 69 | 3300005329 | Ga0070683_100000209 | Ga0070683_10000020934 | 297 |
| 70 | 3300005329 | Ga0070683_100012234 | Ga0070683_1000122344 | 297 |
| 71 | 3300005329 | Ga0070683_100021530 | Ga0070683_1000215305 | 297 |
| 72 | 3300005329 | Ga0070683_100176596 | Ga0070683_1001765962 | 297 |
| 73 | 3300005329 | Ga0070683_100183184 | Ga0070683_1001831842 | 297 |
| 74 | 3300005330 | Ga0070690_100084999 | Ga0070690_1000849993 | 297 |
| 75 | 3300005331 | Ga0070670_100000333 | Ga0070670_10000033331 | 297 |
| 76 | 3300005331 | Ga0070670_100055618 | Ga0070670_1000556183 | 297 |
| 77 | 3300005331 | Ga0070670_100065288 | Ga0070670_1000652883 | 297 |
| 78 | 3300005331 | Ga0070670_100160396 | Ga0070670_1001603962 | 297 |
| 79 | 3300005331 | Ga0070670_100256827 | Ga0070670_1002568272 | 297 |
| 80 | 3300005334 | Ga0068869_100000331 | Ga0068869_10000033111 | 297 |
| 81 | 3300005334 | Ga0068869_100031646 | Ga0068869_1000316463 | 297 |
| 82 | 3300005335 | Ga0070666_10148053 | Ga0070666_101480532 | 297 |
| 83 | 3300005336 | Ga0070680_100000641 | Ga0070680_10000064115 | 297 |
| 84 | 3300005336 | Ga0070680_100013601 | Ga0070680_1000136012 | 297 |
| 85 | 3300005336 | Ga0070680_100019131 | Ga0070680_1000191314 | 297 |
| 86 | 3300005336 | Ga0070680_100019684 | Ga0070680_1000196843 | 297 |
| 87 | 3300005336 | Ga0070680_100202739 | Ga0070680_1002027392 | 297 |
| 88 | 3300005338 | Ga0068868_100000156 | Ga0068868_10000015633 | 297 |
| 89 | 3300005338 | Ga0068868_100041958 | Ga0068868_1000419584 | 297 |
| 90 | 3300005338 | Ga0068868_100086653 | Ga0068868_1000866532 | 297 |
| 91 | 3300005339 | Ga0070660_100012339 | Ga0070660_1000123392 | 297 |
| 92 | 3300005339 | Ga0070660_100015863 | Ga0070660_1000158634 | 297 |
| 93 | 3300005339 | Ga0070660_100022785 | Ga0070660_1000227853 | 297 |
| 94 | 3300005339 | Ga0070660_100024242 | Ga0070660_1000242423 | 297 |
| 95 | 3300005339 | Ga0070660_100045807 | Ga0070660_1000458074 | 297 |
| 96 | 3300005339 | Ga0070660_100099785 | Ga0070660_1000997852 | 297 |
| 97 | 3300005339 | Ga0070660_100123959 | Ga0070660_1001239592 | 297 |
| 98 | 3300005341 | Ga0070691_10061772 | Ga0070691_100617722 | 297 |
| 99 | 3300005344 | Ga0070661_100000452 | Ga0070661_1000004522 | 297 |
| 100 | 3300005344 | Ga0070661_100034706 | Ga0070661_1000347064 | 297 |
| 101 | 3300005344 | Ga0070661_100048731 | Ga0070661_1000487314 | 297 |
| 102 | 3300005345 | Ga0070692_10004588 | Ga0070692_100045884 | 297 |
| 103 | 3300005347 | Ga0070668_100011926 | Ga0070668_1000119262 | 297 |
| 104 | 3300005347 | Ga0070668_100064634 | Ga0070668_1000646343 | 297 |
| 105 | 3300005353 | Ga0070669_100013436 | Ga0070669_1000134363 | 297 |
| 106 | 3300005353 | Ga0070669_100047901 | Ga0070669_1000479013 | 297 |
| 107 | 3300005353 | Ga0070669_100065902 | Ga0070669_1000659022 | 297 |
| 108 | 3300005353 | Ga0070669_100362111 | Ga0070669_1003621111 | 297 |
| 109 | 3300005354 | Ga0070675_100096026 | Ga0070675_1000960263 | 297 |
| 110 | 3300005354 | Ga0070675_100112604 | Ga0070675_1001126043 | 297 |
| 111 | 3300005354 | Ga0070675_100231664 | Ga0070675_1002316642 | 297 |
| 112 | 3300005355 | Ga0070671_100000322 | Ga0070671_1000003224 | 297 |
| 113 | 3300005355 | Ga0070671_100013820 | Ga0070671_1000138207 | 297 |
| 114 | 3300005355 | Ga0070671_100014229 | Ga0070671_1000142294 | 297 |
| 115 | 3300005355 | Ga0070671_100016892 | Ga0070671_1000168924 | 297 |
| 116 | 3300005355 | Ga0070671_100082537 | Ga0070671_1000825372 | 297 |
| 117 | 3300005355 | Ga0070671_100134244 | Ga0070671_1001342443 | 297 |
| 118 | 3300005355 | Ga0070671_100178128 | Ga0070671_1001781282 | 297 |
| 119 | 3300005356 | Ga0070674_100080729 | Ga0070674_1000807292 | 297 |
| 120 | 3300005364 | Ga0070673_100000249 | Ga0070673_10000024923 | 297 |
| 121 | 3300005364 | Ga0070673_100019257 | Ga0070673_1000192574 | 297 |
| 122 | 3300005365 | Ga0070688_100357021 | Ga0070688_1003570211 | 297 |
| 123 | 3300005366 | Ga0070659_100000138 | Ga0070659_10000013830 | 297 |
| 124 | 3300005366 | Ga0070659_100000814 | Ga0070659_1000008147 | 297 |
| 125 | 3300005366 | Ga0070659_100001062 | Ga0070659_1000010629 | 297 |
| 126 | 3300005366 | Ga0070659_100012745 | Ga0070659_1000127455 | 297 |
| 127 | 3300005366 | Ga0070659_100026588 | Ga0070659_1000265884 | 297 |
| 128 | 3300005366 | Ga0070659_100040055 | Ga0070659_1000400551 | 297 |
| 129 | 3300005366 | Ga0070659_100048437 | Ga0070659_1000484372 | 297 |
| 130 | 3300005366 | Ga0070659_100068828 | Ga0070659_1000688283 | 297 |
| 131 | 3300005366 | Ga0070659_100111632 | Ga0070659_1001116323 | 297 |
| 132 | 3300005367 | Ga0070667_100001760 | Ga0070667_10000176016 | 297 |
| 133 | 3300005367 | Ga0070667_100016912 | Ga0070667_1000169125 | 297 |
| 134 | 3300005367 | Ga0070667_100017413 | Ga0070667_1000174134 | 297 |
| 135 | 3300005367 | Ga0070667_100098802 | Ga0070667_1000988023 | 297 |
| 136 | 3300005367 | Ga0070667_100104929 | Ga0070667_1001049293 | 297 |
| 137 | 3300005367 | Ga0070667_100167251 | Ga0070667_1001672512 | 297 |
| 138 | 3300005367 | Ga0070667_100282185 | Ga0070667_1002821852 | 297 |
| 139 | 3300005435 | Ga0070714_100083992 | Ga0070714_1000839923 | 297 |
| 140 | 3300005444 | Ga0070694_100001882 | Ga0070694_1000018823 | 297 |
| 141 | 3300005455 | Ga0070663_100002205 | Ga0070663_10000220511 | 297 |
| 142 | 3300005455 | Ga0070663_100009792 | Ga0070663_1000097921 | 297 |
| 143 | 3300005455 | Ga0070663_100018372 | Ga0070663_1000183724 | 297 |
| 144 | 3300005455 | Ga0070663_100019500 | Ga0070663_1000195003 | 297 |
| 145 | 3300005455 | Ga0070663_100019779 | Ga0070663_1000197794 | 297 |
| 146 | 3300005456 | Ga0070678_100405436 | Ga0070678_1004054362 | 297 |
| 147 | 3300005457 | Ga0070662_100001575 | Ga0070662_10000157515 | 297 |
| 148 | 3300005457 | Ga0070662_100005377 | Ga0070662_1000053777 | 297 |
| 149 | 3300005457 | Ga0070662_100030731 | Ga0070662_1000307312 | 297 |
| 150 | 3300005457 | Ga0070662_100054024 | Ga0070662_1000540243 | 297 |
| 151 | 3300005457 | Ga0070662_100061029 | Ga0070662_1000610292 | 297 |
| 152 | 3300005458 | Ga0070681_10011820 | Ga0070681_100118209 | 297 |
| 153 | 3300005458 | Ga0070681_10063525 | Ga0070681_100635253 | 297 |
| 154 | 3300005458 | Ga0070681_10536926 | Ga0070681_105369261 | 297 |
| 155 | 3300005459 | Ga0068867_100007188 | Ga0068867_1000071886 | 297 |
| 156 | 3300005459 | Ga0068867_100045458 | Ga0068867_1000454582 | 297 |
| 157 | 3300005459 | Ga0068867_100047518 | Ga0068867_1000475183 | 297 |
| 158 | 3300005466 | Ga0070685_10047238 | Ga0070685_100472383 | 297 |
| 159 | 3300005530 | Ga0070679_100035261 | Ga0070679_1000352614 | 297 |
| 160 | 3300005530 | Ga0070679_100048080 | Ga0070679_1000480804 | 297 |
| 161 | 3300005530 | Ga0070679_100062428 | Ga0070679_1000624282 | 297 |
| 162 | 3300005535 | Ga0070684_100004466 | Ga0070684_10000446612 | 297 |
| 163 | 3300005535 | Ga0070684_100133800 | Ga0070684_1001338002 | 297 |
| 164 | 3300005539 | Ga0068853_100001793 | Ga0068853_10000179316 | 297 |
| 165 | 3300005539 | Ga0068853_100003189 | Ga0068853_10000318911 | 297 |
| 166 | 3300005539 | Ga0068853_100011467 | Ga0068853_1000114674 | 297 |
| 167 | 3300005539 | Ga0068853_100016758 | Ga0068853_1000167583 | 297 |
| 168 | 3300005539 | Ga0068853_100020437 | Ga0068853_1000204372 | 297 |
| 169 | 3300005539 | Ga0068853_100039204 | Ga0068853_1000392044 | 297 |
| 170 | 3300005539 | Ga0068853_100063622 | Ga0068853_1000636224 | 297 |
| 171 | 3300005543 | Ga0070672_100004112 | Ga0070672_10000411210 | 297 |
| 172 | 3300005543 | Ga0070672_100004771 | Ga0070672_1000047716 | 297 |
| 173 | 3300005543 | Ga0070672_100064557 | Ga0070672_1000645572 | 297 |
| 174 | 3300005543 | Ga0070672_100097141 | Ga0070672_1000971412 | 297 |
| 175 | 3300005547 | Ga0070693_100000703 | Ga0070693_10000070313 | 297 |
| 176 | 3300005548 | Ga0070665_100004771 | Ga0070665_1000047713 | 297 |
| 177 | 3300005548 | Ga0070665_100005560 | Ga0070665_10000556012 | 297 |
| 178 | 3300005548 | Ga0070665_100011456 | Ga0070665_1000114568 | 297 |
| 179 | 3300005548 | Ga0070665_100014746 | Ga0070665_1000147465 | 297 |
| 180 | 3300005548 | Ga0070665_100016127 | Ga0070665_1000161277 | 297 |
| 181 | 3300005548 | Ga0070665_100039747 | Ga0070665_1000397474 | 297 |
| 182 | 3300005548 | Ga0070665_100072607 | Ga0070665_1000726074 | 297 |
| 183 | 3300005548 | Ga0070665_100082307 | Ga0070665_1000823072 | 297 |
| 184 | 3300005563 | Ga0068855_100000163 | Ga0068855_10000016326 | 297 |
| 185 | 3300005563 | Ga0068855_100035645 | Ga0068855_1000356457 | 297 |
| 186 | 3300005563 | Ga0068855_100065480 | Ga0068855_1000654803 | 297 |
| 187 | 3300005563 | Ga0068855_100106172 | Ga0068855_1001061722 | 297 |
| 188 | 3300005563 | Ga0068855_100156356 | Ga0068855_1001563562 | 297 |
| 189 | 3300005563 | Ga0068855_100366802 | Ga0068855_1003668021 | 297 |
| 190 | 3300005563 | Ga0068855_100559336 | Ga0068855_1005593362 | 297 |
| 191 | 3300005564 | Ga0070664_100000544 | Ga0070664_1000005446 | 297 |
| 192 | 3300005564 | Ga0070664_100009377 | Ga0070664_1000093774 | 297 |
| 193 | 3300005564 | Ga0070664_100014998 | Ga0070664_1000149982 | 297 |
| 194 | 3300005564 | Ga0070664_100028729 | Ga0070664_1000287295 | 297 |
| 195 | 3300005564 | Ga0070664_100072997 | Ga0070664_1000729972 | 297 |
| 196 | 3300005577 | Ga0068857_100000282 | Ga0068857_10000028235 | 297 |
| 197 | 3300005577 | Ga0068857_100006203 | Ga0068857_1000062034 | 297 |
| 198 | 3300005577 | Ga0068857_100017928 | Ga0068857_1000179282 | 297 |
| 199 | 3300005577 | Ga0068857_100023660 | Ga0068857_1000236605 | 297 |
| 200 | 3300005577 | Ga0068857_100059364 | Ga0068857_1000593644 | 297 |
| 201 | 3300005577 | Ga0068857_100102460 | Ga0068857_1001024603 | 297 |
| 202 | 3300005577 | Ga0068857_100149693 | Ga0068857_1001496933 | 297 |
| 203 | 3300005577 | Ga0068857_100186676 | Ga0068857_1001866762 | 297 |
| 204 | 3300005578 | Ga0068854_100001188 | Ga0068854_1000011885 | 297 |
| 205 | 3300005578 | Ga0068854_100005135 | Ga0068854_1000051358 | 297 |
| 206 | 3300005578 | Ga0068854_100006117 | Ga0068854_1000061178 | 297 |
| 207 | 3300005578 | Ga0068854_100012275 | Ga0068854_1000122755 | 297 |
| 208 | 3300005578 | Ga0068854_100012524 | Ga0068854_1000125245 | 297 |
| 209 | 3300005578 | Ga0068854_100047019 | Ga0068854_1000470192 | 297 |
| 210 | 3300005578 | Ga0068854_100179859 | Ga0068854_1001798591 | 297 |
| 211 | 3300005614 | Ga0068856_100000829 | Ga0068856_10000082936 | 297 |
| 212 | 3300005614 | Ga0068856_100008781 | Ga0068856_1000087819 | 297 |
| 213 | 3300005614 | Ga0068856_100009193 | Ga0068856_1000091933 | 297 |
| 214 | 3300005614 | Ga0068856_100054656 | Ga0068856_1000546565 | 297 |
| 215 | 3300005616 | Ga0068852_100003260 | Ga0068852_10000326010 | 297 |
| 216 | 3300005616 | Ga0068852_100004156 | Ga0068852_1000041563 | 297 |
| 217 | 3300005616 | Ga0068852_100010367 | Ga0068852_1000103675 | 297 |
| 218 | 3300005616 | Ga0068852_100013907 | Ga0068852_1000139077 | 297 |
| 219 | 3300005616 | Ga0068852_100018232 | Ga0068852_1000182328 | 297 |
| 220 | 3300005616 | Ga0068852_100051622 | Ga0068852_1000516224 | 297 |
| 221 | 3300005616 | Ga0068852_100364541 | Ga0068852_1003645412 | 297 |
| 222 | 3300005617 | Ga0068859_100000778 | Ga0068859_10000077831 | 297 |
| 223 | 3300005617 | Ga0068859_100065652 | Ga0068859_1000656524 | 297 |
| 224 | 3300005617 | Ga0068859_100231931 | Ga0068859_1002319312 | 297 |
| 225 | 3300005618 | Ga0068864_100006905 | Ga0068864_10000690511 | 297 |
| 226 | 3300005618 | Ga0068864_100032252 | Ga0068864_1000322524 | 297 |
| 227 | 3300005618 | Ga0068864_100091493 | Ga0068864_1000914932 | 297 |
| 228 | 3300005719 | Ga0068861_100302407 | Ga0068861_1003024072 | 297 |
| 229 | 3300005834 | Ga0068851_10012800 | Ga0068851_100128002 | 297 |
| 230 | 3300005834 | Ga0068851_10013684 | Ga0068851_100136843 | 297 |
| 231 | 3300005834 | Ga0068851_10033306 | Ga0068851_100333062 | 297 |
| 232 | 3300005834 | Ga0068851_10123421 | Ga0068851_101234212 | 297 |
| 233 | 3300005841 | Ga0068863_100003770 | Ga0068863_1000037708 | 297 |
| 234 | 3300005841 | Ga0068863_100014935 | Ga0068863_1000149357 | 297 |
| 235 | 3300005841 | Ga0068863_100097788 | Ga0068863_1000977882 | 297 |
| 236 | 3300005841 | Ga0068863_100125321 | Ga0068863_1001253213 | 297 |
| 237 | 3300005842 | Ga0068858_100025779 | Ga0068858_1000257792 | 297 |
| 238 | 3300005842 | Ga0068858_100041345 | Ga0068858_1000413455 | 297 |
| 239 | 3300005842 | Ga0068858_100061421 | Ga0068858_1000614213 | 297 |
| 240 | 3300005842 | Ga0068858_100192228 | Ga0068858_1001922282 | 297 |
| 241 | 3300005843 | Ga0068860_100001686 | Ga0068860_1000016862 | 297 |
| 242 | 3300005843 | Ga0068860_100016439 | Ga0068860_1000164392 | 297 |
| 243 | 3300005843 | Ga0068860_100115760 | Ga0068860_1001157601 | 297 |
| 244 | 3300005844 | Ga0068862_100003296 | Ga0068862_10000329618 | 297 |
| 245 | 3300005844 | Ga0068862_100028968 | Ga0068862_1000289683 | 297 |
| 246 | 3300005844 | Ga0068862_100084683 | Ga0068862_1000846833 | 297 |
| 247 | 3300005844 | Ga0068862_100101303 | Ga0068862_1001013032 | 297 |
| 248 | 3300005844 | Ga0068862_100205961 | Ga0068862_1002059612 | 297 |
| 249 | 3300006237 | Ga0097621_100248444 | Ga0097621_1002484442 | 297 |
| 250 | 3300006358 | Ga0068871_100034709 | Ga0068871_1000347094 | 297 |
| 251 | 3300006358 | Ga0068871_100275624 | Ga0068871_1002756242 | 297 |
| 252 | 3300006852 | Ga0075433_10042385 | Ga0075433_100423853 | 297 |
| 253 | 3300006871 | Ga0075434_100493188 | Ga0075434_1004931882 | 297 |
| 254 | 3300006881 | Ga0068865_100003247 | Ga0068865_1000032475 | 297 |
| 255 | 3300006931 | Ga0097620_100000778 | Ga0097620_1000007785 | 297 |
| 256 | 3300006931 | Ga0097620_100065654 | Ga0097620_1000656544 | 297 |
| 257 | 3300006931 | Ga0097620_100231940 | Ga0097620_1002319402 | 297 |
| 258 | 3300009093 | Ga0105240_10020736 | Ga0105240_100207367 | 297 |
| 259 | 3300009093 | Ga0105240_10020959 | Ga0105240_100209599 | 297 |
| 260 | 3300009093 | Ga0105240_10076614 | Ga0105240_100766144 | 297 |
| 261 | 3300009093 | Ga0105240_10117149 | Ga0105240_101171494 | 297 |
| 262 | 3300009093 | Ga0105240_10213278 | Ga0105240_102132782 | 297 |
| 263 | 3300009093 | Ga0105240_10451278 | Ga0105240_104512782 | 297 |
| 264 | 3300009098 | Ga0105245_10000326 | Ga0105245_1000032618 | 297 |
| 265 | 3300009148 | Ga0105243_10073888 | Ga0105243_100738882 | 297 |
| 266 | 3300009148 | Ga0105243_10327085 | Ga0105243_103270852 | 297 |
| 267 | 3300009177 | Ga0105248_10000159 | Ga0105248_1000015960 | 297 |
| 268 | 3300009177 | Ga0105248_10001489 | Ga0105248_1000148922 | 297 |
| 269 | 3300009177 | Ga0105248_10002100 | Ga0105248_100021008 | 297 |
| 270 | 3300009177 | Ga0105248_10005569 | Ga0105248_1000556912 | 297 |
| 271 | 3300009177 | Ga0105248_10028455 | Ga0105248_100284554 | 297 |
| 272 | 3300009177 | Ga0105248_10100588 | Ga0105248_101005884 | 297 |
| 273 | 3300009177 | Ga0105248_10181321 | Ga0105248_101813213 | 297 |
| 274 | 3300009545 | Ga0105237_10010341 | Ga0105237_1001034111 | 297 |
| 275 | 3300009545 | Ga0105237_10014626 | Ga0105237_100146265 | 297 |
| 276 | 3300009551 | Ga0105238_10015768 | Ga0105238_100157689 | 297 |
| 277 | 3300009551 | Ga0105238_10037553 | Ga0105238_100375535 | 297 |
| 278 | 3300010375 | Ga0105239_10290316 | Ga0105239_102903162 | 297 |
| 279 | 3300010375 | Ga0105239_10341130 | Ga0105239_103411301 | 297 |
| 280 | 3300011119 | Ga0105246_10027780 | Ga0105246_100277802 | 297 |
| 281 | 3300011119 | Ga0105246_10037164 | Ga0105246_100371642 | 297 |
| 282 | 3300013100 | Ga0157373_10008452 | Ga0157373_100084525 | 297 |
| 283 | 3300013100 | Ga0157373_10016885 | Ga0157373_100168854 | 297 |
| 284 | 3300013100 | Ga0157373_10018178 | Ga0157373_100181784 | 297 |
| 285 | 3300013100 | Ga0157373_10029984 | Ga0157373_100299842 | 297 |
| 286 | 3300013100 | Ga0157373_10105922 | Ga0157373_101059222 | 297 |
| 287 | 3300013102 | Ga0157371_10000784 | Ga0157371_1000078438 | 297 |
| 288 | 3300013102 | Ga0157371_10018899 | Ga0157371_100188993 | 297 |
| 289 | 3300013102 | Ga0157371_10019495 | Ga0157371_100194954 | 297 |
| 290 | 3300013102 | Ga0157371_10026498 | Ga0157371_100264984 | 297 |
| 291 | 3300013102 | Ga0157371_10034504 | Ga0157371_100345043 | 297 |
| 292 | 3300013102 | Ga0157371_10037050 | Ga0157371_100370501 | 297 |
| 293 | 3300013104 | Ga0157370_10016872 | Ga0157370_100168723 | 297 |
| 294 | 3300013104 | Ga0157370_10040402 | Ga0157370_100404024 | 297 |
| 295 | 3300013104 | Ga0157370_10047042 | Ga0157370_100470422 | 297 |
| 296 | 3300013104 | Ga0157370_10051983 | Ga0157370_100519832 | 297 |
| 297 | 3300013105 | Ga0157369_10018890 | Ga0157369_100188908 | 297 |
| 298 | 3300013105 | Ga0157369_10033440 | Ga0157369_100334405 | 297 |
| 299 | 3300013105 | Ga0157369_10063148 | Ga0157369_100631482 | 297 |
| 300 | 3300013105 | Ga0157369_10067142 | Ga0157369_100671422 | 297 |
| 301 | 3300013105 | Ga0157369_10077710 | Ga0157369_100777103 | 297 |
| 302 | 3300013296 | Ga0157374_10080450 | Ga0157374_100804502 | 297 |
| 303 | 3300013306 | Ga0163162_10032032 | Ga0163162_100320323 | 297 |
| 304 | 3300013306 | Ga0163162_10256575 | Ga0163162_102565751 | 297 |
| 305 | 3300013306 | Ga0163162_10530305 | Ga0163162_105303052 | 297 |
| 306 | 3300013307 | Ga0157372_10007786 | Ga0157372_100077867 | 297 |
| 307 | 3300013307 | Ga0157372_10008989 | Ga0157372_1000898913 | 297 |
| 308 | 3300013307 | Ga0157372_10135004 | Ga0157372_101350042 | 297 |
| 309 | 3300013307 | Ga0157372_10200313 | Ga0157372_102003132 | 297 |
| 310 | 3300013307 | Ga0157372_10375236 | Ga0157372_103752362 | 297 |
| 311 | 3300013307 | Ga0157372_10400669 | Ga0157372_104006691 | 297 |
| 312 | 3300013308 | Ga0157375_10066623 | Ga0157375_100666234 | 297 |
| 313 | 3300013308 | Ga0157375_10252211 | Ga0157375_102522112 | 297 |
| 314 | 3300014325 | Ga0163163_10000338 | Ga0163163_1000033835 | 297 |
| 315 | 3300014745 | Ga0157377_10011474 | Ga0157377_100114743 | 297 |
| 316 | 3300014968 | Ga0157379_10049930 | Ga0157379_100499303 | 297 |
| 317 | 3300014968 | Ga0157379_10174679 | Ga0157379_101746792 | 297 |
| 318 | 3300025315 | Ga0207697_10000584 | Ga0207697_1000058410 | 297 |
| 319 | 3300025315 | Ga0207697_10015235 | Ga0207697_100152353 | 297 |
| 320 | 3300025321 | Ga0207656_10011341 | Ga0207656_100113413 | 297 |
| 321 | 3300025321 | Ga0207656_10060834 | Ga0207656_100608342 | 297 |
| 322 | 3300025901 | Ga0207688_10004411 | Ga0207688_100044117 | 297 |
| 323 | 3300025903 | Ga0207680_10089196 | Ga0207680_100891962 | 297 |
| 324 | 3300025904 | Ga0207647_10000575 | Ga0207647_1000057517 | 297 |
| 325 | 3300025904 | Ga0207647_10002145 | Ga0207647_100021459 | 297 |
| 326 | 3300025904 | Ga0207647_10002864 | Ga0207647_100028647 | 297 |
| 327 | 3300025904 | Ga0207647_10048512 | Ga0207647_100485123 | 297 |
| 328 | 3300025907 | Ga0207645_10001233 | Ga0207645_1000123318 | 297 |
| 329 | 3300025907 | Ga0207645_10016623 | Ga0207645_100166233 | 297 |
| 330 | 3300025907 | Ga0207645_10127403 | Ga0207645_101274032 | 297 |
| 331 | 3300025909 | Ga0207705_10000260 | Ga0207705_1000026034 | 297 |
| 332 | 3300025909 | Ga0207705_10028624 | Ga0207705_100286244 | 297 |
| 333 | 3300025909 | Ga0207705_10058153 | Ga0207705_100581532 | 297 |
| 334 | 3300025909 | Ga0207705_10075537 | Ga0207705_100755372 | 297 |
| 335 | 3300025909 | Ga0207705_10091117 | Ga0207705_100911173 | 297 |
| 336 | 3300025909 | Ga0207705_10110629 | Ga0207705_101106292 | 297 |
| 337 | 3300025909 | Ga0207705_10188285 | Ga0207705_101882852 | 297 |
| 338 | 3300025909 | Ga0207705_10261340 | Ga0207705_102613402 | 297 |
| 339 | 3300025911 | Ga0207654_10044761 | Ga0207654_100447612 | 297 |
| 340 | 3300025911 | Ga0207654_10179262 | Ga0207654_101792622 | 297 |
| 341 | 3300025913 | Ga0207695_10030232 | Ga0207695_100302323 | 297 |
| 342 | 3300025913 | Ga0207695_10045302 | Ga0207695_100453025 | 297 |
| 343 | 3300025913 | Ga0207695_10098076 | Ga0207695_100980762 | 297 |
| 344 | 3300025913 | Ga0207695_10374386 | Ga0207695_103743862 | 297 |
| 345 | 3300025913 | Ga0207695_10379682 | Ga0207695_103796822 | 297 |
| 346 | 3300025917 | Ga0207660_10001336 | Ga0207660_1000133613 | 297 |
| 347 | 3300025917 | Ga0207660_10007267 | Ga0207660_100072673 | 297 |
| 348 | 3300025917 | Ga0207660_10024318 | Ga0207660_100243182 | 297 |
| 349 | 3300025917 | Ga0207660_10047363 | Ga0207660_100473633 | 297 |
| 350 | 3300025919 | Ga0207657_10000031 | Ga0207657_10000031120 | 297 |
| 351 | 3300025919 | Ga0207657_10009915 | Ga0207657_1000991510 | 297 |
| 352 | 3300025919 | Ga0207657_10018812 | Ga0207657_100188127 | 297 |
| 353 | 3300025919 | Ga0207657_10020134 | Ga0207657_100201345 | 297 |
| 354 | 3300025919 | Ga0207657_10024861 | Ga0207657_100248614 | 297 |
| 355 | 3300025919 | Ga0207657_10033201 | Ga0207657_100332012 | 297 |
| 356 | 3300025919 | Ga0207657_10048214 | Ga0207657_100482143 | 297 |
| 357 | 3300025919 | Ga0207657_10068067 | Ga0207657_100680672 | 297 |
| 358 | 3300025919 | Ga0207657_10166895 | Ga0207657_101668952 | 297 |
| 359 | 3300025919 | Ga0207657_10249157 | Ga0207657_102491572 | 297 |
| 360 | 3300025920 | Ga0207649_10000394 | Ga0207649_1000039429 | 297 |
| 361 | 3300025920 | Ga0207649_10113254 | Ga0207649_101132542 | 297 |
| 362 | 3300025920 | Ga0207649_10125389 | Ga0207649_101253892 | 297 |
| 363 | 3300025921 | Ga0207652_10186861 | Ga0207652_101868612 | 297 |
| 364 | 3300025921 | Ga0207652_10216234 | Ga0207652_102162343 | 297 |
| 365 | 3300025923 | Ga0207681_10096305 | Ga0207681_100963052 | 297 |
| 366 | 3300025924 | Ga0207694_10000526 | Ga0207694_1000052627 | 297 |
| 367 | 3300025924 | Ga0207694_10003458 | Ga0207694_1000345816 | 297 |
| 368 | 3300025925 | Ga0207650_10147841 | Ga0207650_101478412 | 297 |
| 369 | 3300025925 | Ga0207650_10412426 | Ga0207650_104124261 | 297 |
| 370 | 3300025927 | Ga0207687_10007615 | Ga0207687_100076154 | 297 |
| 371 | 3300025931 | Ga0207644_10000941 | Ga0207644_1000094115 | 297 |
| 372 | 3300025931 | Ga0207644_10000954 | Ga0207644_1000095415 | 297 |
| 373 | 3300025931 | Ga0207644_10014636 | Ga0207644_100146365 | 297 |
| 374 | 3300025932 | Ga0207690_10000382 | Ga0207690_1000038220 | 297 |
| 375 | 3300025932 | Ga0207690_10003206 | Ga0207690_100032062 | 297 |
| 376 | 3300025932 | Ga0207690_10046076 | Ga0207690_100460763 | 297 |
| 377 | 3300025932 | Ga0207690_10054025 | Ga0207690_100540253 | 297 |
| 378 | 3300025932 | Ga0207690_10345503 | Ga0207690_103455031 | 297 |
| 379 | 3300025933 | Ga0207706_10000028 | Ga0207706_10000028138 | 297 |
| 380 | 3300025933 | Ga0207706_10000171 | Ga0207706_1000017162 | 297 |
| 381 | 3300025933 | Ga0207706_10005399 | Ga0207706_1000539910 | 297 |
| 382 | 3300025933 | Ga0207706_10022887 | Ga0207706_100228872 | 297 |
| 383 | 3300025933 | Ga0207706_10037286 | Ga0207706_100372864 | 297 |
| 384 | 3300025933 | Ga0207706_10072220 | Ga0207706_100722202 | 297 |
| 385 | 3300025935 | Ga0207709_10103546 | Ga0207709_101035462 | 297 |
| 386 | 3300025936 | Ga0207670_10032192 | Ga0207670_100321923 | 297 |
| 387 | 3300025938 | Ga0207704_10006692 | Ga0207704_100066925 | 297 |
| 388 | 3300025940 | Ga0207691_10001864 | Ga0207691_1000186422 | 297 |
| 389 | 3300025940 | Ga0207691_10045452 | Ga0207691_100454523 | 297 |
| 390 | 3300025940 | Ga0207691_10074323 | Ga0207691_100743232 | 297 |
| 391 | 3300025941 | Ga0207711_10001375 | Ga0207711_1000137511 | 297 |
| 392 | 3300025941 | Ga0207711_10005966 | Ga0207711_100059663 | 297 |
| 393 | 3300025941 | Ga0207711_10027623 | Ga0207711_100276232 | 297 |
| 394 | 3300025941 | Ga0207711_10030857 | Ga0207711_100308573 | 297 |
| 395 | 3300025941 | Ga0207711_10039426 | Ga0207711_100394261 | 297 |
| 396 | 3300025941 | Ga0207711_10125412 | Ga0207711_101254123 | 297 |
| 397 | 3300025942 | Ga0207689_10000092 | Ga0207689_1000009240 | 297 |
| 398 | 3300025942 | Ga0207689_10083550 | Ga0207689_100835503 | 297 |
| 399 | 3300025944 | Ga0207661_10003597 | Ga0207661_1000359711 | 297 |
| 400 | 3300025944 | Ga0207661_10212496 | Ga0207661_102124961 | 297 |
| 401 | 3300025945 | Ga0207679_10000129 | Ga0207679_100001296 | 297 |
| 402 | 3300025945 | Ga0207679_10017763 | Ga0207679_100177632 | 297 |
| 403 | 3300025945 | Ga0207679_10032098 | Ga0207679_100320983 | 297 |
| 404 | 3300025949 | Ga0207667_10000357 | Ga0207667_1000035767 | 297 |
| 405 | 3300025949 | Ga0207667_10025870 | Ga0207667_100258706 | 297 |
| 406 | 3300025949 | Ga0207667_10047594 | Ga0207667_100475944 | 297 |
| 407 | 3300025949 | Ga0207667_10053034 | Ga0207667_100530345 | 297 |
| 408 | 3300025949 | Ga0207667_10056916 | Ga0207667_100569164 | 297 |
| 409 | 3300025949 | Ga0207667_10143983 | Ga0207667_101439833 | 297 |
| 410 | 3300025949 | Ga0207667_10167848 | Ga0207667_101678482 | 297 |
| 411 | 3300025949 | Ga0207667_10326287 | Ga0207667_103262871 | 297 |
| 412 | 3300025960 | Ga0207651_10000176 | Ga0207651_100001769 | 297 |
| 413 | 3300025960 | Ga0207651_10026221 | Ga0207651_100262213 | 297 |
| 414 | 3300025960 | Ga0207651_10203266 | Ga0207651_102032662 | 297 |
| 415 | 3300025961 | Ga0207712_10000269 | Ga0207712_1000026928 | 297 |
| 416 | 3300025972 | Ga0207668_10000080 | Ga0207668_1000008035 | 297 |
| 417 | 3300025972 | Ga0207668_10116835 | Ga0207668_101168352 | 297 |
| 418 | 3300025981 | Ga0207640_10000922 | Ga0207640_100009224 | 297 |
| 419 | 3300025981 | Ga0207640_10001385 | Ga0207640_1000138515 | 297 |
| 420 | 3300025981 | Ga0207640_10008786 | Ga0207640_100087863 | 297 |
| 421 | 3300025981 | Ga0207640_10172026 | Ga0207640_101720262 | 297 |
| 422 | 3300025986 | Ga0207658_10006798 | Ga0207658_100067989 | 297 |
| 423 | 3300025986 | Ga0207658_10036095 | Ga0207658_100360954 | 297 |
| 424 | 3300025986 | Ga0207658_10060055 | Ga0207658_100600553 | 297 |
| 425 | 3300025986 | Ga0207658_10087251 | Ga0207658_100872513 | 297 |
| 426 | 3300025986 | Ga0207658_10117234 | Ga0207658_101172342 | 297 |
| 427 | 3300026023 | Ga0207677_10057650 | Ga0207677_100576503 | 297 |
| 428 | 3300026023 | Ga0207677_10248911 | Ga0207677_102489112 | 297 |
| 429 | 3300026035 | Ga0207703_10009105 | Ga0207703_100091053 | 297 |
| 430 | 3300026035 | Ga0207703_10046172 | Ga0207703_100461723 | 297 |
| 431 | 3300026041 | Ga0207639_10000131 | Ga0207639_1000013130 | 297 |
| 432 | 3300026041 | Ga0207639_10000608 | Ga0207639_1000060821 | 297 |
| 433 | 3300026041 | Ga0207639_10003016 | Ga0207639_100030165 | 297 |
| 434 | 3300026041 | Ga0207639_10028417 | Ga0207639_100284173 | 297 |
| 435 | 3300026041 | Ga0207639_10156966 | Ga0207639_101569663 | 297 |
| 436 | 3300026041 | Ga0207639_10179217 | Ga0207639_101792172 | 297 |
| 437 | 3300026067 | Ga0207678_10000198 | Ga0207678_100001989 | 297 |
| 438 | 3300026067 | Ga0207678_10017221 | Ga0207678_100172212 | 297 |
| 439 | 3300026067 | Ga0207678_10019267 | Ga0207678_100192674 | 297 |
| 440 | 3300026067 | Ga0207678_10025287 | Ga0207678_100252877 | 297 |
| 441 | 3300026067 | Ga0207678_10027353 | Ga0207678_100273535 | 297 |
| 442 | 3300026067 | Ga0207678_10114561 | Ga0207678_101145613 | 297 |
| 443 | 3300026078 | Ga0207702_10000247 | Ga0207702_1000024734 | 297 |
| 444 | 3300026078 | Ga0207702_10044203 | Ga0207702_100442034 | 297 |
| 445 | 3300026078 | Ga0207702_10046137 | Ga0207702_100461372 | 297 |
| 446 | 3300026078 | Ga0207702_10377081 | Ga0207702_103770812 | 297 |
| 447 | 3300026078 | Ga0207702_10411854 | Ga0207702_104118542 | 297 |
| 448 | 3300026088 | Ga0207641_10046546 | Ga0207641_100465463 | 297 |
| 449 | 3300026088 | Ga0207641_10118141 | Ga0207641_101181413 | 297 |
| 450 | 3300026088 | Ga0207641_10152950 | Ga0207641_101529503 | 297 |
| 451 | 3300026089 | Ga0207648_10008297 | Ga0207648_100082974 | 297 |
| 452 | 3300026089 | Ga0207648_10008887 | Ga0207648_100088879 | 297 |
| 453 | 3300026089 | Ga0207648_10017502 | Ga0207648_100175023 | 297 |
| 454 | 3300026095 | Ga0207676_10004385 | Ga0207676_100043853 | 297 |
| 455 | 3300026095 | Ga0207676_10269919 | Ga0207676_102699192 | 297 |
| 456 | 3300026095 | Ga0207676_10297382 | Ga0207676_102973822 | 297 |
| 457 | 3300026116 | Ga0207674_10010569 | Ga0207674_100105694 | 297 |
| 458 | 3300026116 | Ga0207674_10014969 | Ga0207674_100149699 | 297 |
| 459 | 3300026116 | Ga0207674_10016447 | Ga0207674_100164473 | 297 |
| 460 | 3300026116 | Ga0207674_10018937 | Ga0207674_100189379 | 297 |
| 461 | 3300026116 | Ga0207674_10020590 | Ga0207674_100205908 | 297 |
| 462 | 3300026116 | Ga0207674_10053575 | Ga0207674_100535752 | 297 |
| 463 | 3300026116 | Ga0207674_10064490 | Ga0207674_100644903 | 297 |
| 464 | 3300026116 | Ga0207674_10064900 | Ga0207674_100649002 | 297 |
| 465 | 3300026116 | Ga0207674_10068894 | Ga0207674_100688944 | 297 |
| 466 | 3300026116 | Ga0207674_10160076 | Ga0207674_101600762 | 297 |
| 467 | 3300026116 | Ga0207674_10297793 | Ga0207674_102977932 | 297 |
| 468 | 3300026118 | Ga0207675_100378306 | Ga0207675_1003783062 | 297 |
| 469 | 3300026142 | Ga0207698_10001888 | Ga0207698_1000188816 | 297 |
| 470 | 3300026142 | Ga0207698_10006575 | Ga0207698_100065757 | 297 |
| 471 | 3300026142 | Ga0207698_10014500 | Ga0207698_100145003 | 297 |
| 472 | 3300026142 | Ga0207698_10030984 | Ga0207698_100309844 | 297 |
| 473 | 3300026142 | Ga0207698_10108543 | Ga0207698_101085432 | 297 |
| 474 | 3300028379 | Ga0268266_10000433 | Ga0268266_1000043331 | 297 |
| 475 | 3300028379 | Ga0268266_10010715 | Ga0268266_100107157 | 297 |
| 476 | 3300028379 | Ga0268266_10026216 | Ga0268266_100262167 | 297 |
| 477 | 3300028379 | Ga0268266_10040393 | Ga0268266_100403933 | 297 |
| 478 | 3300028379 | Ga0268266_10052988 | Ga0268266_100529881 | 297 |
| 479 | 3300028379 | Ga0268266_10078633 | Ga0268266_100786333 | 297 |
| 480 | 3300028379 | Ga0268266_10162543 | Ga0268266_101625432 | 297 |
| 481 | 3300028380 | Ga0268265_10002770 | Ga0268265_100027705 | 297 |
| 482 | 3300028380 | Ga0268265_10026121 | Ga0268265_100261214 | 297 |
| 483 | 3300028380 | Ga0268265_10073709 | Ga0268265_100737093 | 297 |
| 484 | 3300028380 | Ga0268265_10156824 | Ga0268265_101568242 | 297 |
| 485 | 3300028380 | Ga0268265_10182676 | Ga0268265_101826762 | 297 |
| 486 | 3300028381 | Ga0268264_10000567 | Ga0268264_1000056740 | 297 |
| 487 | 3300028381 | Ga0268264_10003351 | Ga0268264_100033515 | 297 |
| 488 | 3300028381 | Ga0268264_10005259 | Ga0268264_1000525911 | 297 |
| 489 | 3300028381 | Ga0268264_10143383 | Ga0268264_101433832 | 297 |
| 490 | 3300031852 | Ga0307410_10003819 | Ga0307410_100038192 | 297 |
| 491 | 3300031852 | Ga0307410_10262960 | Ga0307410_102629602 | 297 |
| 492 | 3300031901 | Ga0307406_10018726 | Ga0307406_100187263 | 297 |
| 493 | 3300031903 | Ga0307407_10004615 | Ga0307407_100046154 | 297 |
| 494 | 3300031911 | Ga0307412_10067038 | Ga0307412_100670383 | 297 |
| 495 | 3300031995 | Ga0307409_100002843 | Ga0307409_1000028433 | 297 |
| 496 | 3300031995 | Ga0307409_100090561 | Ga0307409_1000905613 | 297 |
| 497 | 3300031995 | Ga0307409_100152813 | Ga0307409_1001528132 | 297 |
| 498 | 3300032002 | Ga0307416_100043719 | Ga0307416_1000437194 | 297 |
| 499 | 3300032004 | Ga0307414_10015027 | Ga0307414_100150274 | 297 |
| 500 | 3300032004 | Ga0307414_10044338 | Ga0307414_100443383 | 297 |
| 501 | 3300032005 | Ga0307411_10011439 | Ga0307411_100114394 | 297 |
| 502 | 3300032005 | Ga0307411_10011531 | Ga0307411_100115312 | 297 |
| 503 | 3300032005 | Ga0307411_10122113 | Ga0307411_101221133 | 297 |
| 504 | 3300032126 | Ga0307415_100017152 | Ga0307415_1000171521 | 297 |
| 505 | 3300032126 | Ga0307415_100018950 | Ga0307415_1000189504 | 297 |
| 506 | 3300035084 | Ga0373928_0026956 | Ga0373928_0026956_130_1059 | 297 |
| 507 | 3300035086 | Ga0373934_0080594 | Ga0373934_0080594_106_1035 | 297 |
| 508 | 3300035090 | Ga0373949_0034273 | Ga0373949_0034273_78_1007 | 297 |
| 509 | 3300035118 | Ga0373954_0013710 | Ga0373954_0013710_595_1524 | 297 |
| 510 | 3300035121 | Ga0373960_0003919 | Ga0373960_0003919_705_1634 | 297 |
| 511 | 3300035170 | Ga0373943_0003195 | Ga0373943_0003195_1037_1969 | 297 |
| 512 | 3300035172 | Ga0373955_0017242 | Ga0373955_0017242_2120_3049 | 297 |
| 513 | 3300035724 | Ga0373933_0117916 | Ga0373933_0117916_447_1376 | 297 |
| 514 | 3300036401 | Ga0373937_0004086 | Ga0373937_0004086_5522_6451 | 297 |
| 515 | 3300037312 | Ga0395899_0004324 | Ga0395899_0004324_4529_5461 | 297 |
| 516 | 3300037312 | Ga0395899_0012008 | Ga0395899_0012008_2998_3927 | 297 |
| 517 | 3300037312 | Ga0395899_0015712 | Ga0395899_0015712_617_1546 | 297 |
| 518 | 3300037312 | Ga0395899_0017880 | Ga0395899_0017880_3944_4873 | 297 |
| 519 | 3300037312 | Ga0395899_0019845 | Ga0395899_0019845_1988_2917 | 297 |
| 520 | 3300037312 | Ga0395899_0052302 | Ga0395899_0052302_158_1087 | 297 |
| 521 | 3300037312 | Ga0395899_0083237 | Ga0395899_0083237_920_1849 | 297 |
| 522 | 3300037312 | Ga0395899_0101568 | Ga0395899_0101568_521_1450 | 297 |
| 523 | 3300037312 | Ga0395899_0227087 | Ga0395899_0227087_113_1042 | 297 |
| 524 | 3300037418 | Ga0395900_0008912 | Ga0395900_0008912_7384_8313 | 297 |
| 525 | 3300037418 | Ga0395900_0016439 | Ga0395900_0016439_2931_3860 | 297 |
| 526 | 3300037418 | Ga0395900_0020464 | Ga0395900_0020464_23_952 | 297 |
| 527 | 3300037418 | Ga0395900_0023784 | Ga0395900_0023784_4347_5276 | 297 |
| 528 | 3300037418 | Ga0395900_0032306 | Ga0395900_0032306_2172_3101 | 297 |
| 529 | 3300037418 | Ga0395900_0073975 | Ga0395900_0073975_2069_2998 | 297 |
| 530 | 3300037418 | Ga0395900_0147255 | Ga0395900_0147255_838_1767 | 297 |
| 531 | 3300037418 | Ga0395900_0207884 | Ga0395900_0207884_279_1211 | 297 |
| 532 | 3300037466 | Ga0395898_0013212 | Ga0395898_0013212_894_1826 | 297 |
| 533 | 3300037466 | Ga0395898_0045666 | Ga0395898_0045666_2282_3211 | 297 |
| 534 | 3300037466 | Ga0395898_0086695 | Ga0395898_0086695_1241_2170 | 297 |
| 535 | 3300037466 | Ga0395898_0107895 | Ga0395898_0107895_1028_1957 | 297 |
| 536 | 3300037466 | Ga0395898_0113668 | Ga0395898_0113668_1184_2113 | 297 |
| 537 | 3300037466 | Ga0395898_0171290 | Ga0395898_0171290_649_1578 | 297 |
| 538 | 3300037466 | Ga0395898_0217232 | Ga0395898_0217232_552_1481 | 297 |
| 539 | 3300037471 | Ga0395905_0000104 | Ga0395905_0000104_5958_6887 | 297 |
| 540 | 3300037471 | Ga0395905_0000974 | Ga0395905_0000974_29036_29965 | 297 |
| 541 | 3300037471 | Ga0395905_0010192 | Ga0395905_0010192_5560_6489 | 297 |
| 542 | 3300037471 | Ga0395905_0011956 | Ga0395905_0011956_329_1261 | 297 |
| 543 | 3300037471 | Ga0395905_0037894 | Ga0395905_0037894_473_1402 | 297 |
| 544 | 3300037471 | Ga0395905_0044957 | Ga0395905_0044957_2209_3138 | 297 |
| 545 | 3300037471 | Ga0395905_0106127 | Ga0395905_0106127_839_1768 | 297 |
| 546 | 3300037471 | Ga0395905_0126104 | Ga0395905_0126104_1157_2086 | 297 |
| 547 | 3300037471 | Ga0395905_0165732 | Ga0395905_0165732_1083_2012 | 297 |
| 548 | 3300037471 | Ga0395905_0272820 | Ga0395905_0272820_79_1008 | 297 |
| 549 | 3300037471 | Ga0395905_0286183 | Ga0395905_0286183_547_1476 | 297 |
| 550 | 3300037471 | Ga0395905_0305990 | Ga0395905_0305990_365_1294 | 297 |
| 551 | 3300037471 | Ga0395905_0585597 | Ga0395905_0585597_40_969 | 297 |
| 552 | 3300038443 | Ga0395901_0000276 | Ga0395901_0000276_33566_34495 | 297 |
| 553 | 3300038443 | Ga0395901_0010013 | Ga0395901_0010013_4335_5264 | 297 |
| 554 | 3300038443 | Ga0395901_0028542 | Ga0395901_0028542_3235_4164 | 297 |
| 555 | 3300038443 | Ga0395901_0043484 | Ga0395901_0043484_757_1686 | 297 |
| 556 | 3300038443 | Ga0395901_0102924 | Ga0395901_0102924_1997_2926 | 297 |
| 557 | 3300038443 | Ga0395901_0130050 | Ga0395901_0130050_1619_2548 | 297 |
| 558 | 3300038443 | Ga0395901_0165053 | Ga0395901_0165053_627_1559 | 297 |
| 559 | 3300044684 | Ga0466966_0030220 | Ga0466966_0030220_1046_1975 | 297 |
| 560 | 3300044684 | Ga0466966_0213391 | Ga0466966_0213391_170_1099 | 297 |
| 561 | 3300044684 | Ga0466966_0215016 | Ga0466966_0215016_56_985 | 297 |
| 562 | 3300044693 | Ga0466961_0007560 | Ga0466961_0007560_1009_1938 | 297 |
| 563 | 3300044693 | Ga0466961_0115074 | Ga0466961_0115074_481_1410 | 297 |
| 564 | 3300044694 | Ga0466963_0000971 | Ga0466963_0000971_10630_11559 | 297 |
| 565 | 3300044694 | Ga0466963_0009670 | Ga0466963_0009670_4247_5176 | 297 |
| 566 | 3300044694 | Ga0466963_0014808 | Ga0466963_0014808_78_1007 | 297 |
| 567 | 3300044694 | Ga0466963_0015010 | Ga0466963_0015010_2735_3667 | 297 |
| 568 | 3300044694 | Ga0466963_0031383 | Ga0466963_0031383_1331_2260 | 297 |
| 569 | 3300044694 | Ga0466963_0092802 | Ga0466963_0092802_1005_1934 | 297 |
| 570 | 3300044694 | Ga0466963_0214913 | Ga0466963_0214913_79_1008 | 297 |
| 571 | 3300044706 | Ga0466964_0102420 | Ga0466964_0102420_319_1248 | 297 |
| 572 | 3300044719 | Ga0466971_0093278 | Ga0466971_0093278_204_1133 | 297 |
| 573 | 3300044842 | Ga0466957_0002813 | Ga0466957_0002813_7146_8075 | 297 |
| 574 | 3300044842 | Ga0466957_0011404 | Ga0466957_0011404_365_1294 | 297 |
| 575 | 3300044842 | Ga0466957_0184479 | Ga0466957_0184479_15_944 | 297 |
| 576 | 3300045049 | Ga0466959_0078525 | Ga0466959_0078525_1428_2357 | 297 |
| 577 | 3300045049 | Ga0466959_0204287 | Ga0466959_0204287_126_1055 | 297 |
| 578 | 3300045976 | Ga0466967_0000483 | Ga0466967_0000483_7881_8810 | 297 |
| 579 | 3300045976 | Ga0466967_0002578 | Ga0466967_0002578_5211_6140 | 297 |
| 580 | 3300045976 | Ga0466967_0005574 | Ga0466967_0005574_339_1268 | 297 |
| 581 | 3300045976 | Ga0466967_0021495 | Ga0466967_0021495_2228_3157 | 297 |
| 582 | 3300045976 | Ga0466967_0023653 | Ga0466967_0023653_1867_2796 | 297 |
| 583 | 3300045976 | Ga0466967_0052339 | Ga0466967_0052339_847_1776 | 297 |
| 584 | 3300045976 | Ga0466967_0089806 | Ga0466967_0089806_307_1236 | 297 |
| 585 | 3300045976 | Ga0466967_0154388 | Ga0466967_0154388_1101_2030 | 297 |
| 586 | 3300045976 | Ga0466967_0367706 | Ga0466967_0367706_198_1127 | 297 |
| 587 | 3300046492 | Ga0495585_0094446 | Ga0495585_0094446_96_1025 | 297 |
| 588 | 3300046616 | Ga0495668_0009438 | Ga0495668_0009438_3636_4565 | 297 |
| 589 | 3300046684 | Ga0495669_0041904 | Ga0495669_0041904_919_1848 | 297 |
| 590 | 3300046684 | Ga0495669_0059759 | Ga0495669_0059759_194_1123 | 297 |
| 591 | 3300046684 | Ga0495669_0092321 | Ga0495669_0092321_407_1336 | 297 |
| 592 | 3300046684 | Ga0495669_0107845 | Ga0495669_0107845_145_1074 | 297 |
| 593 | 3300047445 | Ga0495677_0022636 | Ga0495677_0022636_72_1001 | 297 |
| 594 | 3300048088 | Ga0495602_0051913 | Ga0495602_0051913_161_1090 | 297 |
| 595 | 3300048904 | Ga0496101_0368104 | Ga0496101_0368104_144_1073 | 297 |
| 596 | 3300048907 | Ga0496104_0441116 | Ga0496104_0441116_72_1001 | 297 |
| 597 | 3300048909 | Ga0496106_0090688 | Ga0496106_0090688_975_1904 | 297 |
| 598 | 3300048910 | Ga0496107_0132781 | Ga0496107_0132781_772_1701 | 297 |
| 599 | 3300048911 | Ga0496108_0217863 | Ga0496108_0217863_660_1589 | 297 |
| 600 | 3300048912 | Ga0496109_0158233 | Ga0496109_0158233_563_1492 | 297 |
| 601 | 3300048913 | Ga0496110_0023530 | Ga0496110_0023530_627_1556 | 297 |
| 602 | 3300048913 | Ga0496110_0038404 | Ga0496110_0038404_871_1800 | 297 |
| 603 | 3300048913 | Ga0496110_0119677 | Ga0496110_0119677_167_1096 | 297 |
| 604 | 3300048913 | Ga0496110_0394851 | Ga0496110_0394851_272_1201 | 297 |
| 605 | 3300048914 | Ga0496111_0009804 | Ga0496111_0009804_3131_4060 | 297 |
| 606 | 3300048915 | Ga0496112_0004292 | Ga0496112_0004292_10182_11111 | 297 |
| 607 | 3300048915 | Ga0496112_0018585 | Ga0496112_0018585_5390_6319 | 297 |
| 608 | 3300048916 | Ga0496113_0002271 | Ga0496113_0002271_73_1005 | 297 |
| 609 | 3300048916 | Ga0496113_0049274 | Ga0496113_0049274_313_1242 | 297 |
| 610 | 3300049586 | Ga0501070_0044033 | Ga0501070_0044033_2245_3174 | 297 |
| 611 | 3300050508 | nmdc:mga09592_248854_c1 | nmdc:mga09592_248854_c1_456_1385 | 297 |
| 612 | 3300061719 | Ga0466962_0003571 | Ga0466962_0003571_364_1293 | 297 |
| 613 | 3300061719 | Ga0466962_0008051 | Ga0466962_0008051_1470_2399 | 297 |
| 614 | 3300061719 | Ga0466962_0031717 | Ga0466962_0031717_747_1676 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cgr-assembly1.cif.gz_B | crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and glycerol bound form) | 0.9484 | 4 | 295 |
| 7cgq-assembly1.cif.gz_B | crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and l-arabinose bound form) | 0.9472 | 4 | 295 |
| 7cgr-assembly1.cif.gz_B | crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and glycerol bound form) | 0.9298 | 4 | 295 |
| 7cgq-assembly1.cif.gz_B | crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and l-arabinose bound form) | 0.9287 | 4 | 295 |
| 4ew6-assembly1.cif.gz_A-2 | crystal structure of d-galactose-1-dehydrogenase protein from rhizobium etli | 0.9262 | 1 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6jnkA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9583 | 4 | 115 | 3.40.50.720 |
| 6jnkA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9339 | 4 | 115 | 3.40.50.720 |
| 3fhlA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8946 | 1 | 112 | 3.40.50.720 |
| af_P77376_2_121_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.8919 | 1 | 112 | 3.90.1150.10 |
| af_P46853_1_121_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8902 | 2 | 112 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U1G007-F1-model_v4 | deleted | 0.9611 | 1 | 297 |
|
| AF-A0A2U1G007-F1-model_v4 | deleted | 0.958 | 1 | 297 |
|
| AF-A0A529XHK6-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9573 | 1 | 114 |
GO:0000166
|
| AF-A0A435AKU1-F1-model_v4 | deleted | 0.9562 | 1 | 137 |
|
| AF-A0A455UJI4-F1-model_v4 | Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein | 0.9365 | 1 | 117 |
GO:0000166
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar