F469157

General Info

Members Datasets Scaffolds Average Seq Length
612 258 1224 91

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100988867|Ga0307416_1009888672
Length 85
Sequence VQLARVIGTVVVTRKDENLANRTLLVVQPIAADGAAVGRTLVAVDTVFFVRGKEASFPFHPTEVPTDAGVVGIVDHYDVDHSFHP

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
182 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
187 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
188 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
189 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
190 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
195 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 1.47
Rhizosphere 97.39
Stem 0
Stem Tuber 0
Unclassified 29.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100988867 3300032002 Bacteria 944
2 JGI25406J46586_10006219 3300003203 Bacteria 5513
3 JGI25406J46586_10087643 3300003203 Unclassified 944
4 Ga0058859_11615926 3300004798 Bacteria 617
5 Ga0058860_11945095 3300004801 Bacteria 780
6 Ga0065704_10136530 3300005289 Bacteria 1564
7 Ga0065704_10555237 3300005289 Bacteria 632
8 Ga0065712_10020576 3300005290 Archaea 2039
9 Ga0065712_10638983 3300005290 Unclassified 571
10 Ga0065715_10008633 3300005293 Bacteria 4249
11 Ga0065715_10132159 3300005293 Unclassified 1995
12 Ga0065715_10608925 3300005293 Bacteria 670
13 Ga0065707_10031200 3300005295 Bacteria 1306
14 Ga0065707_10469073 3300005295 Bacteria 784
15 Ga0065707_10748298 3300005295 Bacteria 619
16 Ga0070676_10023344 3300005328 Bacteria 3476
17 Ga0070676_10156131 3300005328 Bacteria 1465
18 Ga0070676_10807019 3300005328 Unclassified 693
19 Ga0070690_100010055 3300005330 Bacteria 5491
20 Ga0070690_100103695 3300005330 Unclassified 1889
21 Ga0070670_100042718 3300005331 Unclassified 3898
22 Ga0070670_100134944 3300005331 Bacteria 2133
23 Ga0070670_100559486 3300005331 Bacteria 1021
24 Ga0070670_100587542 3300005331 Unclassified 996
25 Ga0070677_10006385 3300005333 Unclassified 3915
26 Ga0070677_10404109 3300005333 Bacteria 721
27 Ga0070677_10503373 3300005333 Bacteria 657
28 Ga0070677_10576771 3300005333 Bacteria 620
29 Ga0070677_10692922 3300005333 Unclassified 573
30 Ga0070677_10817765 3300005333 Unclassified 533
31 Ga0068869_100009028 3300005334 Bacteria 6459
32 Ga0068869_100040053 3300005334 Bacteria 3349
33 Ga0068869_100364530 3300005334 Bacteria 1181
34 Ga0068869_100365949 3300005334 Bacteria 1179
35 Ga0070666_10869761 3300005335 Unclassified 666
36 Ga0070666_11072223 3300005335 Archaea 598
37 Ga0070680_100256274 3300005336 Bacteria 1480
38 Ga0070680_101410549 3300005336 Unclassified 603
39 Ga0068868_100017226 3300005338 Bacteria 5377
40 Ga0068868_101255008 3300005338 Unclassified 687
41 Ga0068868_101522308 3300005338 Unclassified 627
42 Ga0070660_100834389 3300005339 Bacteria 776
43 Ga0070689_100029535 3300005340 Bacteria 4151
44 Ga0070689_100853246 3300005340 Archaea 803
45 Ga0070689_101338340 3300005340 Bacteria 646
46 Ga0070689_101883927 3300005340 Unclassified 546
47 Ga0070691_10679776 3300005341 Unclassified 616
48 Ga0070687_100009423 3300005343 Unclassified 4185
49 Ga0070687_100042409 3300005343 Archaea 2305
50 Ga0070687_100389438 3300005343 Unclassified 911
51 Ga0070661_100286780 3300005344 Bacteria 1278
52 Ga0070661_100918382 3300005344 Unclassified 723
53 Ga0070692_10190771 3300005345 Unclassified 1194
54 Ga0070668_100235358 3300005347 Bacteria 1515
55 Ga0070668_100501241 3300005347 Bacteria 1051
56 Ga0070668_101416626 3300005347 Bacteria 634
57 Ga0070669_100000264 3300005353 Bacteria 42905
58 Ga0070669_100031295 3300005353 Bacteria 3844
59 Ga0070669_100056961 3300005353 Bacteria 2866
60 Ga0070669_100191132 3300005353 Bacteria 1606
61 Ga0070669_100357198 3300005353 Unclassified 1187
62 Ga0070669_100940244 3300005353 Unclassified 740
63 Ga0070675_100004615 3300005354 Bacteria 10519
64 Ga0070675_100104302 3300005354 Unclassified 2392
65 Ga0070675_100371285 3300005354 Bacteria 1272
66 Ga0070675_100594703 3300005354 Unclassified 1003
67 Ga0070671_100242858 3300005355 Bacteria 1529
68 Ga0070671_100258049 3300005355 Archaea 1481
69 Ga0070674_100892364 3300005356 Bacteria 774
70 Ga0070674_101244626 3300005356 Bacteria 662
71 Ga0070673_100015867 3300005364 Bacteria 5306
72 Ga0070673_100324133 3300005364 Unclassified 1361
73 Ga0070688_100009649 3300005365 Bacteria 5293
74 Ga0070688_100454236 3300005365 Bacteria 958
75 Ga0070688_100724566 3300005365 Unclassified 772
76 Ga0070659_101048492 3300005366 Unclassified 717
77 Ga0070667_100312103 3300005367 Archaea 1417
78 Ga0070667_100902156 3300005367 Bacteria 823
79 Ga0070713_101271907 3300005436 Unclassified 713
80 Ga0070701_10004293 3300005438 Bacteria 5751
81 Ga0070701_10032587 3300005438 Bacteria 2597
82 Ga0070701_10422802 3300005438 Bacteria 849
83 Ga0070701_10492103 3300005438 Unclassified 795
84 Ga0070705_100030663 3300005440 Bacteria 2970
85 Ga0070705_100073356 3300005440 Unclassified 2076
86 Ga0070705_101344226 3300005440 Bacteria 594
87 Ga0070700_100120411 3300005441 Unclassified 1758
88 Ga0070700_100627594 3300005441 Bacteria 846
89 Ga0070700_101330239 3300005441 Unclassified 605
90 Ga0070694_100037839 3300005444 Unclassified 3202
91 Ga0070694_100161959 3300005444 Unclassified 1642
92 Ga0070694_100167405 3300005444 Bacteria 1617
93 Ga0070694_100192070 3300005444 Bacteria 1517
94 Ga0070663_100031312 3300005455 Bacteria 3655
95 Ga0070678_100025263 3300005456 Bacteria 3993
96 Ga0070678_100036931 3300005456 Bacteria 3425
97 Ga0070678_100633588 3300005456 Unclassified 957
98 Ga0070678_100703082 3300005456 Unclassified 911
99 Ga0070678_101545531 3300005456 Bacteria 622
100 Ga0070662_100009943 3300005457 Bacteria 6231
101 Ga0070662_100081333 3300005457 Unclassified 2413
102 Ga0068867_100009503 3300005459 Bacteria 6858
103 Ga0068867_100042999 3300005459 Bacteria 3307
104 Ga0068867_100662159 3300005459 Bacteria 917
105 Ga0068867_101275889 3300005459 Unclassified 677
106 Ga0070685_10045271 3300005466 Bacteria 2523
107 Ga0070685_10553472 3300005466 Archaea 821
108 Ga0070685_10781756 3300005466 Unclassified 702
109 Ga0070706_100363345 3300005467 Bacteria 1349
110 Ga0070707_100067207 3300005468 Bacteria 3448
111 Ga0070707_102198339 3300005468 Bacteria 519
112 Ga0070698_100036087 3300005471 Bacteria 5109
113 Ga0070698_101534626 3300005471 Bacteria 618
114 Ga0070698_101921121 3300005471 Unclassified 545
115 Ga0070698_102140036 3300005471 Bacteria 513
116 Ga0070699_100004002 3300005518 Bacteria 13022
117 Ga0070699_100028370 3300005518 Bacteria 4826
118 Ga0070699_100036179 3300005518 Unclassified 4271
119 Ga0070684_101186721 3300005535 Archaea 718
120 Ga0070697_100395452 3300005536 Bacteria 1199
121 Ga0068853_100693004 3300005539 Unclassified 971
122 Ga0070672_100026255 3300005543 Bacteria 4331
123 Ga0070672_100027353 3300005543 Unclassified 4252
124 Ga0070672_100083615 3300005543 Bacteria 2562
125 Ga0070672_100506776 3300005543 Unclassified 1044
126 Ga0070672_100915317 3300005543 Unclassified 775
127 Ga0070686_100102005 3300005544 Unclassified 1940
128 Ga0070695_100466148 3300005545 Unclassified 971
129 Ga0070695_100557653 3300005545 Bacteria 894
130 Ga0070696_100044491 3300005546 Bacteria 3074
131 Ga0070665_101187382 3300005548 Unclassified 774
132 Ga0070704_100001363 3300005549 Bacteria 12952
133 Ga0070704_101354351 3300005549 Bacteria 652
134 Ga0070704_101458311 3300005549 Bacteria 629
135 Ga0070664_100020981 3300005564 Bacteria 5382
136 Ga0070664_100070840 3300005564 Bacteria 2987
137 Ga0070664_100085987 3300005564 Unclassified 2717
138 Ga0070664_100309727 3300005564 Bacteria 1428
139 Ga0070664_101290251 3300005564 Unclassified 689
140 Ga0070664_101697387 3300005564 Bacteria 599
141 Ga0068857_100055951 3300005577 Unclassified 3500
142 Ga0068857_101662920 3300005577 Archaea 624
143 Ga0068857_102218755 3300005577 Unclassified 539
144 Ga0070702_100098870 3300005615 Bacteria 1786
145 Ga0068852_100398959 3300005616 Bacteria 1353
146 Ga0068859_100006367 3300005617 Bacteria 11973
147 Ga0068859_100018818 3300005617 Bacteria 6939
148 Ga0068859_100059059 3300005617 Unclassified 3864
149 Ga0068859_100139884 3300005617 Unclassified 2494
150 Ga0068864_100028514 3300005618 Bacteria 4720
151 Ga0068864_100103670 3300005618 Bacteria 2526
152 Ga0068864_100385769 3300005618 Bacteria 1329
153 Ga0068864_102079760 3300005618 Bacteria 574
154 Ga0068861_100001392 3300005719 Bacteria 15179
155 Ga0068861_100062211 3300005719 Bacteria 2866
156 Ga0068870_10001025 3300005840 Bacteria 11049
157 Ga0068870_10274916 3300005840 Bacteria 1054
158 Ga0068870_10395824 3300005840 Unclassified 898
159 Ga0068863_100009464 3300005841 Bacteria 9505
160 Ga0068863_100104587 3300005841 Bacteria 2693
161 Ga0068858_100015247 3300005842 Bacteria 7231
162 Ga0068858_100210577 3300005842 Unclassified 1839
163 Ga0068860_100028667 3300005843 Bacteria 5359
164 Ga0068860_100059487 3300005843 Bacteria 3632
165 Ga0068860_100181573 3300005843 Unclassified 2034
166 Ga0068862_100000749 3300005844 Bacteria 32563
167 Ga0068862_100005782 3300005844 Bacteria 10313
168 Ga0068862_100236130 3300005844 Bacteria 1660
169 Ga0068862_100338429 3300005844 Bacteria 1393
170 Ga0068862_100503648 3300005844 Bacteria 1150
171 Ga0068862_102608333 3300005844 Unclassified 517
172 Ga0081539_10000134 3300005985 Bacteria 173625
173 Ga0081539_10003338 3300005985 Bacteria 19954
174 Ga0070717_10386788 3300006028 Bacteria 1255
175 Ga0075432_10254336 3300006058 Unclassified 714
176 Ga0075432_10386619 3300006058 Bacteria 601
177 Ga0070712_101968845 3300006175 Unclassified 512
178 Ga0075367_10529845 3300006178 Bacteria 748
179 Ga0097621_100144652 3300006237 Bacteria 2034
180 Ga0097621_100930149 3300006237 Unclassified 811
181 Ga0097621_100940074 3300006237 Bacteria 807
182 Ga0097621_102221086 3300006237 Bacteria 525
183 Ga0068871_100107941 3300006358 Unclassified 2339
184 Ga0068871_100123987 3300006358 Bacteria 2185
185 Ga0068871_100235116 3300006358 Bacteria 1592
186 Ga0068871_100650232 3300006358 Unclassified 962
187 Ga0068871_100732880 3300006358 Bacteria 907
188 Ga0068871_102141036 3300006358 Bacteria 533
189 Ga0075428_100039017 3300006844 Bacteria 5227
190 Ga0075428_100119604 3300006844 Bacteria 2868
191 Ga0075428_100155348 3300006844 Unclassified 2486
192 Ga0075428_100549329 3300006844 Bacteria 1235
193 Ga0075428_101048833 3300006844 Unclassified 862
194 Ga0075428_101867566 3300006844 Unclassified 624
195 Ga0075428_102296618 3300006844 Bacteria 555
196 Ga0075430_100003466 3300006846 Bacteria 13203
197 Ga0075431_100074421 3300006847 Bacteria 3505
198 Ga0075431_100162402 3300006847 Bacteria 2297
199 Ga0075431_100617652 3300006847 Bacteria 1067
200 Ga0075433_10013705 3300006852 Bacteria 6602
201 Ga0075433_10032056 3300006852 Bacteria 4498
202 Ga0075433_10221221 3300006852 Bacteria 1682
203 Ga0075434_100122892 3300006871 Bacteria 2612
204 Ga0075434_100123146 3300006871 Bacteria 2609
205 Ga0075429_100010793 3300006880 Bacteria 7899
206 Ga0075429_100032043 3300006880 Bacteria 4569
207 Ga0075429_100050516 3300006880 Bacteria 3617
208 Ga0075429_100432820 3300006880 Unclassified 1153
209 Ga0075429_100462577 3300006880 Bacteria 1112
210 Ga0068865_100249095 3300006881 Bacteria 1401
211 Ga0068865_100341264 3300006881 Unclassified 1211
212 Ga0068865_102006060 3300006881 Bacteria 525
213 Ga0097620_100006367 3300006931 Bacteria 11973
214 Ga0097620_100018818 3300006931 Bacteria 6939
215 Ga0097620_100059047 3300006931 Unclassified 3864
216 Ga0097620_100139886 3300006931 Unclassified 2494
217 Ga0075435_100061362 3300007076 Unclassified 3050
218 Ga0111539_10000302 3300009094 Bacteria 59849
219 Ga0111539_10004769 3300009094 Bacteria 17699
220 Ga0111539_10033005 3300009094 Bacteria 6285
221 Ga0111539_10049295 3300009094 Bacteria 5023
222 Ga0111539_10072442 3300009094 Bacteria 4063
223 Ga0111539_10115101 3300009094 Bacteria 3154
224 Ga0111539_10182653 3300009094 Bacteria 2450
225 Ga0111539_10254868 3300009094 Bacteria 2043
226 Ga0111539_10299358 3300009094 Unclassified 1872
227 Ga0111539_10407981 3300009094 Bacteria 1582
228 Ga0111539_10623280 3300009094 Bacteria 1256
229 Ga0111539_11281365 3300009094 Bacteria 851
230 Ga0105245_10798482 3300009098 Archaea 982
231 Ga0105247_10408552 3300009101 Bacteria 969
232 Ga0114129_10001012 3300009147 Bacteria 36639
233 Ga0114129_10057781 3300009147 Bacteria 5427
234 Ga0114129_10084220 3300009147 Bacteria 4415
235 Ga0114129_10182645 3300009147 Bacteria 2853
236 Ga0114129_10698821 3300009147 Unclassified 1304
237 Ga0114129_10898988 3300009147 Bacteria 1122
238 Ga0114129_13351546 3300009147 Bacteria 517
239 Ga0105243_10096564 3300009148 Unclassified 2445
240 Ga0105243_10538930 3300009148 Unclassified 1113
241 Ga0105243_12329586 3300009148 Unclassified 573
242 Ga0105241_10556673 3300009174 Bacteria 1030
243 Ga0105242_13035507 3300009176 Bacteria 520
244 Ga0105248_10203708 3300009177 Bacteria 2229
245 Ga0105248_10299112 3300009177 Bacteria 1812
246 Ga0105248_11122885 3300009177 Bacteria 888
247 Ga0105249_10001795 3300009553 Bacteria 18668
248 Ga0105249_10247408 3300009553 Unclassified 1766
249 Ga0105249_11311120 3300009553 Bacteria 796
250 Ga0105249_12033715 3300009553 Unclassified 647
251 Ga0105249_13431571 3300009553 Bacteria 510
252 Ga0105246_10003810 3300011119 Bacteria 9141
253 Ga0157314_1001190 3300012500 Unclassified 1921
254 Ga0157371_10563475 3300013102 Bacteria 845
255 Ga0157374_10079407 3300013296 Bacteria 3109
256 Ga0157374_10423451 3300013296 Bacteria 1330
257 Ga0157374_10447683 3300013296 Bacteria 1293
258 Ga0157374_10541098 3300013296 Bacteria 1172
259 Ga0157378_10293346 3300013297 Bacteria 1571
260 Ga0157378_12049912 3300013297 Bacteria 622
261 Ga0163162_10018987 3300013306 Bacteria 6742
262 Ga0163162_11449027 3300013306 Bacteria 782
263 Ga0157375_10302510 3300013308 Unclassified 1763
264 Ga0157375_10899347 3300013308 Unclassified 1029
265 Ga0157380_10003616 3300014326 Bacteria 10632
266 Ga0157380_10016183 3300014326 Bacteria 5494
267 Ga0157380_10087332 3300014326 Bacteria 2564
268 Ga0157380_10203902 3300014326 Archaea 1757
269 Ga0157380_10297756 3300014326 Bacteria 1484
270 Ga0157380_10360600 3300014326 Bacteria 1364
271 Ga0157380_10909709 3300014326 Bacteria 907
272 Ga0157380_11428460 3300014326 Unclassified 743
273 Ga0157377_10018009 3300014745 Unclassified 3665
274 Ga0157377_10023718 3300014745 Bacteria 3255
275 Ga0157377_10049625 3300014745 Bacteria 2360
276 Ga0157377_11087357 3300014745 Unclassified 612
277 Ga0157379_10009913 3300014968 Bacteria 8299
278 Ga0157379_10317028 3300014968 Bacteria 1423
279 Ga0157376_10020942 3300014969 Bacteria 5069
280 Ga0157376_10096144 3300014969 Bacteria 2577
281 Ga0157376_10297556 3300014969 Unclassified 1526
282 Ga0157376_11678469 3300014969 Unclassified 670
283 Ga0163161_10015908 3300017792 Bacteria 5249
284 Ga0163161_10867024 3300017792 Archaea 763
285 Ga0207673_1015807 3300025290 Unclassified 1001
286 Ga0207697_10000575 3300025315 Bacteria 20854
287 Ga0207653_10031715 3300025885 Unclassified 1708
288 Ga0207682_10009140 3300025893 Bacteria 3915
289 Ga0207682_10212884 3300025893 Bacteria 892
290 Ga0207682_10470437 3300025893 Unclassified 595
291 Ga0207710_10587022 3300025900 Bacteria 582
292 Ga0207688_10000078 3300025901 Bacteria 37290
293 Ga0207688_10406562 3300025901 Bacteria 845
294 Ga0207680_10696059 3300025903 Unclassified 728
295 Ga0207645_10002104 3300025907 Bacteria 15935
296 Ga0207645_10060658 3300025907 Unclassified 2415
297 Ga0207645_10519118 3300025907 Unclassified 807
298 Ga0207643_10000706 3300025908 Bacteria 20718
299 Ga0207643_10025639 3300025908 Unclassified 3259
300 Ga0207643_10157901 3300025908 Bacteria 1363
301 Ga0207643_10351873 3300025908 Unclassified 925
302 Ga0207693_10282268 3300025915 Bacteria 1301
303 Ga0207660_10155567 3300025917 Bacteria 1760
304 Ga0207662_10001063 3300025918 Bacteria 12911
305 Ga0207662_10008655 3300025918 Bacteria 5582
306 Ga0207662_10188482 3300025918 Unclassified 1330
307 Ga0207662_10219968 3300025918 Unclassified 1236
308 Ga0207662_10423295 3300025918 Unclassified 906
309 Ga0207657_10331456 3300025919 Bacteria 1202
310 Ga0207649_10131710 3300025920 Archaea 1699
311 Ga0207649_10175062 3300025920 Bacteria 1498
312 Ga0207649_11330246 3300025920 Bacteria 568
313 Ga0207646_11170836 3300025922 Bacteria 675
314 Ga0207646_11459706 3300025922 Unclassified 593
315 Ga0207681_10038294 3300025923 Bacteria 3176
316 Ga0207681_10044121 3300025923 Bacteria 2987
317 Ga0207681_10075046 3300025923 Unclassified 2370
318 Ga0207681_10221207 3300025923 Bacteria 1465
319 Ga0207681_10275153 3300025923 Bacteria 1323
320 Ga0207650_10221378 3300025925 Bacteria 1523
321 Ga0207650_10924509 3300025925 Unclassified 741
322 Ga0207659_10020842 3300025926 Bacteria 4340
323 Ga0207659_10021888 3300025926 Unclassified 4251
324 Ga0207659_10137124 3300025926 Bacteria 1895
325 Ga0207659_10170875 3300025926 Bacteria 1715
326 Ga0207659_10450840 3300025926 Bacteria 1084
327 Ga0207659_10553417 3300025926 Unclassified 978
328 Ga0207659_10992431 3300025926 Bacteria 722
329 Ga0207659_11756073 3300025926 Unclassified 528
330 Ga0207687_11710925 3300025927 Bacteria 539
331 Ga0207700_10598875 3300025928 Bacteria 981
332 Ga0207644_10078348 3300025931 Bacteria 2436
333 Ga0207644_10286655 3300025931 Archaea 1323
334 Ga0207690_10933536 3300025932 Unclassified 720
335 Ga0207690_11184518 3300025932 Archaea 638
336 Ga0207706_10002635 3300025933 Bacteria 17477
337 Ga0207706_10044762 3300025933 Unclassified 3922
338 Ga0207686_10875154 3300025934 Bacteria 724
339 Ga0207670_10009398 3300025936 Bacteria 5581
340 Ga0207670_10115095 3300025936 Unclassified 1945
341 Ga0207670_10705035 3300025936 Bacteria 836
342 Ga0207670_10986793 3300025936 Archaea 708
343 Ga0207669_10183555 3300025937 Bacteria 1502
344 Ga0207669_10527367 3300025937 Bacteria 949
345 Ga0207669_11583400 3300025937 Bacteria 559
346 Ga0207704_10165722 3300025938 Unclassified 1578
347 Ga0207704_11703929 3300025938 Bacteria 542
348 Ga0207691_10024093 3300025940 Bacteria 5724
349 Ga0207691_10034319 3300025940 Bacteria 4718
350 Ga0207691_10073970 3300025940 Bacteria 3073
351 Ga0207691_10344461 3300025940 Bacteria 1275
352 Ga0207691_10794637 3300025940 Unclassified 795
353 Ga0207711_10085622 3300025941 Bacteria 2762
354 Ga0207711_10767719 3300025941 Bacteria 898
355 Ga0207711_11243827 3300025941 Unclassified 686
356 Ga0207689_10002929 3300025942 Bacteria 15757
357 Ga0207689_10101197 3300025942 Bacteria 2367
358 Ga0207689_10135754 3300025942 Unclassified 2026
359 Ga0207689_10545065 3300025942 Bacteria 974
360 Ga0207689_11417561 3300025942 Unclassified 582
361 Ga0207679_10042963 3300025945 Unclassified 3251
362 Ga0207679_10341463 3300025945 Bacteria 1302
363 Ga0207679_10838359 3300025945 Bacteria 839
364 Ga0207679_10916318 3300025945 Bacteria 802
365 Ga0207651_10231831 3300025960 Bacteria 1499
366 Ga0207651_10277983 3300025960 Unclassified 1382
367 Ga0207651_10350728 3300025960 Bacteria 1242
368 Ga0207651_10504133 3300025960 Bacteria 1047
369 Ga0207651_10535025 3300025960 Bacteria 1017
370 Ga0207651_11405416 3300025960 Unclassified 628
371 Ga0207712_10132836 3300025961 Unclassified 1899
372 Ga0207712_10350367 3300025961 Bacteria 1227
373 Ga0207668_10106181 3300025972 Bacteria 2097
374 Ga0207668_10956369 3300025972 Bacteria 764
375 Ga0207640_10169070 3300025981 Unclassified 1627
376 Ga0207658_10793408 3300025986 Archaea 859
377 Ga0207658_10975590 3300025986 Bacteria 773
378 Ga0207658_11395517 3300025986 Bacteria 641
379 Ga0207677_10816999 3300026023 Bacteria 835
380 Ga0207677_10915546 3300026023 Archaea 791
381 Ga0207677_11063904 3300026023 Archaea 736
382 Ga0207703_10010475 3300026035 Bacteria 7248
383 Ga0207703_10169750 3300026035 Unclassified 1918
384 Ga0207703_10253084 3300026035 Bacteria 1588
385 Ga0207639_10779950 3300026041 Unclassified 890
386 Ga0207639_10839992 3300026041 Bacteria 857
387 Ga0207678_10043842 3300026067 Bacteria 3870
388 Ga0207708_10050683 3300026075 Unclassified 3160
389 Ga0207708_10069993 3300026075 Bacteria 2687
390 Ga0207708_10135519 3300026075 Unclassified 1928
391 Ga0207708_10168268 3300026075 Bacteria 1734
392 Ga0207708_10285002 3300026075 Bacteria 1340
393 Ga0207708_10916311 3300026075 Bacteria 759
394 Ga0207641_10027081 3300026088 Bacteria 4733
395 Ga0207641_12640482 3300026088 Unclassified 500
396 Ga0207648_10001511 3300026089 Bacteria 25628
397 Ga0207648_10005943 3300026089 Bacteria 12209
398 Ga0207648_10404379 3300026089 Bacteria 1238
399 Ga0207676_10124626 3300026095 Unclassified 2179
400 Ga0207676_10594324 3300026095 Bacteria 1062
401 Ga0207674_10027680 3300026116 Bacteria 5992
402 Ga0207674_10264081 3300026116 Bacteria 1669
403 Ga0207674_10661741 3300026116 Unclassified 1009
404 Ga0207675_100004132 3300026118 Bacteria 14051
405 Ga0207675_100007494 3300026118 Bacteria 10308
406 Ga0207683_10023350 3300026121 Bacteria 5320
407 Ga0207683_10024468 3300026121 Bacteria 5202
408 Ga0207683_10359318 3300026121 Bacteria 1337
409 Ga0207683_11405816 3300026121 Unclassified 645
410 Ga0207698_11353158 3300026142 Unclassified 727
411 Ga0207698_11608093 3300026142 Unclassified 665
412 Ga0209981_1054867 3300027378 Bacteria 606
413 Ga0209999_1027380 3300027543 Bacteria 1055
414 Ga0209970_1099648 3300027614 Unclassified 555
415 Ga0210002_1078124 3300027617 Bacteria 588
416 Ga0209971_1002754 3300027682 Bacteria 4198
417 Ga0209971_1119922 3300027682 Bacteria 646
418 Ga0209998_10044584 3300027717 Bacteria 1014
419 Ga0207428_10001905 3300027907 Bacteria 21121
420 Ga0207428_10005145 3300027907 Bacteria 12252
421 Ga0207428_10040707 3300027907 Bacteria 3766
422 Ga0207428_10073769 3300027907 Bacteria 2676
423 Ga0207428_10156144 3300027907 Bacteria 1735
424 Ga0207428_10246313 3300027907 Bacteria 1334
425 Ga0207428_10266087 3300027907 Bacteria 1276
426 Ga0207428_10471800 3300027907 Unclassified 914
427 Ga0207428_10500405 3300027907 Bacteria 883
428 Ga0207428_11218075 3300027907 Unclassified 523
429 Ga0268265_10001361 3300028380 Bacteria 20828
430 Ga0268265_10013473 3300028380 Bacteria 5556
431 Ga0268265_10223993 3300028380 Bacteria 1648
432 Ga0268265_10524715 3300028380 Bacteria 1120
433 Ga0268265_10944838 3300028380 Unclassified 849
434 Ga0268265_11121406 3300028380 Bacteria 782
435 Ga0268265_11140502 3300028380 Bacteria 775
436 Ga0268264_10182698 3300028381 Unclassified 1906
437 Ga0268264_10313693 3300028381 Archaea 1480
438 Ga0307408_100534926 3300031548 Bacteria 1032
439 Ga0307405_11002520 3300031731 Unclassified 712
440 Ga0307413_11026488 3300031824 Unclassified 708
441 Ga0307413_12105361 3300031824 Unclassified 510
442 Ga0307410_11524764 3300031852 Unclassified 589
443 Ga0307412_10834307 3300031911 Unclassified 803
444 Ga0307412_11525260 3300031911 Bacteria 608
445 Ga0307409_100461061 3300031995 Bacteria 1229
446 Ga0307416_101220311 3300032002 Bacteria 858
447 Ga0307416_101406750 3300032002 Bacteria 803
448 Ga0307414_11672065 3300032004 Bacteria 594
449 Ga0307414_11805147 3300032004 Bacteria 571
450 Ga0307411_11640951 3300032005 Unclassified 594
451 Ga0307415_100752768 3300032126 Bacteria 885
452 Ga0373958_0020898 3300034819 Unclassified 1210
453 Ga0373959_0119792 3300034820 Bacteria 642
454 Ga0373949_0165005 3300035090 Bacteria 648
455 Ga0373951_0014710 3300035091 Bacteria 1760
456 Ga0373932_0178991 3300035112 Bacteria 743
457 Ga0373936_0235676 3300035113 Bacteria 815
458 Ga0373960_0366758 3300035121 Unclassified 549
459 Ga0373961_0139942 3300035241 Bacteria 817
460 Ga0373962_0021399 3300035242 Unclassified 1706
461 Ga0373962_0225204 3300035242 Bacteria 643
462 Ga0373931_0290106 3300035691 Bacteria 1007
463 Ga0373931_0298349 3300035691 Unclassified 994
464 Ga0373937_0031398 3300036401 Bacteria 4814
465 Ga0439453_0007776 3300041408 Bacteria 1709
466 Ga0451787_476215 3300041441 Bacteria 581
467 Ga0451807_0242364 3300041486 Bacteria 751
468 Ga0451847_0463665 3300041503 Bacteria 915
469 Ga0451853_1279594 3300041512 Unclassified 1357
470 Ga0439450_015089 3300042008 Bacteria 1577
471 Ga0439456_101511 3300042013 Bacteria 651
472 Ga0450890_011980 3300042127 Bacteria 1123
473 Ga0450890_071637 3300042127 Unclassified 555
474 Ga0450894_012344 3300042131 Bacteria 1117
475 Ga0450910_042125 3300042147 Bacteria 740
476 Ga0439435_0244996 3300042436 Unclassified 602
477 Ga0439444_0119418 3300042437 Bacteria 614
478 Ga0439464_0230662 3300042439 Unclassified 595
479 Ga0439460_0340809 3300042461 Unclassified 528
480 Ga0439440_0051308 3300042993 Unclassified 1031
481 Ga0439440_0175289 3300042993 Unclassified 625
482 Ga0451576_0085703 3300045051 Bacteria 3277
483 Ga0451576_0173981 3300045051 Bacteria 2247
484 Ga0451576_0180255 3300045051 Bacteria 2206
485 Ga0495603_0040942 3300046455 Bacteria 2772
486 Ga0495629_0210807 3300046459 Bacteria 1342
487 Ga0495639_0365280 3300046475 Bacteria 726
488 Ga0495639_0426628 3300046475 Bacteria 672
489 Ga0495594_0012571 3300046499 Bacteria 4412
490 Ga0495594_0114642 3300046499 Unclassified 1521
491 Ga0495594_0697101 3300046499 Unclassified 574
492 Ga0495607_0284819 3300046501 Bacteria 783
493 Ga0495663_0241571 3300046525 Bacteria 639
494 Ga0495642_0272654 3300046528 Bacteria 741
495 Ga0495652_0836397 3300046529 Unclassified 611
496 Ga0495640_0573295 3300046533 Bacteria 683
497 Ga0495621_0004646 3300046539 Bacteria 3882
498 Ga0495621_0015596 3300046539 Bacteria 2425
499 Ga0495621_0044890 3300046539 Bacteria 1564
500 Ga0495633_0378704 3300046558 Bacteria 640
501 Ga0495634_0662215 3300046642 Unclassified 602
502 Ga0495659_0018217 3300046664 Bacteria 2337
503 Ga0495659_0417260 3300046664 Unclassified 581
504 Ga0495588_0414415 3300046674 Unclassified 707
505 Ga0495623_0250602 3300046679 Bacteria 996
506 Ga0495669_0017261 3300046684 Bacteria 3096
507 Ga0495669_0293681 3300046684 Unclassified 783
508 Ga0495672_0001674 3300047320 Bacteria 21496
509 Ga0495672_0120395 3300047320 Bacteria 1396
510 Ga0496102_0677799 3300048905 Unclassified 954
511 Ga0496106_0446521 3300048909 Bacteria 1039
512 Ga0496108_0464174 3300048911 Bacteria 1106
513 Ga0496110_0872847 3300048913 Archaea 805
514 Ga0496112_1450145 3300048915 Archaea 601
515 Ga0496113_0047706 3300048916 Bacteria 3184
516 Ga0496114_1450645 3300048917 Bacteria 574
517 Ga0501031_0307875 3300049568 Bacteria 1026
518 Ga0501031_0426681 3300049568 Bacteria 857
519 Ga0501033_0213368 3300049570 Bacteria 1376
520 Ga0501033_0533429 3300049570 Bacteria 810
521 Ga0501036_0355427 3300049572 Bacteria 1223
522 Ga0501036_0431510 3300049572 Bacteria 1098
523 Ga0501037_0265950 3300049573 Bacteria 1198
524 Ga0501038_0089956 3300049574 Bacteria 2574
525 Ga0501039_0378525 3300049575 Bacteria 1112
526 Ga0501039_0977638 3300049575 Viruses 658
527 Ga0501040_0161934 3300049576 Unclassified 1582
528 Ga0501041_0102035 3300049577 Unclassified 1777
529 Ga0501041_0226899 3300049577 Bacteria 1172
530 Ga0501042_0229201 3300049578 Bacteria 1340
531 Ga0501042_0451285 3300049578 Bacteria 932
532 Ga0501042_1079464 3300049578 Unclassified 585
533 Ga0501042_1289562 3300049578 Unclassified 533
534 Ga0501043_0916239 3300049579 Bacteria 628
535 Ga0501048_0047173 3300049582 Bacteria 3074
536 Ga0501048_0076492 3300049582 Bacteria 2362
537 Ga0501067_0106008 3300049583 Bacteria 1562
538 Ga0501067_0258191 3300049583 Bacteria 970
539 Ga0501068_0432205 3300049584 Bacteria 851
540 Ga0501068_0630388 3300049584 Unclassified 699
541 Ga0501068_0850767 3300049584 Bacteria 599
542 Ga0501070_1279280 3300049586 Bacteria 561
543 Ga0501071_0010383 3300049587 Bacteria 6239
544 Ga0501071_0560701 3300049587 Bacteria 878
545 Ga0501071_0937272 3300049587 Unclassified 668
546 Ga0501072_0443271 3300049588 Unclassified 1028
547 Ga0501073_0002831 3300049589 Bacteria 13000
548 Ga0501074_0204181 3300049590 Bacteria 1408
549 Ga0501074_0742509 3300049590 Bacteria 692
550 Ga0501075_0035247 3300049591 Bacteria 3731
551 Ga0501075_0165581 3300049591 Bacteria 1686
552 Ga0501075_0396445 3300049591 Bacteria 1052
553 Ga0501075_1243278 3300049591 Unclassified 565
554 Ga0501076_0057353 3300049592 Bacteria 3092
555 Ga0501076_0330275 3300049592 Bacteria 1251
556 Ga0501076_0341282 3300049592 Bacteria 1229
557 Ga0501077_0330857 3300049593 Unclassified 971
558 Ga0501077_0436720 3300049593 Bacteria 838
559 Ga0501079_0262890 3300049741 Bacteria 1349
560 Ga0501079_0626969 3300049741 Unclassified 846
561 Ga0501080_0373535 3300049742 Unclassified 1285
562 Ga0501080_0452515 3300049742 Bacteria 1151
563 Ga0501081_0492666 3300049743 Viruses 913
564 Ga0501045_0078250 3300049824 Bacteria 2438
565 Ga0501045_0126945 3300049824 Bacteria 1895
566 nmdc:mga0k408_918954_c1 3300050493 Unclassified 507
567 nmdc:mga05p37_1579832_c1 3300050507 Unclassified 648
568 nmdc:mga05p37_217150_c1 3300050507 Bacteria 2309
569 nmdc:mga05p37_3921_c1 3300050507 Bacteria 17427
570 nmdc:mga05p37_61163_c1 3300050507 Bacteria 4636
571 nmdc:mga05p37_78444_c1 3300050507 Bacteria 4066
572 nmdc:mga09592_170653_c1 3300050508 Bacteria 1881
573 nmdc:mga09592_41119_c1 3300050508 Bacteria 3886
574 nmdc:mga09592_411948_c1 3300050508 Bacteria 1168
575 nmdc:mga09592_62807_c1 3300050508 Bacteria 3142
576 nmdc:mga09592_98290_c1 3300050508 Bacteria 2505
577 nmdc:mga0qj67_1346182_c1 3300050509 Unclassified 552
578 nmdc:mga0qj67_78433_c1 3300050509 Bacteria 2644
579 nmdc:mga06r32_187053_c1 3300050510 Bacteria 2058
580 nmdc:mga06r32_203628_c1 3300050510 Bacteria 1967
581 nmdc:mga06r32_334111_c1 3300050510 Bacteria 1500
582 nmdc:mga08y16_136999_c1 3300050511 Unclassified 2545
583 nmdc:mga08y16_202659_c1 3300050511 Unclassified 2056
584 nmdc:mga08y16_218500_c1 3300050511 Bacteria 1973
585 nmdc:mga08y16_220661_c1 3300050511 Unclassified 1963
586 nmdc:mga08y16_252981_c1 3300050511 Bacteria 1820
587 nmdc:mga08y16_2595_c1 3300050511 Bacteria 18556
588 nmdc:mga08y16_35615_c1 3300050511 Bacteria 5227
589 nmdc:mga08y16_453020_c1 3300050511 Bacteria 1308
590 nmdc:mga08y16_50400_c1 3300050511 Bacteria 4357
591 nmdc:mga08y16_548078_c1 3300050511 Bacteria 1171
592 nmdc:mga08y16_69387_c1 3300050511 Bacteria 3674
593 nmdc:mga08y16_7051_c1 3300050511 Bacteria 11795
594 nmdc:mga08y16_775102_c1 3300050511 Unclassified 954
595 nmdc:mga0n895_105471_c1 3300050512 Bacteria 2831
596 nmdc:mga0n895_10789_c2 3300050512 Bacteria 7689
597 nmdc:mga0n895_122519_c1 3300050512 Bacteria 2622
598 nmdc:mga0n895_840963_c1 3300050512 Bacteria 906
599 nmdc:mga0rr50_33794_c1 3300050513 Unclassified 3656
600 nmdc:mga0a205_51087_c1 3300050515 Bacteria 3991
601 nmdc:mga0a205_61006_c2 3300050515 Bacteria 1842
602 Ga0500568_0047475 3300053139 Bacteria 1700
603 Ga0501084_0616333 3300054114 Bacteria 917
604 Ga0501084_0968248 3300054114 Bacteria 715
605 Ga0501082_0245815 3300060353 Bacteria 1557
606 Ga0501082_0276427 3300060353 Unclassified 1462
607 Ga0501082_0429593 3300060353 Unclassified 1154
608 Ga0501082_1176797 3300060353 Unclassified 670
609 Ga0530510_0051210 3300061734 Bacteria 2983
610 Ga0530510_0252324 3300061734 Unclassified 1315
611 Ga0530510_0399419 3300061734 Bacteria 1036
612 Ga0530510_0652140 3300061734 Bacteria 801
613 Ga0307416_100988867
614 JGI25406J46586_10006219
615 JGI25406J46586_10087643
616 Ga0058859_11615926
617 Ga0058860_11945095
618 Ga0065704_10136530
619 Ga0065704_10555237
620 Ga0065712_10020576
621 Ga0065712_10638983
622 Ga0065715_10008633
623 Ga0065715_10132159
624 Ga0065715_10608925
625 Ga0065707_10031200
626 Ga0065707_10469073
627 Ga0065707_10748298
628 Ga0070676_10023344
629 Ga0070676_10156131
630 Ga0070676_10807019
631 Ga0070690_100010055
632 Ga0070690_100103695
633 Ga0070670_100042718
634 Ga0070670_100134944
635 Ga0070670_100559486
636 Ga0070670_100587542
637 Ga0070677_10006385
638 Ga0070677_10404109
639 Ga0070677_10503373
640 Ga0070677_10576771
641 Ga0070677_10692922
642 Ga0070677_10817765
643 Ga0068869_100009028
644 Ga0068869_100040053
645 Ga0068869_100364530
646 Ga0068869_100365949
647 Ga0070666_10869761
648 Ga0070666_11072223
649 Ga0070680_100256274
650 Ga0070680_101410549
651 Ga0068868_100017226
652 Ga0068868_101255008
653 Ga0068868_101522308
654 Ga0070660_100834389
655 Ga0070689_100029535
656 Ga0070689_100853246
657 Ga0070689_101338340
658 Ga0070689_101883927
659 Ga0070691_10679776
660 Ga0070687_100009423
661 Ga0070687_100042409
662 Ga0070687_100389438
663 Ga0070661_100286780
664 Ga0070661_100918382
665 Ga0070692_10190771
666 Ga0070668_100235358
667 Ga0070668_100501241
668 Ga0070668_101416626
669 Ga0070669_100000264
670 Ga0070669_100031295
671 Ga0070669_100056961
672 Ga0070669_100191132
673 Ga0070669_100357198
674 Ga0070669_100940244
675 Ga0070675_100004615
676 Ga0070675_100104302
677 Ga0070675_100371285
678 Ga0070675_100594703
679 Ga0070671_100242858
680 Ga0070671_100258049
681 Ga0070674_100892364
682 Ga0070674_101244626
683 Ga0070673_100015867
684 Ga0070673_100324133
685 Ga0070688_100009649
686 Ga0070688_100454236
687 Ga0070688_100724566
688 Ga0070659_101048492
689 Ga0070667_100312103
690 Ga0070667_100902156
691 Ga0070713_101271907
692 Ga0070701_10004293
693 Ga0070701_10032587
694 Ga0070701_10422802
695 Ga0070701_10492103
696 Ga0070705_100030663
697 Ga0070705_100073356
698 Ga0070705_101344226
699 Ga0070700_100120411
700 Ga0070700_100627594
701 Ga0070700_101330239
702 Ga0070694_100037839
703 Ga0070694_100161959
704 Ga0070694_100167405
705 Ga0070694_100192070
706 Ga0070663_100031312
707 Ga0070678_100025263
708 Ga0070678_100036931
709 Ga0070678_100633588
710 Ga0070678_100703082
711 Ga0070678_101545531
712 Ga0070662_100009943
713 Ga0070662_100081333
714 Ga0068867_100009503
715 Ga0068867_100042999
716 Ga0068867_100662159
717 Ga0068867_101275889
718 Ga0070685_10045271
719 Ga0070685_10553472
720 Ga0070685_10781756
721 Ga0070706_100363345
722 Ga0070707_100067207
723 Ga0070707_102198339
724 Ga0070698_100036087
725 Ga0070698_101534626
726 Ga0070698_101921121
727 Ga0070698_102140036
728 Ga0070699_100004002
729 Ga0070699_100028370
730 Ga0070699_100036179
731 Ga0070684_101186721
732 Ga0070697_100395452
733 Ga0068853_100693004
734 Ga0070672_100026255
735 Ga0070672_100027353
736 Ga0070672_100083615
737 Ga0070672_100506776
738 Ga0070672_100915317
739 Ga0070686_100102005
740 Ga0070695_100466148
741 Ga0070695_100557653
742 Ga0070696_100044491
743 Ga0070665_101187382
744 Ga0070704_100001363
745 Ga0070704_101354351
746 Ga0070704_101458311
747 Ga0070664_100020981
748 Ga0070664_100070840
749 Ga0070664_100085987
750 Ga0070664_100309727
751 Ga0070664_101290251
752 Ga0070664_101697387
753 Ga0068857_100055951
754 Ga0068857_101662920
755 Ga0068857_102218755
756 Ga0070702_100098870
757 Ga0068852_100398959
758 Ga0068859_100006367
759 Ga0068859_100018818
760 Ga0068859_100059059
761 Ga0068859_100139884
762 Ga0068864_100028514
763 Ga0068864_100103670
764 Ga0068864_100385769
765 Ga0068864_102079760
766 Ga0068861_100001392
767 Ga0068861_100062211
768 Ga0068870_10001025
769 Ga0068870_10274916
770 Ga0068870_10395824
771 Ga0068863_100009464
772 Ga0068863_100104587
773 Ga0068858_100015247
774 Ga0068858_100210577
775 Ga0068860_100028667
776 Ga0068860_100059487
777 Ga0068860_100181573
778 Ga0068862_100000749
779 Ga0068862_100005782
780 Ga0068862_100236130
781 Ga0068862_100338429
782 Ga0068862_100503648
783 Ga0068862_102608333
784 Ga0081539_10000134
785 Ga0081539_10003338
786 Ga0070717_10386788
787 Ga0075432_10254336
788 Ga0075432_10386619
789 Ga0070712_101968845
790 Ga0075367_10529845
791 Ga0097621_100144652
792 Ga0097621_100930149
793 Ga0097621_100940074
794 Ga0097621_102221086
795 Ga0068871_100107941
796 Ga0068871_100123987
797 Ga0068871_100235116
798 Ga0068871_100650232
799 Ga0068871_100732880
800 Ga0068871_102141036
801 Ga0075428_100039017
802 Ga0075428_100119604
803 Ga0075428_100155348
804 Ga0075428_100549329
805 Ga0075428_101048833
806 Ga0075428_101867566
807 Ga0075428_102296618
808 Ga0075430_100003466
809 Ga0075431_100074421
810 Ga0075431_100162402
811 Ga0075431_100617652
812 Ga0075433_10013705
813 Ga0075433_10032056
814 Ga0075433_10221221
815 Ga0075434_100122892
816 Ga0075434_100123146
817 Ga0075429_100010793
818 Ga0075429_100032043
819 Ga0075429_100050516
820 Ga0075429_100432820
821 Ga0075429_100462577
822 Ga0068865_100249095
823 Ga0068865_100341264
824 Ga0068865_102006060
825 Ga0097620_100006367
826 Ga0097620_100018818
827 Ga0097620_100059047
828 Ga0097620_100139886
829 Ga0075435_100061362
830 Ga0111539_10000302
831 Ga0111539_10004769
832 Ga0111539_10033005
833 Ga0111539_10049295
834 Ga0111539_10072442
835 Ga0111539_10115101
836 Ga0111539_10182653
837 Ga0111539_10254868
838 Ga0111539_10299358
839 Ga0111539_10407981
840 Ga0111539_10623280
841 Ga0111539_11281365
842 Ga0105245_10798482
843 Ga0105247_10408552
844 Ga0114129_10001012
845 Ga0114129_10057781
846 Ga0114129_10084220
847 Ga0114129_10182645
848 Ga0114129_10698821
849 Ga0114129_10898988
850 Ga0114129_13351546
851 Ga0105243_10096564
852 Ga0105243_10538930
853 Ga0105243_12329586
854 Ga0105241_10556673
855 Ga0105242_13035507
856 Ga0105248_10203708
857 Ga0105248_10299112
858 Ga0105248_11122885
859 Ga0105249_10001795
860 Ga0105249_10247408
861 Ga0105249_11311120
862 Ga0105249_12033715
863 Ga0105249_13431571
864 Ga0105246_10003810
865 Ga0157314_1001190
866 Ga0157371_10563475
867 Ga0157374_10079407
868 Ga0157374_10423451
869 Ga0157374_10447683
870 Ga0157374_10541098
871 Ga0157378_10293346
872 Ga0157378_12049912
873 Ga0163162_10018987
874 Ga0163162_11449027
875 Ga0157375_10302510
876 Ga0157375_10899347
877 Ga0157380_10003616
878 Ga0157380_10016183
879 Ga0157380_10087332
880 Ga0157380_10203902
881 Ga0157380_10297756
882 Ga0157380_10360600
883 Ga0157380_10909709
884 Ga0157380_11428460
885 Ga0157377_10018009
886 Ga0157377_10023718
887 Ga0157377_10049625
888 Ga0157377_11087357
889 Ga0157379_10009913
890 Ga0157379_10317028
891 Ga0157376_10020942
892 Ga0157376_10096144
893 Ga0157376_10297556
894 Ga0157376_11678469
895 Ga0163161_10015908
896 Ga0163161_10867024
897 Ga0207673_1015807
898 Ga0207697_10000575
899 Ga0207653_10031715
900 Ga0207682_10009140
901 Ga0207682_10212884
902 Ga0207682_10470437
903 Ga0207710_10587022
904 Ga0207688_10000078
905 Ga0207688_10406562
906 Ga0207680_10696059
907 Ga0207645_10002104
908 Ga0207645_10060658
909 Ga0207645_10519118
910 Ga0207643_10000706
911 Ga0207643_10025639
912 Ga0207643_10157901
913 Ga0207643_10351873
914 Ga0207693_10282268
915 Ga0207660_10155567
916 Ga0207662_10001063
917 Ga0207662_10008655
918 Ga0207662_10188482
919 Ga0207662_10219968
920 Ga0207662_10423295
921 Ga0207657_10331456
922 Ga0207649_10131710
923 Ga0207649_10175062
924 Ga0207649_11330246
925 Ga0207646_11170836
926 Ga0207646_11459706
927 Ga0207681_10038294
928 Ga0207681_10044121
929 Ga0207681_10075046
930 Ga0207681_10221207
931 Ga0207681_10275153
932 Ga0207650_10221378
933 Ga0207650_10924509
934 Ga0207659_10020842
935 Ga0207659_10021888
936 Ga0207659_10137124
937 Ga0207659_10170875
938 Ga0207659_10450840
939 Ga0207659_10553417
940 Ga0207659_10992431
941 Ga0207659_11756073
942 Ga0207687_11710925
943 Ga0207700_10598875
944 Ga0207644_10078348
945 Ga0207644_10286655
946 Ga0207690_10933536
947 Ga0207690_11184518
948 Ga0207706_10002635
949 Ga0207706_10044762
950 Ga0207686_10875154
951 Ga0207670_10009398
952 Ga0207670_10115095
953 Ga0207670_10705035
954 Ga0207670_10986793
955 Ga0207669_10183555
956 Ga0207669_10527367
957 Ga0207669_11583400
958 Ga0207704_10165722
959 Ga0207704_11703929
960 Ga0207691_10024093
961 Ga0207691_10034319
962 Ga0207691_10073970
963 Ga0207691_10344461
964 Ga0207691_10794637
965 Ga0207711_10085622
966 Ga0207711_10767719
967 Ga0207711_11243827
968 Ga0207689_10002929
969 Ga0207689_10101197
970 Ga0207689_10135754
971 Ga0207689_10545065
972 Ga0207689_11417561
973 Ga0207679_10042963
974 Ga0207679_10341463
975 Ga0207679_10838359
976 Ga0207679_10916318
977 Ga0207651_10231831
978 Ga0207651_10277983
979 Ga0207651_10350728
980 Ga0207651_10504133
981 Ga0207651_10535025
982 Ga0207651_11405416
983 Ga0207712_10132836
984 Ga0207712_10350367
985 Ga0207668_10106181
986 Ga0207668_10956369
987 Ga0207640_10169070
988 Ga0207658_10793408
989 Ga0207658_10975590
990 Ga0207658_11395517
991 Ga0207677_10816999
992 Ga0207677_10915546
993 Ga0207677_11063904
994 Ga0207703_10010475
995 Ga0207703_10169750
996 Ga0207703_10253084
997 Ga0207639_10779950
998 Ga0207639_10839992
999 Ga0207678_10043842
1000 Ga0207708_10050683
1001 Ga0207708_10069993
1002 Ga0207708_10135519
1003 Ga0207708_10168268
1004 Ga0207708_10285002
1005 Ga0207708_10916311
1006 Ga0207641_10027081
1007 Ga0207641_12640482
1008 Ga0207648_10001511
1009 Ga0207648_10005943
1010 Ga0207648_10404379
1011 Ga0207676_10124626
1012 Ga0207676_10594324
1013 Ga0207674_10027680
1014 Ga0207674_10264081
1015 Ga0207674_10661741
1016 Ga0207675_100004132
1017 Ga0207675_100007494
1018 Ga0207683_10023350
1019 Ga0207683_10024468
1020 Ga0207683_10359318
1021 Ga0207683_11405816
1022 Ga0207698_11353158
1023 Ga0207698_11608093
1024 Ga0209981_1054867
1025 Ga0209999_1027380
1026 Ga0209970_1099648
1027 Ga0210002_1078124
1028 Ga0209971_1002754
1029 Ga0209971_1119922
1030 Ga0209998_10044584
1031 Ga0207428_10001905
1032 Ga0207428_10005145
1033 Ga0207428_10040707
1034 Ga0207428_10073769
1035 Ga0207428_10156144
1036 Ga0207428_10246313
1037 Ga0207428_10266087
1038 Ga0207428_10471800
1039 Ga0207428_10500405
1040 Ga0207428_11218075
1041 Ga0268265_10001361
1042 Ga0268265_10013473
1043 Ga0268265_10223993
1044 Ga0268265_10524715
1045 Ga0268265_10944838
1046 Ga0268265_11121406
1047 Ga0268265_11140502
1048 Ga0268264_10182698
1049 Ga0268264_10313693
1050 Ga0307408_100534926
1051 Ga0307405_11002520
1052 Ga0307413_11026488
1053 Ga0307413_12105361
1054 Ga0307410_11524764
1055 Ga0307412_10834307
1056 Ga0307412_11525260
1057 Ga0307409_100461061
1058 Ga0307416_101220311
1059 Ga0307416_101406750
1060 Ga0307414_11672065
1061 Ga0307414_11805147
1062 Ga0307411_11640951
1063 Ga0307415_100752768
1064 Ga0373958_0020898
1065 Ga0373959_0119792
1066 Ga0373949_0165005
1067 Ga0373951_0014710
1068 Ga0373932_0178991
1069 Ga0373936_0235676
1070 Ga0373960_0366758
1071 Ga0373961_0139942
1072 Ga0373962_0021399
1073 Ga0373962_0225204
1074 Ga0373931_0290106
1075 Ga0373931_0298349
1076 Ga0373937_0031398
1077 Ga0439453_0007776
1078 Ga0451787_476215
1079 Ga0451807_0242364
1080 Ga0451847_0463665
1081 Ga0451853_1279594
1082 Ga0439450_015089
1083 Ga0439456_101511
1084 Ga0450890_011980
1085 Ga0450890_071637
1086 Ga0450894_012344
1087 Ga0450910_042125
1088 Ga0439435_0244996
1089 Ga0439444_0119418
1090 Ga0439464_0230662
1091 Ga0439460_0340809
1092 Ga0439440_0051308
1093 Ga0439440_0175289
1094 Ga0451576_0085703
1095 Ga0451576_0173981
1096 Ga0451576_0180255
1097 Ga0495603_0040942
1098 Ga0495629_0210807
1099 Ga0495639_0365280
1100 Ga0495639_0426628
1101 Ga0495594_0012571
1102 Ga0495594_0114642
1103 Ga0495594_0697101
1104 Ga0495607_0284819
1105 Ga0495663_0241571
1106 Ga0495642_0272654
1107 Ga0495652_0836397
1108 Ga0495640_0573295
1109 Ga0495621_0004646
1110 Ga0495621_0015596
1111 Ga0495621_0044890
1112 Ga0495633_0378704
1113 Ga0495634_0662215
1114 Ga0495659_0018217
1115 Ga0495659_0417260
1116 Ga0495588_0414415
1117 Ga0495623_0250602
1118 Ga0495669_0017261
1119 Ga0495669_0293681
1120 Ga0495672_0001674
1121 Ga0495672_0120395
1122 Ga0496102_0677799
1123 Ga0496106_0446521
1124 Ga0496108_0464174
1125 Ga0496110_0872847
1126 Ga0496112_1450145
1127 Ga0496113_0047706
1128 Ga0496114_1450645
1129 Ga0501031_0307875
1130 Ga0501031_0426681
1131 Ga0501033_0213368
1132 Ga0501033_0533429
1133 Ga0501036_0355427
1134 Ga0501036_0431510
1135 Ga0501037_0265950
1136 Ga0501038_0089956
1137 Ga0501039_0378525
1138 Ga0501039_0977638
1139 Ga0501040_0161934
1140 Ga0501041_0102035
1141 Ga0501041_0226899
1142 Ga0501042_0229201
1143 Ga0501042_0451285
1144 Ga0501042_1079464
1145 Ga0501042_1289562
1146 Ga0501043_0916239
1147 Ga0501048_0047173
1148 Ga0501048_0076492
1149 Ga0501067_0106008
1150 Ga0501067_0258191
1151 Ga0501068_0432205
1152 Ga0501068_0630388
1153 Ga0501068_0850767
1154 Ga0501070_1279280
1155 Ga0501071_0010383
1156 Ga0501071_0560701
1157 Ga0501071_0937272
1158 Ga0501072_0443271
1159 Ga0501073_0002831
1160 Ga0501074_0204181
1161 Ga0501074_0742509
1162 Ga0501075_0035247
1163 Ga0501075_0165581
1164 Ga0501075_0396445
1165 Ga0501075_1243278
1166 Ga0501076_0057353
1167 Ga0501076_0330275
1168 Ga0501076_0341282
1169 Ga0501077_0330857
1170 Ga0501077_0436720
1171 Ga0501079_0262890
1172 Ga0501079_0626969
1173 Ga0501080_0373535
1174 Ga0501080_0452515
1175 Ga0501081_0492666
1176 Ga0501045_0078250
1177 Ga0501045_0126945
1178 nmdc:mga0k408_918954_c1
1179 nmdc:mga05p37_1579832_c1
1180 nmdc:mga05p37_217150_c1
1181 nmdc:mga05p37_3921_c1
1182 nmdc:mga05p37_61163_c1
1183 nmdc:mga05p37_78444_c1
1184 nmdc:mga09592_170653_c1
1185 nmdc:mga09592_41119_c1
1186 nmdc:mga09592_411948_c1
1187 nmdc:mga09592_62807_c1
1188 nmdc:mga09592_98290_c1
1189 nmdc:mga0qj67_1346182_c1
1190 nmdc:mga0qj67_78433_c1
1191 nmdc:mga06r32_187053_c1
1192 nmdc:mga06r32_203628_c1
1193 nmdc:mga06r32_334111_c1
1194 nmdc:mga08y16_136999_c1
1195 nmdc:mga08y16_202659_c1
1196 nmdc:mga08y16_218500_c1
1197 nmdc:mga08y16_220661_c1
1198 nmdc:mga08y16_252981_c1
1199 nmdc:mga08y16_2595_c1
1200 nmdc:mga08y16_35615_c1
1201 nmdc:mga08y16_453020_c1
1202 nmdc:mga08y16_50400_c1
1203 nmdc:mga08y16_548078_c1
1204 nmdc:mga08y16_69387_c1
1205 nmdc:mga08y16_7051_c1
1206 nmdc:mga08y16_775102_c1
1207 nmdc:mga0n895_105471_c1
1208 nmdc:mga0n895_10789_c2
1209 nmdc:mga0n895_122519_c1
1210 nmdc:mga0n895_840963_c1
1211 nmdc:mga0rr50_33794_c1
1212 nmdc:mga0a205_51087_c1
1213 nmdc:mga0a205_61006_c2
1214 Ga0500568_0047475
1215 Ga0501084_0616333
1216 Ga0501084_0968248
1217 Ga0501082_0245815
1218 Ga0501082_0276427
1219 Ga0501082_0429593
1220 Ga0501082_1176797
1221 Ga0530510_0051210
1222 Ga0530510_0252324
1223 Ga0530510_0399419
1224 Ga0530510_0652140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03319

EutN_CcmL

Ethanolamine utilisation protein EutN/carboxysome

1

75

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i7a-assembly1.cif.gz_B grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.8867 1 87
4i7a-assembly1.cif.gz_A grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.877 1 88
4i7a-assembly1.cif.gz_B grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.8769 1 87
6owg-assembly1.cif.gz_DR structure of a synthetic beta-carboxysome shell, t=4 0.8746 1 87
2qw7-assembly1.cif.gz_D carboxysome subunit, ccml 0.8744 1 87
ID Description Score Start End Superfamily
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8867 1 87 2.40.50.220
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8769 1 87 2.40.50.220
2hd3F00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8581 2 87 2.40.50.220
2hd3I00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8528 2 87 2.40.50.220
4n8x100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8491 1 88 2.40.50.220
ID Description Score Start End GO Terms
AF-X1HQN0-F1-model_v4 Ethanolamine utilization protein EutN 0.9183 1 60 GO:0031469
AF-X1G3E1-F1-model_v4 Ethanolamine utilization protein EutN 0.913 1 64 GO:0031469
AF-A0A523NDQ4-F1-model_v4 Ethanolamine utilization protein EutN 0.9115 1 61 GO:0031469
AF-A0A3N5X188-F1-model_v4 Ethanolamine utilization protein EutN 0.9105 2 55 GO:0031469
AF-X1HQN0-F1-model_v4 Ethanolamine utilization protein EutN 0.9042 1 60 GO:0031469

Map