F469262

General Info

Members Datasets Scaffolds Average Seq Length
613 243 1226 101

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10340818|Ga0207663_103408182
Length 109
Sequence MSPSTVNSVFRRRRFTDLISRQLDLFEREHADVIVEAQERLDAYNRAERDEAEELYGDYVDAVETGTEILADLRDHYAASVEDADAYCAEFNRTVARRLPPFALEIENR

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 2.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.6
Rhizosphere 88.42
Stem 0
Stem Tuber 0
Unclassified 9.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10340818 3300025916 Bacteria 1132
2 Ga0070658_10787730 3300005327 Bacteria 826
3 Ga0070658_10800708 3300005327 Bacteria 819
4 Ga0070683_100005942 3300005329 Bacteria 10214
5 Ga0070683_100015866 3300005329 Bacteria 6626
6 Ga0070683_100148123 3300005329 Bacteria 2225
7 Ga0070680_100030616 3300005336 Bacteria 4324
8 Ga0070680_100055832 3300005336 Bacteria 3228
9 Ga0070680_100073546 3300005336 Bacteria 2811
10 Ga0070680_100128359 3300005336 Bacteria 2120
11 Ga0070680_100784792 3300005336 Bacteria 821
12 Ga0070680_101741879 3300005336 Bacteria 540
13 Ga0070682_100261389 3300005337 Bacteria 1253
14 Ga0070682_100269637 3300005337 Bacteria 1236
15 Ga0070682_101285878 3300005337 Bacteria 621
16 Ga0070682_101316934 3300005337 Unclassified 614
17 Ga0068868_100101893 3300005338 Bacteria 2324
18 Ga0068868_101136974 3300005338 Bacteria 720
19 Ga0070660_100001517 3300005339 Bacteria 15917
20 Ga0070660_100050981 3300005339 Bacteria 3186
21 Ga0070660_100063653 3300005339 Bacteria 2867
22 Ga0070660_100143568 3300005339 Bacteria 1916
23 Ga0070660_100246169 3300005339 Bacteria 1457
24 Ga0070660_100292186 3300005339 Bacteria 1335
25 Ga0070660_101702169 3300005339 Bacteria 537
26 Ga0070661_100024554 3300005344 Bacteria 4323
27 Ga0070661_100167688 3300005344 Bacteria 1666
28 Ga0070661_100187106 3300005344 Bacteria 1578
29 Ga0070661_100506130 3300005344 Bacteria 967
30 Ga0070671_100267088 3300005355 Bacteria 1454
31 Ga0070659_100051475 3300005366 Bacteria 3238
32 Ga0070659_101850487 3300005366 Unclassified 541
33 Ga0070667_100003011 3300005367 Bacteria 14476
34 Ga0070709_10714107 3300005434 Unclassified 781
35 Ga0070714_100158768 3300005435 Bacteria 2044
36 Ga0070714_100433353 3300005435 Bacteria 1247
37 Ga0070714_100829828 3300005435 Unclassified 896
38 Ga0070713_100056890 3300005436 Bacteria 3254
39 Ga0070710_10087831 3300005437 Bacteria 1828
40 Ga0070710_10252161 3300005437 Unclassified 1135
41 Ga0070711_100034309 3300005439 Bacteria 3384
42 Ga0070711_100147974 3300005439 Bacteria 1768
43 Ga0070711_100434499 3300005439 Bacteria 1072
44 Ga0070711_100492029 3300005439 Bacteria 1010
45 Ga0070708_100428798 3300005445 Bacteria 1247
46 Ga0070708_101592164 3300005445 Bacteria 608
47 Ga0070663_101431074 3300005455 Bacteria 613
48 Ga0070678_100372555 3300005456 Unclassified 1233
49 Ga0070681_10013809 3300005458 Bacteria 8037
50 Ga0070681_10042506 3300005458 Bacteria 4553
51 Ga0070681_10099693 3300005458 Bacteria 2850
52 Ga0070681_10128982 3300005458 Bacteria 2461
53 Ga0070681_10165454 3300005458 Bacteria 2134
54 Ga0070681_10499280 3300005458 Bacteria 1130
55 Ga0070681_11244594 3300005458 Bacteria 666
56 Ga0068867_101619874 3300005459 Bacteria 605
57 Ga0070679_100036130 3300005530 Bacteria 4903
58 Ga0070679_100043391 3300005530 Bacteria 4479
59 Ga0070679_100048602 3300005530 Bacteria 4226
60 Ga0070679_100112087 3300005530 Bacteria 2714
61 Ga0070679_100213535 3300005530 Bacteria 1892
62 Ga0070679_100233060 3300005530 Bacteria 1800
63 Ga0070679_100256877 3300005530 Bacteria 1703
64 Ga0070679_100505694 3300005530 Bacteria 1152
65 Ga0070679_100654073 3300005530 Bacteria 994
66 Ga0070679_100711502 3300005530 Bacteria 947
67 Ga0070679_101601338 3300005530 Bacteria 599
68 Ga0070679_102025127 3300005530 Bacteria 525
69 Ga0070684_100030060 3300005535 Bacteria 4613
70 Ga0070684_100060050 3300005535 Bacteria 3325
71 Ga0070684_100105016 3300005535 Bacteria 2528
72 Ga0070684_100111559 3300005535 Bacteria 2452
73 Ga0070684_100403480 3300005535 Bacteria 1260
74 Ga0070684_100671593 3300005535 Bacteria 965
75 Ga0070697_100855287 3300005536 Unclassified 806
76 Ga0068853_100055073 3300005539 Bacteria 3428
77 Ga0068853_100250115 3300005539 Bacteria 1626
78 Ga0068853_101846474 3300005539 Bacteria 586
79 Ga0070696_100160715 3300005546 Unclassified 1655
80 Ga0070665_100034046 3300005548 Bacteria 5123
81 Ga0070665_101960765 3300005548 Bacteria 591
82 Ga0070665_102519313 3300005548 Bacteria 516
83 Ga0068855_100016384 3300005563 Bacteria 8910
84 Ga0068855_100063510 3300005563 Bacteria 4309
85 Ga0068855_100087624 3300005563 Bacteria 3597
86 Ga0068855_100255347 3300005563 Bacteria 1954
87 Ga0068855_100411399 3300005563 Bacteria 1481
88 Ga0068855_100769190 3300005563 Bacteria 1025
89 Ga0068855_101716402 3300005563 Bacteria 640
90 Ga0068857_100029189 3300005577 Bacteria 4867
91 Ga0068857_102147719 3300005577 Bacteria 548
92 Ga0068854_100232381 3300005578 Bacteria 1464
93 Ga0068856_100165285 3300005614 Unclassified 2224
94 Ga0068856_100802305 3300005614 Bacteria 961
95 Ga0068856_100922479 3300005614 Bacteria 892
96 Ga0068856_101027112 3300005614 Bacteria 842
97 Ga0068856_102643535 3300005614 Bacteria 508
98 Ga0068852_100179666 3300005616 Bacteria 1989
99 Ga0068852_100204256 3300005616 Bacteria 1871
100 Ga0068852_101089156 3300005616 Bacteria 819
101 Ga0068852_101461091 3300005616 Bacteria 706
102 Ga0068858_101426512 3300005842 Bacteria 682
103 Ga0068860_100924557 3300005843 Bacteria 889
104 Ga0081538_10010466 3300005981 Bacteria 7607
105 Ga0070717_10587493 3300006028 Bacteria 1010
106 Ga0070716_100745654 3300006173 Bacteria 753
107 Ga0070712_100069257 3300006175 Bacteria 2517
108 Ga0070712_100417845 3300006175 Bacteria 1111
109 Ga0070712_101068896 3300006175 Bacteria 700
110 Ga0070712_101967503 3300006175 Bacteria 512
111 Ga0097621_101137383 3300006237 Unclassified 734
112 Ga0068871_100411371 3300006358 Unclassified 1206
113 Ga0068871_101284739 3300006358 Unclassified 688
114 Ga0075428_100009861 3300006844 Bacteria 10614
115 Ga0075431_101075308 3300006847 Bacteria 770
116 Ga0075433_10138820 3300006852 Bacteria 2160
117 Ga0075434_100010410 3300006871 Bacteria 8717
118 Ga0075429_100839573 3300006880 Bacteria 804
119 Ga0075436_100370066 3300006914 Bacteria 1035
120 Ga0075435_100016982 3300007076 Bacteria 5497
121 Ga0105240_10053923 3300009093 Bacteria 5043
122 Ga0105240_10120145 3300009093 Bacteria 3165
123 Ga0105240_10120376 3300009093 Bacteria 3161
124 Ga0105240_10143064 3300009093 Bacteria 2857
125 Ga0105240_10247992 3300009093 Bacteria 2061
126 Ga0105240_10693310 3300009093 Bacteria 1112
127 Ga0105240_11524410 3300009093 Bacteria 700
128 Ga0111539_10482426 3300009094 Unclassified 1444
129 Ga0105245_10005489 3300009098 Bacteria 11140
130 Ga0105245_10245370 3300009098 Bacteria 1738
131 Ga0105245_10546408 3300009098 Bacteria 1180
132 Ga0105245_12210810 3300009098 Bacteria 604
133 Ga0105245_12246828 3300009098 Bacteria 599
134 Ga0114129_10005334 3300009147 Bacteria 18145
135 Ga0114129_12101196 3300009147 Bacteria 681
136 Ga0105241_10606446 3300009174 Bacteria 989
137 Ga0105241_11044786 3300009174 Bacteria 766
138 Ga0105242_11741843 3300009176 Bacteria 660
139 Ga0105248_11211769 3300009177 Unclassified 853
140 Ga0105237_10019405 3300009545 Bacteria 7021
141 Ga0105237_10034220 3300009545 Bacteria 5146
142 Ga0105237_10139637 3300009545 Bacteria 2417
143 Ga0105238_10019876 3300009551 Bacteria 6836
144 Ga0105238_10047475 3300009551 Bacteria 4329
145 Ga0105238_11941955 3300009551 Bacteria 622
146 Ga0105249_10042223 3300009553 Bacteria 4147
147 Ga0105239_10066207 3300010375 Bacteria 3969
148 Ga0105239_11395985 3300010375 Bacteria 808
149 Ga0105239_12970559 3300010375 Bacteria 553
150 Ga0157373_10030526 3300013100 Bacteria 3879
151 Ga0157373_10462957 3300013100 Bacteria 913
152 Ga0157370_10008703 3300013104 Bacteria 10922
153 Ga0157370_10008884 3300013104 Bacteria 10799
154 Ga0157370_10074275 3300013104 Bacteria 3207
155 Ga0157370_10339226 3300013104 Bacteria 1385
156 Ga0157370_11075063 3300013104 Bacteria 727
157 Ga0157369_10003170 3300013105 Bacteria 19626
158 Ga0157369_10021481 3300013105 Bacteria 7220
159 Ga0157369_10079566 3300013105 Bacteria 3510
160 Ga0157369_10209123 3300013105 Bacteria 2046
161 Ga0157369_10413168 3300013105 Bacteria 1399
162 Ga0157369_10424350 3300013105 Bacteria 1379
163 Ga0157369_10659443 3300013105 Unclassified 1079
164 Ga0157369_10750883 3300013105 Bacteria 1004
165 Ga0157374_10113216 3300013296 Bacteria 2611
166 Ga0157374_11128889 3300013296 Bacteria 804
167 Ga0157374_11854936 3300013296 Bacteria 628
168 Ga0157378_10518701 3300013297 Bacteria 1193
169 Ga0157378_10830372 3300013297 Bacteria 951
170 Ga0157378_12869537 3300013297 Bacteria 534
171 Ga0157372_10064426 3300013307 Bacteria 4112
172 Ga0157372_10080130 3300013307 Bacteria 3693
173 Ga0157372_10205945 3300013307 Bacteria 2279
174 Ga0157372_10534068 3300013307 Bacteria 1367
175 Ga0157372_10917620 3300013307 Bacteria 1016
176 Ga0157372_11165457 3300013307 Bacteria 891
177 Ga0157375_10493086 3300013308 Unclassified 1389
178 Ga0157375_10523948 3300013308 Bacteria 1348
179 Ga0157375_11244684 3300013308 Bacteria 874
180 Ga0157376_10597810 3300014969 Bacteria 1098
181 Ga0157376_11120158 3300014969 Bacteria 813
182 Ga0182006_1174381 3300015261 Bacteria 719
183 Ga0182007_10237935 3300015262 Unclassified 649
184 Ga0197907_10555821 3300020069 Unclassified 780
185 Ga0206356_10199074 3300020070 Bacteria 536
186 Ga0206356_10213960 3300020070 Bacteria 1565
187 Ga0206356_10906256 3300020070 Unclassified 589
188 Ga0206356_11007588 3300020070 Bacteria 1920
189 Ga0206356_11532121 3300020070 Bacteria 1317
190 Ga0206350_11658887 3300020080 Bacteria 658
191 Ga0206354_10372290 3300020081 Unclassified 773
192 Ga0206354_10434998 3300020081 Bacteria 790
193 Ga0206354_10791054 3300020081 Bacteria 1103
194 Ga0206354_11344677 3300020081 Bacteria 2220
195 Ga0206353_10418390 3300020082 Bacteria 2717
196 Ga0206353_10987184 3300020082 Bacteria 10455
197 Ga0206353_11646033 3300020082 Bacteria 2560
198 Ga0206353_11798682 3300020082 Bacteria 2763
199 Ga0206353_11896535 3300020082 Bacteria 1814
200 Ga0213876_10362658 3300021384 Bacteria 771
201 Ga0207692_10135577 3300025898 Unclassified 1395
202 Ga0207692_10643612 3300025898 Bacteria 684
203 Ga0207699_10788796 3300025906 Unclassified 698
204 Ga0207699_10985817 3300025906 Bacteria 623
205 Ga0207705_10061210 3300025909 Bacteria 2719
206 Ga0207705_10086718 3300025909 Bacteria 2288
207 Ga0207705_10168217 3300025909 Bacteria 1650
208 Ga0207705_10176595 3300025909 Bacteria 1610
209 Ga0207705_10261425 3300025909 Bacteria 1322
210 Ga0207654_10653030 3300025911 Bacteria 753
211 Ga0207707_10028530 3300025912 Bacteria 4878
212 Ga0207707_10063643 3300025912 Bacteria 3210
213 Ga0207707_10068650 3300025912 Bacteria 3089
214 Ga0207707_10095190 3300025912 Bacteria 2603
215 Ga0207707_10395371 3300025912 Bacteria 1187
216 Ga0207695_10118469 3300025913 Bacteria 2619
217 Ga0207695_10307743 3300025913 Bacteria 1475
218 Ga0207695_11296545 3300025913 Bacteria 609
219 Ga0207671_10027983 3300025914 Bacteria 4213
220 Ga0207671_10041739 3300025914 Bacteria 3396
221 Ga0207693_10027294 3300025915 Bacteria 4514
222 Ga0207663_10022190 3300025916 Bacteria 3626
223 Ga0207663_10129207 3300025916 Bacteria 1743
224 Ga0207663_10268048 3300025916 Unclassified 1264
225 Ga0207663_11654477 3300025916 Bacteria 515
226 Ga0207660_10033916 3300025917 Bacteria 3534
227 Ga0207660_10073040 3300025917 Bacteria 2500
228 Ga0207660_10123762 3300025917 Bacteria 1962
229 Ga0207660_10157622 3300025917 Bacteria 1749
230 Ga0207660_10242730 3300025917 Bacteria 1420
231 Ga0207660_10472920 3300025917 Bacteria 1015
232 Ga0207660_10871611 3300025917 Bacteria 735
233 Ga0207660_11285700 3300025917 Bacteria 594
234 Ga0207660_11519715 3300025917 Bacteria 541
235 Ga0207657_10000054 3300025919 Bacteria 106767
236 Ga0207657_10000651 3300025919 Bacteria 36939
237 Ga0207657_10026684 3300025919 Bacteria 5301
238 Ga0207657_10094223 3300025919 Bacteria 2493
239 Ga0207657_10617865 3300025919 Bacteria 845
240 Ga0207649_10031801 3300025920 Bacteria 3140
241 Ga0207649_10172831 3300025920 Bacteria 1506
242 Ga0207649_11183285 3300025920 Bacteria 604
243 Ga0207652_10118461 3300025921 Bacteria 2353
244 Ga0207652_10136182 3300025921 Bacteria 2193
245 Ga0207652_10160515 3300025921 Bacteria 2015
246 Ga0207652_10249862 3300025921 Bacteria 1599
247 Ga0207652_10492662 3300025921 Bacteria 1104
248 Ga0207652_10842891 3300025921 Bacteria 812
249 Ga0207652_10939436 3300025921 Bacteria 762
250 Ga0207652_10956839 3300025921 Bacteria 754
251 Ga0207652_11055511 3300025921 Bacteria 712
252 Ga0207652_11172087 3300025921 Bacteria 670
253 Ga0207694_10020090 3300025924 Bacteria 5052
254 Ga0207694_10914020 3300025924 Bacteria 742
255 Ga0207687_10533173 3300025927 Bacteria 983
256 Ga0207687_10870535 3300025927 Bacteria 770
257 Ga0207687_11168188 3300025927 Bacteria 661
258 Ga0207687_11175915 3300025927 Bacteria 659
259 Ga0207700_10031432 3300025928 Bacteria 3772
260 Ga0207700_10472195 3300025928 Bacteria 1108
261 Ga0207700_10709310 3300025928 Bacteria 898
262 Ga0207664_10169838 3300025929 Bacteria 1866
263 Ga0207664_10237926 3300025929 Unclassified 1585
264 Ga0207664_11636295 3300025929 Bacteria 566
265 Ga0207644_10329837 3300025931 Unclassified 1235
266 Ga0207690_10010167 3300025932 Bacteria 5589
267 Ga0207690_10616053 3300025932 Bacteria 887
268 Ga0207706_11673395 3300025933 Unclassified 513
269 Ga0207686_11128603 3300025934 Bacteria 640
270 Ga0207709_11625002 3300025935 Bacteria 537
271 Ga0207665_10525454 3300025939 Bacteria 917
272 Ga0207711_11823254 3300025941 Bacteria 551
273 Ga0207661_10124155 3300025944 Bacteria 2203
274 Ga0207661_10124905 3300025944 Bacteria 2196
275 Ga0207661_10142813 3300025944 Bacteria 2062
276 Ga0207661_10261327 3300025944 Bacteria 1542
277 Ga0207661_10431280 3300025944 Bacteria 1198
278 Ga0207661_10469994 3300025944 Bacteria 1147
279 Ga0207661_10866301 3300025944 Bacteria 832
280 Ga0207667_10080044 3300025949 Bacteria 3385
281 Ga0207667_10143431 3300025949 Bacteria 2458
282 Ga0207667_10705488 3300025949 Unclassified 1011
283 Ga0207667_11158537 3300025949 Bacteria 754
284 Ga0207667_11812059 3300025949 Unclassified 574
285 Ga0207640_10361307 3300025981 Bacteria 1170
286 Ga0207640_10364956 3300025981 Bacteria 1165
287 Ga0207658_10004308 3300025986 Bacteria 9909
288 Ga0207677_10407891 3300026023 Bacteria 1154
289 Ga0207677_10924852 3300026023 Bacteria 787
290 Ga0207703_11452587 3300026035 Bacteria 660
291 Ga0207639_10037935 3300026041 Bacteria 3582
292 Ga0207639_11752269 3300026041 Bacteria 582
293 Ga0207678_10275632 3300026067 Bacteria 1443
294 Ga0207702_10052351 3300026078 Bacteria 3454
295 Ga0207702_10071171 3300026078 Bacteria 2994
296 Ga0207702_11512748 3300026078 Bacteria 665
297 Ga0207702_12472665 3300026078 Bacteria 506
298 Ga0207648_10315305 3300026089 Bacteria 1404
299 Ga0207648_11294753 3300026089 Bacteria 685
300 Ga0207674_10010978 3300026116 Bacteria 10193
301 Ga0207674_10492468 3300026116 Bacteria 1185
302 Ga0207674_11645151 3300026116 Bacteria 610
303 Ga0207683_10377027 3300026121 Unclassified 1304
304 Ga0207698_10116228 3300026142 Bacteria 2254
305 Ga0207698_10225077 3300026142 Bacteria 1698
306 Ga0207698_10228812 3300026142 Bacteria 1686
307 Ga0207698_10436355 3300026142 Bacteria 1261
308 Ga0207698_10690979 3300026142 Bacteria 1014
309 Ga0268266_10115483 3300028379 Bacteria 2383
310 Ga0268266_10933194 3300028379 Bacteria 840
311 Ga0268266_11058210 3300028379 Unclassified 785
312 Ga0268264_10255698 3300028381 Bacteria 1629
313 Ga0265331_10115676 3300031250 Unclassified 1228
314 Ga0265327_10015633 3300031251 Bacteria 4882
315 Ga0307408_100356479 3300031548 Bacteria 1243
316 Ga0307416_101733772 3300032002 Bacteria 729
317 Ga0373944_0006321 3300035089 Bacteria 3141
318 Ga0373944_0043716 3300035089 Bacteria 1393
319 Ga0373936_0008928 3300035113 Bacteria 3778
320 Ga0373936_0300579 3300035113 Unclassified 724
321 Ga0373936_0352033 3300035113 Bacteria 671
322 Ga0373945_0002165 3300035116 Bacteria 6128
323 Ga0373945_0014749 3300035116 Bacteria 2623
324 Ga0373956_0380699 3300035119 Bacteria 673
325 Ga0373957_0051723 3300035120 Bacteria 1572
326 Ga0373943_0000101 3300035170 Bacteria 31609
327 Ga0373943_0002380 3300035170 Bacteria 8526
328 Ga0373943_0019104 3300035170 Bacteria 3151
329 Ga0373946_0089985 3300035171 Bacteria 1359
330 Ga0373946_0494491 3300035171 Bacteria 627
331 Ga0373955_0006377 3300035172 Bacteria 5376
332 Ga0373924_0124279 3300035410 Unclassified 1121
333 Ga0373935_0003186 3300035692 Bacteria 9463
334 Ga0373935_0436657 3300035692 Bacteria 944
335 Ga0373935_0475622 3300035692 Bacteria 905
336 Ga0373927_0078714 3300035695 Bacteria 2135
337 Ga0373927_0104633 3300035695 Bacteria 1843
338 Ga0373927_0817063 3300035695 Bacteria 616
339 Ga0373933_0032010 3300035724 Bacteria 3055
340 Ga0373947_0002740 3300035725 Bacteria 10558
341 Ga0373947_0004984 3300035725 Bacteria 7772
342 Ga0373947_0942873 3300035725 Bacteria 589
343 Ga0373947_1228311 3300035725 Bacteria 510
344 Ga0373925_0001828 3300037068 Bacteria 17755
345 Ga0373925_0010452 3300037068 Bacteria 6730
346 Ga0373925_0019854 3300037068 Bacteria 4889
347 Ga0373925_1033958 3300037068 Bacteria 676
348 Ga0395899_0502132 3300037312 Unclassified 787
349 Ga0395900_0062931 3300037418 Bacteria 3813
350 Ga0395900_0118840 3300037418 Bacteria 2713
351 Ga0395900_0469456 3300037418 Bacteria 1212
352 Ga0395900_0675402 3300037418 Bacteria 968
353 Ga0395900_1046062 3300037418 Bacteria 735
354 Ga0395900_1455836 3300037418 Bacteria 597
355 Ga0395898_0001509 3300037466 Bacteria 32076
356 Ga0395898_0007850 3300037466 Bacteria 11324
357 Ga0395898_0342362 3300037466 Bacteria 1426
358 Ga0395898_0349215 3300037466 Bacteria 1411
359 Ga0395898_0493331 3300037466 Bacteria 1165
360 Ga0395898_0944284 3300037466 Bacteria 800
361 Ga0395905_0106669 3300037471 Bacteria 2630
362 Ga0395901_0001414 3300038443 Bacteria 25054
363 Ga0395901_0022116 3300038443 Bacteria 6515
364 Ga0395901_0111813 3300038443 Bacteria 2869
365 Ga0395901_0128104 3300038443 Bacteria 2668
366 Ga0395901_0248383 3300038443 Bacteria 1854
367 Ga0395901_0656177 3300038443 Unclassified 1052
368 Ga0395901_0713905 3300038443 Bacteria 999
369 Ga0395901_0780048 3300038443 Bacteria 946
370 Ga0436365_1571369 3300039437 Bacteria 894
371 Ga0436363_0074777 3300039450 Bacteria 515
372 Ga0436363_1532817 3300039450 Bacteria 632
373 Ga0451800_0466089 3300041459 Bacteria 612
374 Ga0451845_0612332 3300041501 Bacteria 719
375 Ga0451853_2492716 3300041512 Bacteria 1402
376 Ga0439448_0156574 3300042005 Bacteria 792
377 Ga0439454_084621 3300042011 Unclassified 579
378 Ga0466965_0106994 3300044683 Bacteria 1435
379 Ga0466966_0002588 3300044684 Bacteria 11853
380 Ga0466966_0032731 3300044684 Bacteria 3367
381 Ga0466963_0001732 3300044694 Bacteria 11878
382 Ga0466963_0023591 3300044694 Bacteria 3909
383 Ga0466963_0123435 3300044694 Bacteria 1784
384 Ga0466963_0664204 3300044694 Bacteria 736
385 Ga0466964_0004414 3300044706 Bacteria 5193
386 Ga0466964_0105488 3300044706 Bacteria 1249
387 Ga0466957_0505265 3300044842 Bacteria 838
388 Ga0466959_0015352 3300045049 Bacteria 5577
389 Ga0466959_0060933 3300045049 Bacteria 2745
390 Ga0466959_0721938 3300045049 Bacteria 667
391 Ga0466958_0667679 3300045836 Bacteria 677
392 Ga0466958_0705546 3300045836 Bacteria 657
393 Ga0466958_1008525 3300045836 Bacteria 543
394 Ga0466967_0007258 3300045976 Bacteria 7971
395 Ga0466967_0032999 3300045976 Bacteria 4378
396 Ga0466967_0044604 3300045976 Bacteria 3847
397 Ga0466967_0084219 3300045976 Bacteria 2877
398 Ga0466967_0231194 3300045976 Unclassified 1761
399 Ga0466967_0614351 3300045976 Bacteria 1073
400 Ga0466967_1037078 3300045976 Bacteria 817
401 Ga0495592_0067449 3300046454 Bacteria 2615
402 Ga0495603_0102425 3300046455 Bacteria 1671
403 Ga0495629_0000670 3300046459 Bacteria 27725
404 Ga0495629_0189887 3300046459 Bacteria 1422
405 Ga0495629_1071416 3300046459 Unclassified 522
406 Ga0495641_0000374 3300046461 Bacteria 37120
407 Ga0495641_0208812 3300046461 Bacteria 875
408 Ga0495651_0004871 3300046462 Bacteria 10268
409 Ga0495651_0022109 3300046462 Bacteria 4944
410 Ga0495651_0191781 3300046462 Bacteria 1437
411 Ga0495653_0011141 3300046463 Bacteria 7354
412 Ga0495653_0039537 3300046463 Bacteria 3694
413 Ga0495653_0064886 3300046463 Bacteria 2750
414 Ga0495580_0387117 3300046472 Bacteria 944
415 Ga0495582_0000124 3300046473 Bacteria 41197
416 Ga0495582_0579476 3300046473 Bacteria 649
417 Ga0495639_0000658 3300046475 Bacteria 15965
418 Ga0495662_0000898 3300046476 Bacteria 14537
419 Ga0495662_0031320 3300046476 Bacteria 2569
420 Ga0495664_0033006 3300046477 Bacteria 3041
421 Ga0495664_0070584 3300046477 Bacteria 2086
422 Ga0495596_0071042 3300046500 Bacteria 1352
423 Ga0495608_0005935 3300046511 Bacteria 8686
424 Ga0495608_0038097 3300046511 Bacteria 3231
425 Ga0495608_0050740 3300046511 Bacteria 2752
426 Ga0495618_0053992 3300046514 Bacteria 2541
427 Ga0495618_0201734 3300046514 Bacteria 1259
428 Ga0495628_0916762 3300046516 Unclassified 607
429 Ga0495630_0007417 3300046517 Bacteria 7836
430 Ga0495630_0021732 3300046517 Bacteria 4738
431 Ga0495630_0022236 3300046517 Bacteria 4686
432 Ga0495630_0059166 3300046517 Bacteria 2874
433 Ga0495630_0354178 3300046517 Bacteria 1123
434 Ga0495666_0030819 3300046526 Bacteria 2630
435 Ga0495666_0487786 3300046526 Bacteria 551
436 Ga0495652_0026278 3300046529 Bacteria 5144
437 Ga0495652_0370780 3300046529 Bacteria 1020
438 Ga0495665_0000249 3300046531 Bacteria 27073
439 Ga0495665_0361968 3300046531 Unclassified 738
440 Ga0495640_0019459 3300046533 Bacteria 5010
441 Ga0495640_0023042 3300046533 Bacteria 4546
442 Ga0495640_0080149 3300046533 Bacteria 2172
443 Ga0495586_0039208 3300046535 Unclassified 2546
444 Ga0495587_0006779 3300046536 Bacteria 7455
445 Ga0495587_0341912 3300046536 Bacteria 835
446 Ga0495587_0641130 3300046536 Bacteria 584
447 Ga0495645_0015115 3300046543 Bacteria 5487
448 Ga0495645_0046298 3300046543 Bacteria 3170
449 Ga0495667_0012696 3300046559 Bacteria 5710
450 Ga0495667_0030058 3300046559 Bacteria 3653
451 Ga0495668_0474100 3300046616 Unclassified 689
452 Ga0495634_0038440 3300046642 Bacteria 3263
453 Ga0495634_0110312 3300046642 Bacteria 1769
454 Ga0495634_0329186 3300046642 Bacteria 918
455 Ga0495635_0009732 3300046663 Bacteria 6719
456 Ga0495635_0012567 3300046663 Bacteria 5934
457 Ga0495635_0126029 3300046663 Bacteria 1746
458 Ga0495657_0035371 3300046675 Bacteria 3462
459 Ga0495657_0108190 3300046675 Bacteria 1764
460 Ga0495657_0110282 3300046675 Bacteria 1744
461 Ga0495599_0009819 3300046678 Bacteria 5857
462 Ga0495599_0322865 3300046678 Unclassified 929
463 Ga0495623_0005346 3300046679 Bacteria 8407
464 Ga0495646_0112052 3300046680 Bacteria 1552
465 Ga0495646_0305794 3300046680 Unclassified 840
466 Ga0495647_0000689 3300046681 Bacteria 10082
467 Ga0495647_0601682 3300046681 Unclassified 516
468 Ga0495658_0000247 3300046683 Bacteria 30977
469 Ga0495658_0029776 3300046683 Bacteria 2958
470 Ga0495613_0001393 3300046689 Bacteria 18401
471 Ga0495613_0388861 3300046689 Bacteria 953
472 Ga0495624_0045682 3300046690 Bacteria 2787
473 Ga0495624_0144487 3300046690 Bacteria 1456
474 Ga0495589_0274977 3300046794 Unclassified 784
475 Ga0495600_0017263 3300046809 Bacteria 4588
476 Ga0495600_0398876 3300046809 Bacteria 856
477 Ga0495581_0004417 3300047315 Bacteria 8130
478 Ga0495604_0014213 3300047317 Bacteria 6345
479 Ga0495604_0096373 3300047317 Bacteria 2183
480 Ga0495604_0340699 3300047317 Bacteria 998
481 Ga0495674_0003941 3300047319 Bacteria 14400
482 Ga0495674_0011930 3300047319 Bacteria 8194
483 Ga0495674_0192128 3300047319 Bacteria 1696
484 Ga0495676_0001077 3300047321 Bacteria 23118
485 Ga0495676_0296886 3300047321 Bacteria 1090
486 Ga0495676_0493381 3300047321 Unclassified 804
487 Ga0495680_0003365 3300047322 Bacteria 15791
488 Ga0495680_0013880 3300047322 Bacteria 7008
489 Ga0495675_0000878 3300047444 Bacteria 18381
490 Ga0495684_0001855 3300047471 Bacteria 16919
491 Ga0495684_0036467 3300047471 Bacteria 3769
492 Ga0495593_0039086 3300047673 Bacteria 2560
493 Ga0495602_0028925 3300048088 Bacteria 5294
494 Ga0495602_0283502 3300048088 Bacteria 1219
495 Ga0495602_0628722 3300048088 Bacteria 735
496 Ga0495614_0009511 3300048089 Bacteria 4297
497 Ga0496100_0004628 3300048903 Bacteria 7318
498 Ga0496100_0064529 3300048903 Bacteria 2424
499 Ga0496100_0074714 3300048903 Bacteria 2271
500 Ga0496100_1455474 3300048903 Unclassified 541
501 Ga0496101_0009476 3300048904 Bacteria 6401
502 Ga0496101_0018810 3300048904 Bacteria 4704
503 Ga0496101_0071677 3300048904 Bacteria 2540
504 Ga0496101_0159973 3300048904 Bacteria 1727
505 Ga0496101_0272957 3300048904 Bacteria 1320
506 Ga0496102_0009451 3300048905 Bacteria 8378
507 Ga0496102_0019849 3300048905 Bacteria 5926
508 Ga0496102_0275326 3300048905 Bacteria 1586
509 Ga0496103_0053451 3300048906 Bacteria 2503
510 Ga0496103_0544672 3300048906 Unclassified 741
511 Ga0496103_0781227 3300048906 Bacteria 603
512 Ga0496104_0026632 3300048907 Bacteria 5342
513 Ga0496104_0047678 3300048907 Bacteria 4038
514 Ga0496104_0050582 3300048907 Bacteria 3921
515 Ga0496104_1611585 3300048907 Bacteria 552
516 Ga0496105_0002629 3300048908 Bacteria 13070
517 Ga0496105_0052163 3300048908 Bacteria 3377
518 Ga0496105_0128549 3300048908 Bacteria 2089
519 Ga0496106_0011636 3300048909 Bacteria 6504
520 Ga0496106_0947980 3300048909 Unclassified 678
521 Ga0496107_0006368 3300048910 Bacteria 8115
522 Ga0496107_0075266 3300048910 Bacteria 2457
523 Ga0496107_0339223 3300048910 Bacteria 1118
524 Ga0496107_0699935 3300048910 Unclassified 745
525 Ga0496108_0002961 3300048911 Bacteria 13659
526 Ga0496108_0836217 3300048911 Unclassified 793
527 Ga0496108_0977330 3300048911 Unclassified 724
528 Ga0496109_0002273 3300048912 Bacteria 15968
529 Ga0496109_0012523 3300048912 Bacteria 7322
530 Ga0496109_1191901 3300048912 Unclassified 698
531 Ga0496109_2005747 3300048912 Unclassified 511
532 Ga0496110_0030477 3300048913 Bacteria 4650
533 Ga0496110_0076879 3300048913 Bacteria 2969
534 Ga0496110_0208041 3300048913 Bacteria 1778
535 Ga0496110_0398523 3300048913 Bacteria 1255
536 Ga0496111_0008543 3300048914 Bacteria 6785
537 Ga0496111_0221288 3300048914 Bacteria 1406
538 Ga0496111_0780321 3300048914 Unclassified 692
539 Ga0496112_0006274 3300048915 Bacteria 10426
540 Ga0496112_0010827 3300048915 Bacteria 8297
541 Ga0496112_0026439 3300048915 Bacteria 5584
542 Ga0496112_0101324 3300048915 Bacteria 2850
543 Ga0496112_0177088 3300048915 Bacteria 2097
544 Ga0496112_1450759 3300048915 Bacteria 600
545 Ga0496113_0010642 3300048916 Bacteria 6091
546 Ga0496113_0275258 3300048916 Bacteria 1346
547 Ga0496114_0012160 3300048917 Bacteria 6888
548 Ga0496114_0024496 3300048917 Bacteria 4927
549 Ga0496114_0025411 3300048917 Bacteria 4841
550 Ga0496114_0627563 3300048917 Bacteria 946
551 Ga0496114_0859215 3300048917 Bacteria 788
552 Ga0496114_0980489 3300048917 Bacteria 728
553 Ga0496114_1255216 3300048917 Bacteria 627
554 Ga0496115_0002513 3300048918 Bacteria 13172
555 Ga0496115_0018662 3300048918 Bacteria 5331
556 Ga0496115_0113212 3300048918 Bacteria 2229
557 Ga0496115_0240251 3300048918 Bacteria 1493
558 Ga0496115_0283249 3300048918 Bacteria 1360
559 Ga0496115_1201506 3300048918 Bacteria 570
560 Ga0496115_1395858 3300048918 Unclassified 517
561 Ga0501034_0347104 3300049571 Bacteria 1413
562 Ga0501043_1272013 3300049579 Bacteria 514
563 Ga0501046_0525474 3300049580 Bacteria 846
564 Ga0501046_0574867 3300049580 Bacteria 801
565 Ga0501047_0030664 3300049581 Bacteria 5183
566 Ga0501047_0897287 3300049581 Bacteria 700
567 Ga0501067_0025573 3300049583 Bacteria 3272
568 Ga0501067_0251661 3300049583 Bacteria 983
569 Ga0501069_0212710 3300049585 Bacteria 1122
570 Ga0501069_0548386 3300049585 Bacteria 692
571 Ga0501070_0014526 3300049586 Bacteria 6625
572 Ga0501070_0104456 3300049586 Bacteria 2342
573 Ga0501070_0199843 3300049586 Bacteria 1642
574 Ga0501072_0006239 3300049588 Bacteria 9084
575 Ga0501073_0179515 3300049589 Bacteria 1465
576 Ga0501073_0225181 3300049589 Bacteria 1295
577 Ga0501074_0005182 3300049590 Bacteria 9364
578 Ga0501074_0006294 3300049590 Bacteria 8572
579 Ga0501074_0104417 3300049590 Bacteria 2028
580 Ga0501074_0432978 3300049590 Bacteria 933
581 Ga0501076_0558754 3300049592 Unclassified 944
582 Ga0501077_0512456 3300049593 Bacteria 769
583 Ga0501079_0027091 3300049741 Bacteria 4393
584 Ga0501079_0563910 3300049741 Bacteria 896
585 Ga0501079_1488724 3300049741 Bacteria 532
586 Ga0501080_0021753 3300049742 Bacteria 5941
587 Ga0501080_0318824 3300049742 Bacteria 1407
588 Ga0501083_0005259 3300049744 Bacteria 9155
589 Ga0501083_0844146 3300049744 Bacteria 596
590 Ga0501035_0909263 3300049822 Bacteria 697
591 Ga0501044_0584492 3300049823 Bacteria 1011
592 nmdc:mga05p37_8824_c2 3300050507 Bacteria 4147
593 nmdc:mga09592_766456_c1 3300050508 Bacteria 818
594 nmdc:mga06r32_119589_c1 3300050510 Bacteria 2597
595 nmdc:mga0n895_54375_c1 3300050512 Bacteria 3938
596 nmdc:mga0rr50_21866_c1 3300050513 Bacteria 4377
597 nmdc:mga0a205_33711_c2 3300050515 Bacteria 2166
598 Ga0495601_0010350 3300053077 Bacteria 5548
599 Ga0495601_0093841 3300053077 Bacteria 1933
600 Ga0495601_0720095 3300053077 Bacteria 636
601 Ga0495612_0050027 3300053078 Bacteria 1716
602 Ga0495612_0172221 3300053078 Bacteria 948
603 Ga0495595_0004822 3300053084 Bacteria 5431
604 Ga0495595_0008213 3300053084 Bacteria 4285
605 Ga0495595_0209849 3300053084 Bacteria 970
606 Ga0495619_0002878 3300053085 Bacteria 11188
607 Ga0495619_0004757 3300053085 Bacteria 8632
608 Ga0495619_0005166 3300053085 Bacteria 8284
609 Ga0495619_0587620 3300053085 Unclassified 762
610 Ga0501084_0204316 3300054114 Bacteria 1667
611 Ga0587091_184499 3300059511 Bacteria 551
612 Ga0466962_0152859 3300061719 Bacteria 1120
613 Ga0466962_0598635 3300061719 Bacteria 562
614 Ga0207663_10340818
615 Ga0070658_10787730
616 Ga0070658_10800708
617 Ga0070683_100005942
618 Ga0070683_100015866
619 Ga0070683_100148123
620 Ga0070680_100030616
621 Ga0070680_100055832
622 Ga0070680_100073546
623 Ga0070680_100128359
624 Ga0070680_100784792
625 Ga0070680_101741879
626 Ga0070682_100261389
627 Ga0070682_100269637
628 Ga0070682_101285878
629 Ga0070682_101316934
630 Ga0068868_100101893
631 Ga0068868_101136974
632 Ga0070660_100001517
633 Ga0070660_100050981
634 Ga0070660_100063653
635 Ga0070660_100143568
636 Ga0070660_100246169
637 Ga0070660_100292186
638 Ga0070660_101702169
639 Ga0070661_100024554
640 Ga0070661_100167688
641 Ga0070661_100187106
642 Ga0070661_100506130
643 Ga0070671_100267088
644 Ga0070659_100051475
645 Ga0070659_101850487
646 Ga0070667_100003011
647 Ga0070709_10714107
648 Ga0070714_100158768
649 Ga0070714_100433353
650 Ga0070714_100829828
651 Ga0070713_100056890
652 Ga0070710_10087831
653 Ga0070710_10252161
654 Ga0070711_100034309
655 Ga0070711_100147974
656 Ga0070711_100434499
657 Ga0070711_100492029
658 Ga0070708_100428798
659 Ga0070708_101592164
660 Ga0070663_101431074
661 Ga0070678_100372555
662 Ga0070681_10013809
663 Ga0070681_10042506
664 Ga0070681_10099693
665 Ga0070681_10128982
666 Ga0070681_10165454
667 Ga0070681_10499280
668 Ga0070681_11244594
669 Ga0068867_101619874
670 Ga0070679_100036130
671 Ga0070679_100043391
672 Ga0070679_100048602
673 Ga0070679_100112087
674 Ga0070679_100213535
675 Ga0070679_100233060
676 Ga0070679_100256877
677 Ga0070679_100505694
678 Ga0070679_100654073
679 Ga0070679_100711502
680 Ga0070679_101601338
681 Ga0070679_102025127
682 Ga0070684_100030060
683 Ga0070684_100060050
684 Ga0070684_100105016
685 Ga0070684_100111559
686 Ga0070684_100403480
687 Ga0070684_100671593
688 Ga0070697_100855287
689 Ga0068853_100055073
690 Ga0068853_100250115
691 Ga0068853_101846474
692 Ga0070696_100160715
693 Ga0070665_100034046
694 Ga0070665_101960765
695 Ga0070665_102519313
696 Ga0068855_100016384
697 Ga0068855_100063510
698 Ga0068855_100087624
699 Ga0068855_100255347
700 Ga0068855_100411399
701 Ga0068855_100769190
702 Ga0068855_101716402
703 Ga0068857_100029189
704 Ga0068857_102147719
705 Ga0068854_100232381
706 Ga0068856_100165285
707 Ga0068856_100802305
708 Ga0068856_100922479
709 Ga0068856_101027112
710 Ga0068856_102643535
711 Ga0068852_100179666
712 Ga0068852_100204256
713 Ga0068852_101089156
714 Ga0068852_101461091
715 Ga0068858_101426512
716 Ga0068860_100924557
717 Ga0081538_10010466
718 Ga0070717_10587493
719 Ga0070716_100745654
720 Ga0070712_100069257
721 Ga0070712_100417845
722 Ga0070712_101068896
723 Ga0070712_101967503
724 Ga0097621_101137383
725 Ga0068871_100411371
726 Ga0068871_101284739
727 Ga0075428_100009861
728 Ga0075431_101075308
729 Ga0075433_10138820
730 Ga0075434_100010410
731 Ga0075429_100839573
732 Ga0075436_100370066
733 Ga0075435_100016982
734 Ga0105240_10053923
735 Ga0105240_10120145
736 Ga0105240_10120376
737 Ga0105240_10143064
738 Ga0105240_10247992
739 Ga0105240_10693310
740 Ga0105240_11524410
741 Ga0111539_10482426
742 Ga0105245_10005489
743 Ga0105245_10245370
744 Ga0105245_10546408
745 Ga0105245_12210810
746 Ga0105245_12246828
747 Ga0114129_10005334
748 Ga0114129_12101196
749 Ga0105241_10606446
750 Ga0105241_11044786
751 Ga0105242_11741843
752 Ga0105248_11211769
753 Ga0105237_10019405
754 Ga0105237_10034220
755 Ga0105237_10139637
756 Ga0105238_10019876
757 Ga0105238_10047475
758 Ga0105238_11941955
759 Ga0105249_10042223
760 Ga0105239_10066207
761 Ga0105239_11395985
762 Ga0105239_12970559
763 Ga0157373_10030526
764 Ga0157373_10462957
765 Ga0157370_10008703
766 Ga0157370_10008884
767 Ga0157370_10074275
768 Ga0157370_10339226
769 Ga0157370_11075063
770 Ga0157369_10003170
771 Ga0157369_10021481
772 Ga0157369_10079566
773 Ga0157369_10209123
774 Ga0157369_10413168
775 Ga0157369_10424350
776 Ga0157369_10659443
777 Ga0157369_10750883
778 Ga0157374_10113216
779 Ga0157374_11128889
780 Ga0157374_11854936
781 Ga0157378_10518701
782 Ga0157378_10830372
783 Ga0157378_12869537
784 Ga0157372_10064426
785 Ga0157372_10080130
786 Ga0157372_10205945
787 Ga0157372_10534068
788 Ga0157372_10917620
789 Ga0157372_11165457
790 Ga0157375_10493086
791 Ga0157375_10523948
792 Ga0157375_11244684
793 Ga0157376_10597810
794 Ga0157376_11120158
795 Ga0182006_1174381
796 Ga0182007_10237935
797 Ga0197907_10555821
798 Ga0206356_10199074
799 Ga0206356_10213960
800 Ga0206356_10906256
801 Ga0206356_11007588
802 Ga0206356_11532121
803 Ga0206350_11658887
804 Ga0206354_10372290
805 Ga0206354_10434998
806 Ga0206354_10791054
807 Ga0206354_11344677
808 Ga0206353_10418390
809 Ga0206353_10987184
810 Ga0206353_11646033
811 Ga0206353_11798682
812 Ga0206353_11896535
813 Ga0213876_10362658
814 Ga0207692_10135577
815 Ga0207692_10643612
816 Ga0207699_10788796
817 Ga0207699_10985817
818 Ga0207705_10061210
819 Ga0207705_10086718
820 Ga0207705_10168217
821 Ga0207705_10176595
822 Ga0207705_10261425
823 Ga0207654_10653030
824 Ga0207707_10028530
825 Ga0207707_10063643
826 Ga0207707_10068650
827 Ga0207707_10095190
828 Ga0207707_10395371
829 Ga0207695_10118469
830 Ga0207695_10307743
831 Ga0207695_11296545
832 Ga0207671_10027983
833 Ga0207671_10041739
834 Ga0207693_10027294
835 Ga0207663_10022190
836 Ga0207663_10129207
837 Ga0207663_10268048
838 Ga0207663_11654477
839 Ga0207660_10033916
840 Ga0207660_10073040
841 Ga0207660_10123762
842 Ga0207660_10157622
843 Ga0207660_10242730
844 Ga0207660_10472920
845 Ga0207660_10871611
846 Ga0207660_11285700
847 Ga0207660_11519715
848 Ga0207657_10000054
849 Ga0207657_10000651
850 Ga0207657_10026684
851 Ga0207657_10094223
852 Ga0207657_10617865
853 Ga0207649_10031801
854 Ga0207649_10172831
855 Ga0207649_11183285
856 Ga0207652_10118461
857 Ga0207652_10136182
858 Ga0207652_10160515
859 Ga0207652_10249862
860 Ga0207652_10492662
861 Ga0207652_10842891
862 Ga0207652_10939436
863 Ga0207652_10956839
864 Ga0207652_11055511
865 Ga0207652_11172087
866 Ga0207694_10020090
867 Ga0207694_10914020
868 Ga0207687_10533173
869 Ga0207687_10870535
870 Ga0207687_11168188
871 Ga0207687_11175915
872 Ga0207700_10031432
873 Ga0207700_10472195
874 Ga0207700_10709310
875 Ga0207664_10169838
876 Ga0207664_10237926
877 Ga0207664_11636295
878 Ga0207644_10329837
879 Ga0207690_10010167
880 Ga0207690_10616053
881 Ga0207706_11673395
882 Ga0207686_11128603
883 Ga0207709_11625002
884 Ga0207665_10525454
885 Ga0207711_11823254
886 Ga0207661_10124155
887 Ga0207661_10124905
888 Ga0207661_10142813
889 Ga0207661_10261327
890 Ga0207661_10431280
891 Ga0207661_10469994
892 Ga0207661_10866301
893 Ga0207667_10080044
894 Ga0207667_10143431
895 Ga0207667_10705488
896 Ga0207667_11158537
897 Ga0207667_11812059
898 Ga0207640_10361307
899 Ga0207640_10364956
900 Ga0207658_10004308
901 Ga0207677_10407891
902 Ga0207677_10924852
903 Ga0207703_11452587
904 Ga0207639_10037935
905 Ga0207639_11752269
906 Ga0207678_10275632
907 Ga0207702_10052351
908 Ga0207702_10071171
909 Ga0207702_11512748
910 Ga0207702_12472665
911 Ga0207648_10315305
912 Ga0207648_11294753
913 Ga0207674_10010978
914 Ga0207674_10492468
915 Ga0207674_11645151
916 Ga0207683_10377027
917 Ga0207698_10116228
918 Ga0207698_10225077
919 Ga0207698_10228812
920 Ga0207698_10436355
921 Ga0207698_10690979
922 Ga0268266_10115483
923 Ga0268266_10933194
924 Ga0268266_11058210
925 Ga0268264_10255698
926 Ga0265331_10115676
927 Ga0265327_10015633
928 Ga0307408_100356479
929 Ga0307416_101733772
930 Ga0373944_0006321
931 Ga0373944_0043716
932 Ga0373936_0008928
933 Ga0373936_0300579
934 Ga0373936_0352033
935 Ga0373945_0002165
936 Ga0373945_0014749
937 Ga0373956_0380699
938 Ga0373957_0051723
939 Ga0373943_0000101
940 Ga0373943_0002380
941 Ga0373943_0019104
942 Ga0373946_0089985
943 Ga0373946_0494491
944 Ga0373955_0006377
945 Ga0373924_0124279
946 Ga0373935_0003186
947 Ga0373935_0436657
948 Ga0373935_0475622
949 Ga0373927_0078714
950 Ga0373927_0104633
951 Ga0373927_0817063
952 Ga0373933_0032010
953 Ga0373947_0002740
954 Ga0373947_0004984
955 Ga0373947_0942873
956 Ga0373947_1228311
957 Ga0373925_0001828
958 Ga0373925_0010452
959 Ga0373925_0019854
960 Ga0373925_1033958
961 Ga0395899_0502132
962 Ga0395900_0062931
963 Ga0395900_0118840
964 Ga0395900_0469456
965 Ga0395900_0675402
966 Ga0395900_1046062
967 Ga0395900_1455836
968 Ga0395898_0001509
969 Ga0395898_0007850
970 Ga0395898_0342362
971 Ga0395898_0349215
972 Ga0395898_0493331
973 Ga0395898_0944284
974 Ga0395905_0106669
975 Ga0395901_0001414
976 Ga0395901_0022116
977 Ga0395901_0111813
978 Ga0395901_0128104
979 Ga0395901_0248383
980 Ga0395901_0656177
981 Ga0395901_0713905
982 Ga0395901_0780048
983 Ga0436365_1571369
984 Ga0436363_0074777
985 Ga0436363_1532817
986 Ga0451800_0466089
987 Ga0451845_0612332
988 Ga0451853_2492716
989 Ga0439448_0156574
990 Ga0439454_084621
991 Ga0466965_0106994
992 Ga0466966_0002588
993 Ga0466966_0032731
994 Ga0466963_0001732
995 Ga0466963_0023591
996 Ga0466963_0123435
997 Ga0466963_0664204
998 Ga0466964_0004414
999 Ga0466964_0105488
1000 Ga0466957_0505265
1001 Ga0466959_0015352
1002 Ga0466959_0060933
1003 Ga0466959_0721938
1004 Ga0466958_0667679
1005 Ga0466958_0705546
1006 Ga0466958_1008525
1007 Ga0466967_0007258
1008 Ga0466967_0032999
1009 Ga0466967_0044604
1010 Ga0466967_0084219
1011 Ga0466967_0231194
1012 Ga0466967_0614351
1013 Ga0466967_1037078
1014 Ga0495592_0067449
1015 Ga0495603_0102425
1016 Ga0495629_0000670
1017 Ga0495629_0189887
1018 Ga0495629_1071416
1019 Ga0495641_0000374
1020 Ga0495641_0208812
1021 Ga0495651_0004871
1022 Ga0495651_0022109
1023 Ga0495651_0191781
1024 Ga0495653_0011141
1025 Ga0495653_0039537
1026 Ga0495653_0064886
1027 Ga0495580_0387117
1028 Ga0495582_0000124
1029 Ga0495582_0579476
1030 Ga0495639_0000658
1031 Ga0495662_0000898
1032 Ga0495662_0031320
1033 Ga0495664_0033006
1034 Ga0495664_0070584
1035 Ga0495596_0071042
1036 Ga0495608_0005935
1037 Ga0495608_0038097
1038 Ga0495608_0050740
1039 Ga0495618_0053992
1040 Ga0495618_0201734
1041 Ga0495628_0916762
1042 Ga0495630_0007417
1043 Ga0495630_0021732
1044 Ga0495630_0022236
1045 Ga0495630_0059166
1046 Ga0495630_0354178
1047 Ga0495666_0030819
1048 Ga0495666_0487786
1049 Ga0495652_0026278
1050 Ga0495652_0370780
1051 Ga0495665_0000249
1052 Ga0495665_0361968
1053 Ga0495640_0019459
1054 Ga0495640_0023042
1055 Ga0495640_0080149
1056 Ga0495586_0039208
1057 Ga0495587_0006779
1058 Ga0495587_0341912
1059 Ga0495587_0641130
1060 Ga0495645_0015115
1061 Ga0495645_0046298
1062 Ga0495667_0012696
1063 Ga0495667_0030058
1064 Ga0495668_0474100
1065 Ga0495634_0038440
1066 Ga0495634_0110312
1067 Ga0495634_0329186
1068 Ga0495635_0009732
1069 Ga0495635_0012567
1070 Ga0495635_0126029
1071 Ga0495657_0035371
1072 Ga0495657_0108190
1073 Ga0495657_0110282
1074 Ga0495599_0009819
1075 Ga0495599_0322865
1076 Ga0495623_0005346
1077 Ga0495646_0112052
1078 Ga0495646_0305794
1079 Ga0495647_0000689
1080 Ga0495647_0601682
1081 Ga0495658_0000247
1082 Ga0495658_0029776
1083 Ga0495613_0001393
1084 Ga0495613_0388861
1085 Ga0495624_0045682
1086 Ga0495624_0144487
1087 Ga0495589_0274977
1088 Ga0495600_0017263
1089 Ga0495600_0398876
1090 Ga0495581_0004417
1091 Ga0495604_0014213
1092 Ga0495604_0096373
1093 Ga0495604_0340699
1094 Ga0495674_0003941
1095 Ga0495674_0011930
1096 Ga0495674_0192128
1097 Ga0495676_0001077
1098 Ga0495676_0296886
1099 Ga0495676_0493381
1100 Ga0495680_0003365
1101 Ga0495680_0013880
1102 Ga0495675_0000878
1103 Ga0495684_0001855
1104 Ga0495684_0036467
1105 Ga0495593_0039086
1106 Ga0495602_0028925
1107 Ga0495602_0283502
1108 Ga0495602_0628722
1109 Ga0495614_0009511
1110 Ga0496100_0004628
1111 Ga0496100_0064529
1112 Ga0496100_0074714
1113 Ga0496100_1455474
1114 Ga0496101_0009476
1115 Ga0496101_0018810
1116 Ga0496101_0071677
1117 Ga0496101_0159973
1118 Ga0496101_0272957
1119 Ga0496102_0009451
1120 Ga0496102_0019849
1121 Ga0496102_0275326
1122 Ga0496103_0053451
1123 Ga0496103_0544672
1124 Ga0496103_0781227
1125 Ga0496104_0026632
1126 Ga0496104_0047678
1127 Ga0496104_0050582
1128 Ga0496104_1611585
1129 Ga0496105_0002629
1130 Ga0496105_0052163
1131 Ga0496105_0128549
1132 Ga0496106_0011636
1133 Ga0496106_0947980
1134 Ga0496107_0006368
1135 Ga0496107_0075266
1136 Ga0496107_0339223
1137 Ga0496107_0699935
1138 Ga0496108_0002961
1139 Ga0496108_0836217
1140 Ga0496108_0977330
1141 Ga0496109_0002273
1142 Ga0496109_0012523
1143 Ga0496109_1191901
1144 Ga0496109_2005747
1145 Ga0496110_0030477
1146 Ga0496110_0076879
1147 Ga0496110_0208041
1148 Ga0496110_0398523
1149 Ga0496111_0008543
1150 Ga0496111_0221288
1151 Ga0496111_0780321
1152 Ga0496112_0006274
1153 Ga0496112_0010827
1154 Ga0496112_0026439
1155 Ga0496112_0101324
1156 Ga0496112_0177088
1157 Ga0496112_1450759
1158 Ga0496113_0010642
1159 Ga0496113_0275258
1160 Ga0496114_0012160
1161 Ga0496114_0024496
1162 Ga0496114_0025411
1163 Ga0496114_0627563
1164 Ga0496114_0859215
1165 Ga0496114_0980489
1166 Ga0496114_1255216
1167 Ga0496115_0002513
1168 Ga0496115_0018662
1169 Ga0496115_0113212
1170 Ga0496115_0240251
1171 Ga0496115_0283249
1172 Ga0496115_1201506
1173 Ga0496115_1395858
1174 Ga0501034_0347104
1175 Ga0501043_1272013
1176 Ga0501046_0525474
1177 Ga0501046_0574867
1178 Ga0501047_0030664
1179 Ga0501047_0897287
1180 Ga0501067_0025573
1181 Ga0501067_0251661
1182 Ga0501069_0212710
1183 Ga0501069_0548386
1184 Ga0501070_0014526
1185 Ga0501070_0104456
1186 Ga0501070_0199843
1187 Ga0501072_0006239
1188 Ga0501073_0179515
1189 Ga0501073_0225181
1190 Ga0501074_0005182
1191 Ga0501074_0006294
1192 Ga0501074_0104417
1193 Ga0501074_0432978
1194 Ga0501076_0558754
1195 Ga0501077_0512456
1196 Ga0501079_0027091
1197 Ga0501079_0563910
1198 Ga0501079_1488724
1199 Ga0501080_0021753
1200 Ga0501080_0318824
1201 Ga0501083_0005259
1202 Ga0501083_0844146
1203 Ga0501035_0909263
1204 Ga0501044_0584492
1205 nmdc:mga05p37_8824_c2
1206 nmdc:mga09592_766456_c1
1207 nmdc:mga06r32_119589_c1
1208 nmdc:mga0n895_54375_c1
1209 nmdc:mga0rr50_21866_c1
1210 nmdc:mga0a205_33711_c2
1211 Ga0495601_0010350
1212 Ga0495601_0093841
1213 Ga0495601_0720095
1214 Ga0495612_0050027
1215 Ga0495612_0172221
1216 Ga0495595_0004822
1217 Ga0495595_0008213
1218 Ga0495595_0209849
1219 Ga0495619_0002878
1220 Ga0495619_0004757
1221 Ga0495619_0005166
1222 Ga0495619_0587620
1223 Ga0501084_0204316
1224 Ga0587091_184499
1225 Ga0466962_0152859
1226 Ga0466962_0598635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7upo-assembly1.cif.gz_A crystal structure of designed heterotrimeric assembly dht03 0.686 11 67
6v7u-assembly1.cif.gz_A structure of a phage-encoded quorum sensing anti-activator, aqs1 0.5746 13 65
8d2j-assembly2.cif.gz_C a novel insecticidal protein from ferns ipd113_cow. 0.5669 13 100
1vcs-assembly1.cif.gz_A solution structure of rsgi ruh-009, an n-terminal domain of vti1a [mus musculus] 0.5581 18 100
8d2j-assembly1.cif.gz_A a novel insecticidal protein from ferns ipd113_cow. 0.5569 13 101
ID Description Score Start End Superfamily
4javA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.6432 6 72 1.10.287.130
af_Q4D532_1_122_1.25.40.270 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 0.6162 15 100 1.25.40.270
af_Q4E3R3_1_122_1.25.40.270 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 0.6156 15 100 1.25.40.270
af_Q8S0N4_1_99_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.6049 16 100 1.20.58.400
af_A0A1D6NEE8_1_99_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.6008 16 100 1.20.58.400
ID Description Score Start End GO Terms
AF-A0A7W1N6L5-F1-model_v4 Uncharacterized protein 0.965 4 101
AF-A0A7W0NHV8-F1-model_v4 Uncharacterized protein 0.9567 2 93
AF-A0A7V9I497-F1-model_v4 Uncharacterized protein 0.9563 3 101
AF-A0A538HSN3-F1-model_v4 Uncharacterized protein 0.9556 4 98
AF-A0A537TPC9-F1-model_v4 Uncharacterized protein 0.9529 9 98

Map