F469093
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 611 | 235 | 1222 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300046459|Ga0495629_0112048|Ga0495629_0112048_918_1319 |
| Length | 133 |
| Sequence | MLPRCPGALKLSQTMDAAAVRELIERYNAAWNAQDLDTIDDLHHPDIVFDNHTAGERAEGAAAVREHIGQIFRNNPTLRFATRSLLTGDDFAVCEWTASTGSKEWDGVDVFPLRDGRIARKDVYSSSHRSREL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 36 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 105 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 106 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 107 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 108 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 109 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 110 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 111 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 112 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 113 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 114 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 115 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 116 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 117 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 118 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 119 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 120 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 125 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 126 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 127 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 128 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 129 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 130 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 131 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 132 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 133 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 134 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 135 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 136 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 137 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 138 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 139 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 144 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 145 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 220 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 221 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 231 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 232 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 235 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.49 |
| Nodule | 0 |
| Rhizoplane | 11.95 |
| Rhizosphere | 87.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495629_0112048 | 3300046459 | Bacteria | 1902 |
| 2 | Ga0070658_10014304 | 3300005327 | Bacteria | 6367 |
| 3 | Ga0070658_10524216 | 3300005327 | Bacteria | 1024 |
| 4 | Ga0070683_100155761 | 3300005329 | Bacteria | 2166 |
| 5 | Ga0070680_100015767 | 3300005336 | Bacteria | 5932 |
| 6 | Ga0070680_100108730 | 3300005336 | Bacteria | 2307 |
| 7 | Ga0070680_100342970 | 3300005336 | Bacteria | 1269 |
| 8 | Ga0070682_100049476 | 3300005337 | Bacteria | 2620 |
| 9 | Ga0068868_100193541 | 3300005338 | Bacteria | 1692 |
| 10 | Ga0068868_102133850 | 3300005338 | Bacteria | 533 |
| 11 | Ga0070660_100004010 | 3300005339 | Bacteria | 10165 |
| 12 | Ga0070660_100616883 | 3300005339 | Bacteria | 907 |
| 13 | Ga0070661_100080662 | 3300005344 | Bacteria | 2401 |
| 14 | Ga0070661_100445262 | 3300005344 | Bacteria | 1030 |
| 15 | Ga0070671_100152865 | 3300005355 | Bacteria | 1949 |
| 16 | Ga0070659_100315245 | 3300005366 | Bacteria | 1306 |
| 17 | Ga0070659_100446233 | 3300005366 | Bacteria | 1097 |
| 18 | Ga0070709_10122443 | 3300005434 | Bacteria | 1765 |
| 19 | Ga0070709_10260118 | 3300005434 | Unclassified | 1253 |
| 20 | Ga0070714_100004472 | 3300005435 | Bacteria | 10534 |
| 21 | Ga0070714_100021145 | 3300005435 | Bacteria | 5321 |
| 22 | Ga0070714_100025096 | 3300005435 | Bacteria | 4917 |
| 23 | Ga0070714_100049468 | 3300005435 | Bacteria | 3578 |
| 24 | Ga0070714_100085391 | 3300005435 | Bacteria | 2756 |
| 25 | Ga0070714_100096400 | 3300005435 | Bacteria | 2599 |
| 26 | Ga0070714_100301114 | 3300005435 | Bacteria | 1495 |
| 27 | Ga0070714_100464355 | 3300005435 | Bacteria | 1204 |
| 28 | Ga0070714_101507707 | 3300005435 | Bacteria | 657 |
| 29 | Ga0070713_100070946 | 3300005436 | Bacteria | 2942 |
| 30 | Ga0070713_100074903 | 3300005436 | Bacteria | 2869 |
| 31 | Ga0070713_101161972 | 3300005436 | Unclassified | 747 |
| 32 | Ga0070710_10004780 | 3300005437 | Bacteria | 6408 |
| 33 | Ga0070710_10049156 | 3300005437 | Unclassified | 2358 |
| 34 | Ga0070710_10084418 | 3300005437 | Bacteria | 1861 |
| 35 | Ga0070678_101643697 | 3300005456 | Unclassified | 604 |
| 36 | Ga0070681_10028662 | 3300005458 | Bacteria | 5598 |
| 37 | Ga0070681_10337503 | 3300005458 | Bacteria | 1416 |
| 38 | Ga0070707_100432906 | 3300005468 | Bacteria | 1276 |
| 39 | Ga0070679_100040029 | 3300005530 | Bacteria | 4661 |
| 40 | Ga0070679_100292030 | 3300005530 | Bacteria | 1581 |
| 41 | Ga0070679_100373598 | 3300005530 | Bacteria | 1372 |
| 42 | Ga0070684_100060703 | 3300005535 | Bacteria | 3308 |
| 43 | Ga0070684_100062092 | 3300005535 | Bacteria | 3272 |
| 44 | Ga0070684_100064232 | 3300005535 | Bacteria | 3220 |
| 45 | Ga0070695_100000209 | 3300005545 | Bacteria | 28514 |
| 46 | Ga0070693_100614042 | 3300005547 | Bacteria | 787 |
| 47 | Ga0070693_101089355 | 3300005547 | Archaea | 609 |
| 48 | Ga0070704_100074586 | 3300005549 | Bacteria | 2475 |
| 49 | Ga0068855_100003360 | 3300005563 | Bacteria | 19591 |
| 50 | Ga0068855_100046068 | 3300005563 | Bacteria | 5156 |
| 51 | Ga0068855_100074314 | 3300005563 | Bacteria | 3948 |
| 52 | Ga0068855_100500241 | 3300005563 | Bacteria | 1321 |
| 53 | Ga0070664_100116865 | 3300005564 | Bacteria | 2332 |
| 54 | Ga0070664_100893262 | 3300005564 | Unclassified | 833 |
| 55 | Ga0068854_100738357 | 3300005578 | Bacteria | 853 |
| 56 | Ga0068856_100021002 | 3300005614 | Bacteria | 6346 |
| 57 | Ga0068856_100181401 | 3300005614 | Bacteria | 2118 |
| 58 | Ga0070702_100107017 | 3300005615 | Bacteria | 1726 |
| 59 | Ga0068852_100343541 | 3300005616 | Bacteria | 1455 |
| 60 | Ga0068852_100666338 | 3300005616 | Bacteria | 1049 |
| 61 | Ga0068863_100159153 | 3300005841 | Bacteria | 2163 |
| 62 | Ga0068863_100833490 | 3300005841 | Unclassified | 921 |
| 63 | Ga0068858_101653707 | 3300005842 | Archaea | 632 |
| 64 | Ga0070717_10005447 | 3300006028 | Bacteria | 9291 |
| 65 | Ga0070717_10071120 | 3300006028 | Bacteria | 2901 |
| 66 | Ga0070717_10186749 | 3300006028 | Bacteria | 1809 |
| 67 | Ga0070717_10259440 | 3300006028 | Bacteria | 1537 |
| 68 | Ga0070717_10984636 | 3300006028 | Bacteria | 768 |
| 69 | Ga0070715_10004505 | 3300006163 | Archaea | 4579 |
| 70 | Ga0070716_100010808 | 3300006173 | Archaea | 4589 |
| 71 | Ga0070712_100197508 | 3300006175 | Unclassified | 1578 |
| 72 | Ga0070712_100225462 | 3300006175 | Bacteria | 1486 |
| 73 | Ga0075433_10063490 | 3300006852 | Bacteria | 3236 |
| 74 | Ga0075434_100003661 | 3300006871 | Bacteria | 13731 |
| 75 | Ga0105240_10045671 | 3300009093 | Bacteria | 5556 |
| 76 | Ga0105240_10125870 | 3300009093 | Bacteria | 3079 |
| 77 | Ga0105240_10347756 | 3300009093 | Bacteria | 1682 |
| 78 | Ga0111539_10492799 | 3300009094 | Bacteria | 1427 |
| 79 | Ga0105245_10073532 | 3300009098 | Bacteria | 3108 |
| 80 | Ga0105245_11258430 | 3300009098 | Bacteria | 788 |
| 81 | Ga0105247_10116298 | 3300009101 | Bacteria | 1727 |
| 82 | Ga0105241_11047555 | 3300009174 | Bacteria | 765 |
| 83 | Ga0105248_10161088 | 3300009177 | Bacteria | 2531 |
| 84 | Ga0105237_10057657 | 3300009545 | Archaea | 3886 |
| 85 | Ga0105237_11671447 | 3300009545 | Unclassified | 644 |
| 86 | Ga0105237_12490976 | 3300009545 | Unclassified | 528 |
| 87 | Ga0105238_10292280 | 3300009551 | Bacteria | 1612 |
| 88 | Ga0105238_10514425 | 3300009551 | Bacteria | 1199 |
| 89 | Ga0105249_11357221 | 3300009553 | Unclassified | 783 |
| 90 | Ga0105239_10374628 | 3300010375 | Bacteria | 1609 |
| 91 | Ga0105239_10650335 | 3300010375 | Bacteria | 1204 |
| 92 | Ga0157373_10220183 | 3300013100 | Unclassified | 1339 |
| 93 | Ga0157373_10821346 | 3300013100 | Bacteria | 686 |
| 94 | Ga0157373_11238404 | 3300013100 | Unclassified | 563 |
| 95 | Ga0157371_11188968 | 3300013102 | Bacteria | 587 |
| 96 | Ga0157370_10014156 | 3300013104 | Bacteria | 8179 |
| 97 | Ga0157370_10033313 | 3300013104 | Bacteria | 5023 |
| 98 | Ga0157370_10103091 | 3300013104 | Bacteria | 2671 |
| 99 | Ga0157370_11256309 | 3300013104 | Unclassified | 668 |
| 100 | Ga0157370_11895795 | 3300013104 | Unclassified | 535 |
| 101 | Ga0157369_10003612 | 3300013105 | Bacteria | 18376 |
| 102 | Ga0157369_10080356 | 3300013105 | Bacteria | 3491 |
| 103 | Ga0157369_10091877 | 3300013105 | Bacteria | 3239 |
| 104 | Ga0157369_10106006 | 3300013105 | Bacteria | 2991 |
| 105 | Ga0157369_10208307 | 3300013105 | Bacteria | 2050 |
| 106 | Ga0157369_10470582 | 3300013105 | Archaea | 1301 |
| 107 | Ga0157369_10828419 | 3300013105 | Unclassified | 950 |
| 108 | Ga0157374_10510228 | 3300013296 | Bacteria | 1208 |
| 109 | Ga0157378_11862620 | 3300013297 | Unclassified | 650 |
| 110 | Ga0163162_10113156 | 3300013306 | Bacteria | 2812 |
| 111 | Ga0157372_10041853 | 3300013307 | Bacteria | 5065 |
| 112 | Ga0157372_10171537 | 3300013307 | Bacteria | 2510 |
| 113 | Ga0157372_10317187 | 3300013307 | Unclassified | 1815 |
| 114 | Ga0157372_11685737 | 3300013307 | Archaea | 729 |
| 115 | Ga0157375_10816674 | 3300013308 | Bacteria | 1080 |
| 116 | Ga0163163_10466153 | 3300014325 | Bacteria | 1324 |
| 117 | Ga0182008_10016646 | 3300014497 | Bacteria | 3819 |
| 118 | Ga0182008_10094727 | 3300014497 | Bacteria | 1473 |
| 119 | Ga0157377_10579864 | 3300014745 | Unclassified | 797 |
| 120 | Ga0157379_10236095 | 3300014968 | Unclassified | 1658 |
| 121 | Ga0157376_10011045 | 3300014969 | Bacteria | 6639 |
| 122 | Ga0157376_10390598 | 3300014969 | Unclassified | 1343 |
| 123 | Ga0157376_10545332 | 3300014969 | Bacteria | 1147 |
| 124 | Ga0182006_1053155 | 3300015261 | Bacteria | 1554 |
| 125 | Ga0182007_10015979 | 3300015262 | Bacteria | 2781 |
| 126 | Ga0197907_10922662 | 3300020069 | Bacteria | 1032 |
| 127 | Ga0206356_10555049 | 3300020070 | Bacteria | 6261 |
| 128 | Ga0206356_11018159 | 3300020070 | Archaea | 614 |
| 129 | Ga0206354_10931922 | 3300020081 | Bacteria | 2189 |
| 130 | Ga0207692_10112462 | 3300025898 | Unclassified | 1512 |
| 131 | Ga0207692_10352888 | 3300025898 | Archaea | 907 |
| 132 | Ga0207710_10065176 | 3300025900 | Bacteria | 1660 |
| 133 | Ga0207685_10083206 | 3300025905 | Bacteria | 1330 |
| 134 | Ga0207699_10022920 | 3300025906 | Archaea | 3391 |
| 135 | Ga0207699_10046159 | 3300025906 | Bacteria | 2546 |
| 136 | Ga0207705_10017542 | 3300025909 | Bacteria | 5125 |
| 137 | Ga0207705_10033212 | 3300025909 | Bacteria | 3686 |
| 138 | Ga0207705_10145772 | 3300025909 | Bacteria | 1771 |
| 139 | Ga0207707_10021329 | 3300025912 | Bacteria | 5663 |
| 140 | Ga0207707_11002651 | 3300025912 | Bacteria | 685 |
| 141 | Ga0207695_10113723 | 3300025913 | Bacteria | 2683 |
| 142 | Ga0207695_11018663 | 3300025913 | Archaea | 708 |
| 143 | Ga0207671_10037202 | 3300025914 | Archaea | 3610 |
| 144 | Ga0207671_11193477 | 3300025914 | Unclassified | 595 |
| 145 | Ga0207693_10001707 | 3300025915 | Bacteria | 19335 |
| 146 | Ga0207693_10011495 | 3300025915 | Bacteria | 7161 |
| 147 | Ga0207693_10438377 | 3300025915 | Bacteria | 1021 |
| 148 | Ga0207663_10357479 | 3300025916 | Unclassified | 1107 |
| 149 | Ga0207660_10014625 | 3300025917 | Bacteria | 5167 |
| 150 | Ga0207660_10252329 | 3300025917 | Bacteria | 1393 |
| 151 | Ga0207657_10003122 | 3300025919 | Bacteria | 17709 |
| 152 | Ga0207657_10017269 | 3300025919 | Bacteria | 6927 |
| 153 | Ga0207657_10037527 | 3300025919 | Bacteria | 4325 |
| 154 | Ga0207649_10647045 | 3300025920 | Bacteria | 816 |
| 155 | Ga0207652_10238177 | 3300025921 | Bacteria | 1640 |
| 156 | Ga0207652_10494717 | 3300025921 | Bacteria | 1101 |
| 157 | Ga0207652_11644827 | 3300025921 | Unclassified | 547 |
| 158 | Ga0207646_10587166 | 3300025922 | Bacteria | 1000 |
| 159 | Ga0207646_10592275 | 3300025922 | Bacteria | 996 |
| 160 | Ga0207694_10353466 | 3300025924 | Bacteria | 1217 |
| 161 | Ga0207687_10109897 | 3300025927 | Bacteria | 2043 |
| 162 | Ga0207687_10627400 | 3300025927 | Bacteria | 908 |
| 163 | Ga0207700_10043790 | 3300025928 | Bacteria | 3291 |
| 164 | Ga0207700_10913642 | 3300025928 | Bacteria | 786 |
| 165 | Ga0207700_11020297 | 3300025928 | Bacteria | 740 |
| 166 | Ga0207664_10009176 | 3300025929 | Bacteria | 6932 |
| 167 | Ga0207664_10012552 | 3300025929 | Bacteria | 6061 |
| 168 | Ga0207664_10040599 | 3300025929 | Bacteria | 3620 |
| 169 | Ga0207664_10041301 | 3300025929 | Archaea | 3592 |
| 170 | Ga0207664_10081892 | 3300025929 | Bacteria | 2628 |
| 171 | Ga0207664_10121958 | 3300025929 | Bacteria | 2183 |
| 172 | Ga0207664_10304100 | 3300025929 | Bacteria | 1404 |
| 173 | Ga0207664_10572047 | 3300025929 | Bacteria | 1014 |
| 174 | Ga0207664_11348513 | 3300025929 | Bacteria | 633 |
| 175 | Ga0207644_10265915 | 3300025931 | Unclassified | 1373 |
| 176 | Ga0207709_10547211 | 3300025935 | Bacteria | 910 |
| 177 | Ga0207665_10000359 | 3300025939 | Bacteria | 31672 |
| 178 | Ga0207665_10226086 | 3300025939 | Bacteria | 1374 |
| 179 | Ga0207711_10546164 | 3300025941 | Bacteria | 1081 |
| 180 | Ga0207661_10283078 | 3300025944 | Bacteria | 1482 |
| 181 | Ga0207679_10041300 | 3300025945 | Bacteria | 3307 |
| 182 | Ga0207667_10325883 | 3300025949 | Bacteria | 1568 |
| 183 | Ga0207667_10369298 | 3300025949 | Unclassified | 1462 |
| 184 | Ga0207667_10374866 | 3300025949 | Bacteria | 1450 |
| 185 | Ga0207667_10403488 | 3300025949 | Bacteria | 1392 |
| 186 | Ga0207667_10411530 | 3300025949 | Unclassified | 1376 |
| 187 | Ga0207712_10310649 | 3300025961 | Bacteria | 1297 |
| 188 | Ga0207640_10576214 | 3300025981 | Bacteria | 949 |
| 189 | Ga0207677_10283440 | 3300026023 | Bacteria | 1361 |
| 190 | Ga0207639_11182321 | 3300026041 | Bacteria | 718 |
| 191 | Ga0207702_10082274 | 3300026078 | Bacteria | 2799 |
| 192 | Ga0207702_10181474 | 3300026078 | Bacteria | 1939 |
| 193 | Ga0207702_10559244 | 3300026078 | Unclassified | 1120 |
| 194 | Ga0207702_10777372 | 3300026078 | Unclassified | 946 |
| 195 | Ga0207641_10267236 | 3300026088 | Bacteria | 1604 |
| 196 | Ga0207676_10429652 | 3300026095 | Bacteria | 1241 |
| 197 | Ga0207674_10109393 | 3300026116 | Bacteria | 2740 |
| 198 | Ga0207683_10213792 | 3300026121 | Unclassified | 1755 |
| 199 | Ga0207698_11027810 | 3300026142 | Archaea | 835 |
| 200 | Ga0265327_10003744 | 3300031251 | Bacteria | 14140 |
| 201 | Ga0265327_10149645 | 3300031251 | Bacteria | 1085 |
| 202 | Ga0307409_100747724 | 3300031995 | Bacteria | 981 |
| 203 | Ga0307414_11479435 | 3300032004 | Bacteria | 632 |
| 204 | Ga0373944_0013395 | 3300035089 | Bacteria | 2274 |
| 205 | Ga0373951_0118530 | 3300035091 | Unclassified | 718 |
| 206 | Ga0373952_0077387 | 3300035092 | Unclassified | 843 |
| 207 | Ga0373936_0058588 | 3300035113 | Bacteria | 1568 |
| 208 | Ga0373945_0053323 | 3300035116 | Bacteria | 1492 |
| 209 | Ga0373954_0166670 | 3300035118 | Bacteria | 1079 |
| 210 | Ga0373943_0024384 | 3300035170 | Unclassified | 2819 |
| 211 | Ga0373943_0202457 | 3300035170 | Bacteria | 1099 |
| 212 | Ga0373943_0554473 | 3300035170 | Unclassified | 675 |
| 213 | Ga0373946_0035830 | 3300035171 | Bacteria | 2009 |
| 214 | Ga0373946_0202867 | 3300035171 | Bacteria | 951 |
| 215 | Ga0373955_0212240 | 3300035172 | Bacteria | 1154 |
| 216 | Ga0373962_0233450 | 3300035242 | Unclassified | 633 |
| 217 | Ga0373924_0171361 | 3300035410 | Bacteria | 954 |
| 218 | Ga0373931_0038067 | 3300035691 | Bacteria | 2514 |
| 219 | Ga0373935_0085744 | 3300035692 | Bacteria | 2054 |
| 220 | Ga0373935_0321928 | 3300035692 | Bacteria | 1097 |
| 221 | Ga0373935_0524561 | 3300035692 | Bacteria | 862 |
| 222 | Ga0373927_0143384 | 3300035695 | Bacteria | 1563 |
| 223 | Ga0373947_0012051 | 3300035725 | Bacteria | 4951 |
| 224 | Ga0373947_0123119 | 3300035725 | Unclassified | 1649 |
| 225 | Ga0373947_0247185 | 3300035725 | Bacteria | 1179 |
| 226 | Ga0373947_0466872 | 3300035725 | Bacteria | 856 |
| 227 | Ga0373937_0194127 | 3300036401 | Bacteria | 1908 |
| 228 | Ga0373937_1392805 | 3300036401 | Unclassified | 649 |
| 229 | Ga0373937_1954251 | 3300036401 | Bacteria | 533 |
| 230 | Ga0373925_0004988 | 3300037068 | Bacteria | 9968 |
| 231 | Ga0395899_0053994 | 3300037312 | Bacteria | 2974 |
| 232 | Ga0395899_0101431 | 3300037312 | Bacteria | 2077 |
| 233 | Ga0395899_0339259 | 3300037312 | Bacteria | 1008 |
| 234 | Ga0395900_0023098 | 3300037418 | Bacteria | 6365 |
| 235 | Ga0395900_0547415 | 3300037418 | Bacteria | 1102 |
| 236 | Ga0395900_0778857 | 3300037418 | Bacteria | 885 |
| 237 | Ga0395900_0982172 | 3300037418 | Bacteria | 765 |
| 238 | Ga0395900_1836595 | 3300037418 | Unclassified | 517 |
| 239 | Ga0395898_0040888 | 3300037466 | Bacteria | 4582 |
| 240 | Ga0395898_0050830 | 3300037466 | Bacteria | 4055 |
| 241 | Ga0395898_0355273 | 3300037466 | Bacteria | 1397 |
| 242 | Ga0395905_0139704 | 3300037471 | Bacteria | 2279 |
| 243 | Ga0395905_0244628 | 3300037471 | Bacteria | 1676 |
| 244 | Ga0395905_0480568 | 3300037471 | Bacteria | 1142 |
| 245 | Ga0395901_0007588 | 3300038443 | Bacteria | 10957 |
| 246 | Ga0395901_0058497 | 3300038443 | Bacteria | 4008 |
| 247 | Ga0395901_0535062 | 3300038443 | Unclassified | 1189 |
| 248 | Ga0395901_0773028 | 3300038443 | Bacteria | 952 |
| 249 | Ga0439439_0160569 | 3300041406 | Bacteria | 641 |
| 250 | Ga0451853_1830562 | 3300041512 | Unclassified | 629 |
| 251 | Ga0439446_0005057 | 3300042156 | Bacteria | 3375 |
| 252 | Ga0439434_0052622 | 3300042435 | Bacteria | 1264 |
| 253 | Ga0466969_0327353 | 3300044656 | Bacteria | 693 |
| 254 | Ga0466965_0049680 | 3300044683 | Bacteria | 2079 |
| 255 | Ga0466965_0108780 | 3300044683 | Bacteria | 1423 |
| 256 | Ga0466966_0194116 | 3300044684 | Bacteria | 1229 |
| 257 | Ga0466961_0049112 | 3300044693 | Bacteria | 2697 |
| 258 | Ga0466961_0342577 | 3300044693 | Bacteria | 910 |
| 259 | Ga0466961_0612373 | 3300044693 | Bacteria | 654 |
| 260 | Ga0466963_0001297 | 3300044694 | Bacteria | 13282 |
| 261 | Ga0466963_0003091 | 3300044694 | Bacteria | 9437 |
| 262 | Ga0466963_0004599 | 3300044694 | Bacteria | 8035 |
| 263 | Ga0466963_0040268 | 3300044694 | Bacteria | 3062 |
| 264 | Ga0466963_0047917 | 3300044694 | Bacteria | 2822 |
| 265 | Ga0466963_0086995 | 3300044694 | Bacteria | 2124 |
| 266 | Ga0466963_0090831 | 3300044694 | Bacteria | 2079 |
| 267 | Ga0466963_0115981 | 3300044694 | Bacteria | 1841 |
| 268 | Ga0466963_0206053 | 3300044694 | Bacteria | 1375 |
| 269 | Ga0466963_0540819 | 3300044694 | Bacteria | 823 |
| 270 | Ga0466964_0007533 | 3300044706 | Bacteria | 4073 |
| 271 | Ga0466964_0009765 | 3300044706 | Bacteria | 3615 |
| 272 | Ga0466964_0032548 | 3300044706 | Bacteria | 2073 |
| 273 | Ga0466964_0033658 | 3300044706 | Bacteria | 2042 |
| 274 | Ga0466964_0063836 | 3300044706 | Bacteria | 1539 |
| 275 | Ga0466964_0085035 | 3300044706 | Bacteria | 1365 |
| 276 | Ga0466964_0125170 | 3300044706 | Bacteria | 1164 |
| 277 | Ga0466964_0126704 | 3300044706 | Unclassified | 1158 |
| 278 | Ga0466964_0148505 | 3300044706 | Bacteria | 1084 |
| 279 | Ga0466971_0003684 | 3300044719 | Bacteria | 6552 |
| 280 | Ga0466971_0048454 | 3300044719 | Bacteria | 1910 |
| 281 | Ga0466971_0056969 | 3300044719 | Bacteria | 1763 |
| 282 | Ga0466971_0238708 | 3300044719 | Unclassified | 864 |
| 283 | Ga0466971_0529878 | 3300044719 | Bacteria | 583 |
| 284 | Ga0466968_0006616 | 3300044735 | Bacteria | 4375 |
| 285 | Ga0466968_0006945 | 3300044735 | Bacteria | 4288 |
| 286 | Ga0466968_0014165 | 3300044735 | Bacteria | 3148 |
| 287 | Ga0466968_0065302 | 3300044735 | Bacteria | 1575 |
| 288 | Ga0466968_0072939 | 3300044735 | Bacteria | 1497 |
| 289 | Ga0466968_0100763 | 3300044735 | Bacteria | 1289 |
| 290 | Ga0466968_0398452 | 3300044735 | Unclassified | 674 |
| 291 | Ga0466970_0038365 | 3300044765 | Bacteria | 2541 |
| 292 | Ga0466957_0006625 | 3300044842 | Bacteria | 6547 |
| 293 | Ga0466957_0007304 | 3300044842 | Bacteria | 6243 |
| 294 | Ga0466957_0030565 | 3300044842 | Bacteria | 3216 |
| 295 | Ga0466957_0193830 | 3300044842 | Bacteria | 1332 |
| 296 | Ga0466960_0005535 | 3300044901 | Bacteria | 5007 |
| 297 | Ga0466960_0448252 | 3300044901 | Unclassified | 750 |
| 298 | Ga0466959_0190129 | 3300045049 | Bacteria | 1433 |
| 299 | Ga0466959_0215294 | 3300045049 | Bacteria | 1334 |
| 300 | Ga0466959_0462955 | 3300045049 | Bacteria | 859 |
| 301 | Ga0466959_0620802 | 3300045049 | Bacteria | 726 |
| 302 | Ga0466958_0005267 | 3300045836 | Bacteria | 6933 |
| 303 | Ga0466958_0022705 | 3300045836 | Bacteria | 3678 |
| 304 | Ga0466958_0092308 | 3300045836 | Bacteria | 1874 |
| 305 | Ga0466958_0239415 | 3300045836 | Bacteria | 1159 |
| 306 | Ga0466958_0299704 | 3300045836 | Bacteria | 1032 |
| 307 | Ga0466958_0337800 | 3300045836 | Bacteria | 969 |
| 308 | Ga0466958_0542426 | 3300045836 | Bacteria | 755 |
| 309 | Ga0466958_0605933 | 3300045836 | Unclassified | 712 |
| 310 | Ga0466967_0009453 | 3300045976 | Bacteria | 7233 |
| 311 | Ga0466967_0011239 | 3300045976 | Bacteria | 6766 |
| 312 | Ga0466967_0021796 | 3300045976 | Bacteria | 5213 |
| 313 | Ga0466967_0021971 | 3300045976 | Bacteria | 5195 |
| 314 | Ga0466967_0029939 | 3300045976 | Bacteria | 4562 |
| 315 | Ga0466967_0032549 | 3300045976 | Bacteria | 4403 |
| 316 | Ga0466967_0035151 | 3300045976 | Bacteria | 4261 |
| 317 | Ga0466967_0045747 | 3300045976 | Bacteria | 3805 |
| 318 | Ga0466967_0058108 | 3300045976 | Bacteria | 3417 |
| 319 | Ga0466967_0149311 | 3300045976 | Bacteria | 2183 |
| 320 | Ga0466967_0160211 | 3300045976 | Bacteria | 2111 |
| 321 | Ga0466967_0272586 | 3300045976 | Bacteria | 1622 |
| 322 | Ga0466967_0303539 | 3300045976 | Bacteria | 1536 |
| 323 | Ga0466967_0380930 | 3300045976 | Unclassified | 1369 |
| 324 | Ga0466967_0413844 | 3300045976 | Bacteria | 1313 |
| 325 | Ga0466967_0425032 | 3300045976 | Bacteria | 1295 |
| 326 | Ga0466967_0488093 | 3300045976 | Bacteria | 1207 |
| 327 | Ga0466967_0504683 | 3300045976 | Bacteria | 1187 |
| 328 | Ga0466967_0505600 | 3300045976 | Bacteria | 1186 |
| 329 | Ga0466967_0561939 | 3300045976 | Bacteria | 1123 |
| 330 | Ga0466967_1131762 | 3300045976 | Bacteria | 780 |
| 331 | Ga0495592_0005488 | 3300046454 | Bacteria | 9371 |
| 332 | Ga0495592_0011072 | 3300046454 | Bacteria | 6809 |
| 333 | Ga0495592_0260917 | 3300046454 | Bacteria | 1141 |
| 334 | Ga0495603_0088596 | 3300046455 | Bacteria | 1811 |
| 335 | Ga0495629_0007462 | 3300046459 | Bacteria | 8057 |
| 336 | Ga0495629_0047802 | 3300046459 | Bacteria | 3001 |
| 337 | Ga0495629_0267264 | 3300046459 | Bacteria | 1175 |
| 338 | Ga0495629_0640376 | 3300046459 | Bacteria | 709 |
| 339 | Ga0495629_1080034 | 3300046459 | Bacteria | 519 |
| 340 | Ga0495641_0017824 | 3300046461 | Bacteria | 3686 |
| 341 | Ga0495641_0035909 | 3300046461 | Bacteria | 2332 |
| 342 | Ga0495641_0050037 | 3300046461 | Bacteria | 1911 |
| 343 | Ga0495641_0060395 | 3300046461 | Bacteria | 1713 |
| 344 | Ga0495641_0223936 | 3300046461 | Bacteria | 844 |
| 345 | Ga0495641_0358690 | 3300046461 | Bacteria | 659 |
| 346 | Ga0495651_0035851 | 3300046462 | Bacteria | 3861 |
| 347 | Ga0495651_0354030 | 3300046462 | Bacteria | 969 |
| 348 | Ga0495653_0011970 | 3300046463 | Bacteria | 7084 |
| 349 | Ga0495653_0154697 | 3300046463 | Bacteria | 1598 |
| 350 | Ga0495653_0194916 | 3300046463 | Bacteria | 1379 |
| 351 | Ga0495653_0484321 | 3300046463 | Bacteria | 773 |
| 352 | Ga0495653_0778308 | 3300046463 | Bacteria | 576 |
| 353 | Ga0495580_0221294 | 3300046472 | Bacteria | 1301 |
| 354 | Ga0495580_0508599 | 3300046472 | Bacteria | 803 |
| 355 | Ga0495582_0006876 | 3300046473 | Archaea | 6322 |
| 356 | Ga0495582_0037974 | 3300046473 | Bacteria | 2649 |
| 357 | Ga0495582_0038635 | 3300046473 | Bacteria | 2627 |
| 358 | Ga0495582_0087822 | 3300046473 | Bacteria | 1731 |
| 359 | Ga0495639_0002130 | 3300046475 | Bacteria | 8726 |
| 360 | Ga0495662_0003067 | 3300046476 | Bacteria | 8423 |
| 361 | Ga0495662_0144968 | 3300046476 | Bacteria | 1169 |
| 362 | Ga0495662_0541137 | 3300046476 | Bacteria | 570 |
| 363 | Ga0495664_0011563 | 3300046477 | Bacteria | 4978 |
| 364 | Ga0495664_0014362 | 3300046477 | Bacteria | 4488 |
| 365 | Ga0495664_0088756 | 3300046477 | Bacteria | 1858 |
| 366 | Ga0495664_0131167 | 3300046477 | Bacteria | 1517 |
| 367 | Ga0495584_0021287 | 3300046491 | Bacteria | 3295 |
| 368 | Ga0495585_0029947 | 3300046492 | Bacteria | 3097 |
| 369 | Ga0495594_0217352 | 3300046499 | Bacteria | 1090 |
| 370 | Ga0495594_0554215 | 3300046499 | Unclassified | 652 |
| 371 | Ga0495607_0021962 | 3300046501 | Bacteria | 4013 |
| 372 | Ga0495608_0003297 | 3300046511 | Bacteria | 11540 |
| 373 | Ga0495608_0041985 | 3300046511 | Bacteria | 3058 |
| 374 | Ga0495608_0111352 | 3300046511 | Bacteria | 1760 |
| 375 | Ga0495618_0188558 | 3300046514 | Bacteria | 1308 |
| 376 | Ga0495618_0233835 | 3300046514 | Bacteria | 1156 |
| 377 | Ga0495618_0373207 | 3300046514 | Bacteria | 876 |
| 378 | Ga0495628_0087989 | 3300046516 | Bacteria | 2407 |
| 379 | Ga0495630_0017884 | 3300046517 | Bacteria | 5199 |
| 380 | Ga0495630_0020061 | 3300046517 | Bacteria | 4923 |
| 381 | Ga0495630_0097410 | 3300046517 | Bacteria | 2224 |
| 382 | Ga0495630_0163203 | 3300046517 | Bacteria | 1696 |
| 383 | Ga0495630_0180478 | 3300046517 | Bacteria | 1609 |
| 384 | Ga0495630_0719826 | 3300046517 | Archaea | 763 |
| 385 | Ga0495630_0853787 | 3300046517 | Bacteria | 694 |
| 386 | Ga0495631_0301634 | 3300046518 | Bacteria | 682 |
| 387 | Ga0495644_0016352 | 3300046523 | Archaea | 2839 |
| 388 | Ga0495666_0002953 | 3300046526 | Bacteria | 8519 |
| 389 | Ga0495666_0077440 | 3300046526 | Bacteria | 1576 |
| 390 | Ga0495642_0134777 | 3300046528 | Bacteria | 1064 |
| 391 | Ga0495652_0018236 | 3300046529 | Bacteria | 6261 |
| 392 | Ga0495652_0076542 | 3300046529 | Archaea | 2775 |
| 393 | Ga0495652_0157007 | 3300046529 | Bacteria | 1770 |
| 394 | Ga0495652_0346571 | 3300046529 | Bacteria | 1065 |
| 395 | Ga0495665_0007699 | 3300046531 | Bacteria | 5832 |
| 396 | Ga0495665_0374645 | 3300046531 | Bacteria | 724 |
| 397 | Ga0495640_0005377 | 3300046533 | Bacteria | 10188 |
| 398 | Ga0495640_0110828 | 3300046533 | Bacteria | 1794 |
| 399 | Ga0495640_0164193 | 3300046533 | Bacteria | 1421 |
| 400 | Ga0495640_0316256 | 3300046533 | Bacteria | 967 |
| 401 | Ga0495586_0008736 | 3300046535 | Bacteria | 5393 |
| 402 | Ga0495586_0011589 | 3300046535 | Bacteria | 4692 |
| 403 | Ga0495586_0016899 | 3300046535 | Bacteria | 3881 |
| 404 | Ga0495586_0019143 | 3300046535 | Bacteria | 3642 |
| 405 | Ga0495586_0195936 | 3300046535 | Bacteria | 1144 |
| 406 | Ga0495586_0342176 | 3300046535 | Bacteria | 859 |
| 407 | Ga0495587_0021469 | 3300046536 | Bacteria | 3982 |
| 408 | Ga0495587_0108659 | 3300046536 | Bacteria | 1594 |
| 409 | Ga0495598_0333688 | 3300046537 | Bacteria | 580 |
| 410 | Ga0495621_0180533 | 3300046539 | Bacteria | 842 |
| 411 | Ga0495645_0010720 | 3300046543 | Bacteria | 6437 |
| 412 | Ga0495645_0020500 | 3300046543 | Bacteria | 4771 |
| 413 | Ga0495645_0116887 | 3300046543 | Bacteria | 1882 |
| 414 | Ga0495667_0065416 | 3300046559 | Bacteria | 2378 |
| 415 | Ga0495667_0476032 | 3300046559 | Bacteria | 783 |
| 416 | Ga0495656_0005025 | 3300046615 | Bacteria | 4556 |
| 417 | Ga0495668_0064887 | 3300046616 | Bacteria | 2010 |
| 418 | Ga0495634_0007256 | 3300046642 | Bacteria | 8353 |
| 419 | Ga0495634_0080250 | 3300046642 | Bacteria | 2135 |
| 420 | Ga0495634_0245587 | 3300046642 | Bacteria | 1096 |
| 421 | Ga0495634_0308699 | 3300046642 | Bacteria | 955 |
| 422 | Ga0495634_0519599 | 3300046642 | Bacteria | 696 |
| 423 | Ga0495635_0020313 | 3300046663 | Bacteria | 4628 |
| 424 | Ga0495635_0027689 | 3300046663 | Bacteria | 3941 |
| 425 | Ga0495635_0054871 | 3300046663 | Bacteria | 2744 |
| 426 | Ga0495635_0060084 | 3300046663 | Bacteria | 2613 |
| 427 | Ga0495635_0458520 | 3300046663 | Bacteria | 842 |
| 428 | Ga0495635_0869162 | 3300046663 | Bacteria | 578 |
| 429 | Ga0495659_0030357 | 3300046664 | Bacteria | 1881 |
| 430 | Ga0495661_0157939 | 3300046665 | Unclassified | 1220 |
| 431 | Ga0495588_0735472 | 3300046674 | Bacteria | 516 |
| 432 | Ga0495657_0019689 | 3300046675 | Bacteria | 4865 |
| 433 | Ga0495657_0038452 | 3300046675 | Bacteria | 3293 |
| 434 | Ga0495657_0147493 | 3300046675 | Bacteria | 1463 |
| 435 | Ga0495657_0294105 | 3300046675 | Bacteria | 969 |
| 436 | Ga0495599_0004995 | 3300046678 | Bacteria | 7890 |
| 437 | Ga0495599_0009444 | 3300046678 | Bacteria | 5963 |
| 438 | Ga0495599_0061519 | 3300046678 | Bacteria | 2346 |
| 439 | Ga0495599_0540197 | 3300046678 | Bacteria | 683 |
| 440 | Ga0495623_0008557 | 3300046679 | Bacteria | 6645 |
| 441 | Ga0495646_0065453 | 3300046680 | Bacteria | 2152 |
| 442 | Ga0495646_0308720 | 3300046680 | Bacteria | 835 |
| 443 | Ga0495647_0000373 | 3300046681 | Bacteria | 12661 |
| 444 | Ga0495647_0257317 | 3300046681 | Unclassified | 778 |
| 445 | Ga0495647_0558867 | 3300046681 | Bacteria | 535 |
| 446 | Ga0495658_0027177 | 3300046683 | Bacteria | 3075 |
| 447 | Ga0495658_0049640 | 3300046683 | Bacteria | 2371 |
| 448 | Ga0495658_0066628 | 3300046683 | Bacteria | 2080 |
| 449 | Ga0495658_0551059 | 3300046683 | Bacteria | 738 |
| 450 | Ga0495613_0001141 | 3300046689 | Bacteria | 20239 |
| 451 | Ga0495613_0061267 | 3300046689 | Bacteria | 2755 |
| 452 | Ga0495613_0089607 | 3300046689 | Bacteria | 2228 |
| 453 | Ga0495613_0204788 | 3300046689 | Bacteria | 1390 |
| 454 | Ga0495613_0691972 | 3300046689 | Bacteria | 672 |
| 455 | Ga0495624_0011331 | 3300046690 | Bacteria | 6128 |
| 456 | Ga0495624_0014449 | 3300046690 | Bacteria | 5356 |
| 457 | Ga0495624_0015890 | 3300046690 | Bacteria | 5070 |
| 458 | Ga0495624_0060813 | 3300046690 | Bacteria | 2368 |
| 459 | Ga0495624_0890978 | 3300046690 | Unclassified | 524 |
| 460 | Ga0495589_0141569 | 3300046794 | Bacteria | 1151 |
| 461 | Ga0495600_0013238 | 3300046809 | Bacteria | 5178 |
| 462 | Ga0495600_0141267 | 3300046809 | Bacteria | 1562 |
| 463 | Ga0495600_0177960 | 3300046809 | Bacteria | 1371 |
| 464 | Ga0495600_0196042 | 3300046809 | Bacteria | 1298 |
| 465 | Ga0495600_0294987 | 3300046809 | Bacteria | 1024 |
| 466 | Ga0495581_0003607 | 3300047315 | Bacteria | 8910 |
| 467 | Ga0495581_0013081 | 3300047315 | Bacteria | 4811 |
| 468 | Ga0495581_0156404 | 3300047315 | Bacteria | 1332 |
| 469 | Ga0495581_0306017 | 3300047315 | Bacteria | 929 |
| 470 | Ga0495581_0702789 | 3300047315 | Bacteria | 583 |
| 471 | Ga0495604_0191574 | 3300047317 | Bacteria | 1424 |
| 472 | Ga0495604_0202927 | 3300047317 | Bacteria | 1374 |
| 473 | Ga0495674_0019490 | 3300047319 | Bacteria | 6294 |
| 474 | Ga0495674_0031686 | 3300047319 | Bacteria | 4800 |
| 475 | Ga0495674_0043407 | 3300047319 | Bacteria | 4002 |
| 476 | Ga0495674_0052220 | 3300047319 | Bacteria | 3598 |
| 477 | Ga0495674_0294103 | 3300047319 | Bacteria | 1327 |
| 478 | Ga0495676_0070435 | 3300047321 | Bacteria | 2693 |
| 479 | Ga0495676_0309549 | 3300047321 | Bacteria | 1063 |
| 480 | Ga0495676_0517946 | 3300047321 | Bacteria | 782 |
| 481 | Ga0495676_0718525 | 3300047321 | Bacteria | 646 |
| 482 | Ga0495676_0890549 | 3300047321 | Bacteria | 570 |
| 483 | Ga0495680_0048863 | 3300047322 | Archaea | 3319 |
| 484 | Ga0495680_0063608 | 3300047322 | Bacteria | 2833 |
| 485 | Ga0495680_0067235 | 3300047322 | Bacteria | 2740 |
| 486 | Ga0495680_0368721 | 3300047322 | Bacteria | 997 |
| 487 | Ga0495675_0130270 | 3300047444 | Bacteria | 1564 |
| 488 | Ga0495677_0031153 | 3300047445 | Bacteria | 1941 |
| 489 | Ga0495685_046141 | 3300047447 | Bacteria | 1483 |
| 490 | Ga0495684_0004825 | 3300047471 | Bacteria | 10522 |
| 491 | Ga0495684_0024046 | 3300047471 | Archaea | 4687 |
| 492 | Ga0495684_0036890 | 3300047471 | Bacteria | 3747 |
| 493 | Ga0495684_0075567 | 3300047471 | Bacteria | 2559 |
| 494 | Ga0495684_0181563 | 3300047471 | Bacteria | 1559 |
| 495 | Ga0495593_0005681 | 3300047673 | Bacteria | 7359 |
| 496 | Ga0495593_0458702 | 3300047673 | Bacteria | 638 |
| 497 | Ga0495602_0038366 | 3300048088 | Bacteria | 4430 |
| 498 | Ga0495602_0110712 | 3300048088 | Bacteria | 2231 |
| 499 | Ga0495602_0539677 | 3300048088 | Bacteria | 810 |
| 500 | Ga0495614_0003371 | 3300048089 | Bacteria | 7141 |
| 501 | Ga0495614_0507971 | 3300048089 | Unclassified | 574 |
| 502 | Ga0496100_0050526 | 3300048903 | Bacteria | 2694 |
| 503 | Ga0496100_0092921 | 3300048903 | Bacteria | 2063 |
| 504 | Ga0496100_0098783 | 3300048903 | Bacteria | 2007 |
| 505 | Ga0496100_0405684 | 3300048903 | Bacteria | 1039 |
| 506 | Ga0496100_0440033 | 3300048903 | Bacteria | 998 |
| 507 | Ga0496101_0058602 | 3300048904 | Bacteria | 2789 |
| 508 | Ga0496101_0145543 | 3300048904 | Bacteria | 1809 |
| 509 | Ga0496101_0349605 | 3300048904 | Bacteria | 1162 |
| 510 | Ga0496101_0394037 | 3300048904 | Bacteria | 1090 |
| 511 | Ga0496101_0525943 | 3300048904 | Unclassified | 935 |
| 512 | Ga0496101_0591618 | 3300048904 | Bacteria | 877 |
| 513 | Ga0496101_0625399 | 3300048904 | Bacteria | 851 |
| 514 | Ga0496102_0066819 | 3300048905 | Bacteria | 3296 |
| 515 | Ga0496102_0227818 | 3300048905 | Bacteria | 1757 |
| 516 | Ga0496102_0381191 | 3300048905 | Bacteria | 1327 |
| 517 | Ga0496102_1806211 | 3300048905 | Archaea | 528 |
| 518 | Ga0496103_0019511 | 3300048906 | Archaea | 4071 |
| 519 | Ga0496103_0034640 | 3300048906 | Bacteria | 3089 |
| 520 | Ga0496103_0642500 | 3300048906 | Unclassified | 675 |
| 521 | Ga0496104_0096019 | 3300048907 | Bacteria | 2836 |
| 522 | Ga0496104_0373432 | 3300048907 | Bacteria | 1338 |
| 523 | Ga0496104_0379010 | 3300048907 | Bacteria | 1327 |
| 524 | Ga0496105_0007590 | 3300048908 | Bacteria | 8406 |
| 525 | Ga0496105_0110415 | 3300048908 | Bacteria | 2270 |
| 526 | Ga0496105_0116265 | 3300048908 | Bacteria | 2206 |
| 527 | Ga0496105_0202260 | 3300048908 | Bacteria | 1621 |
| 528 | Ga0496105_0362660 | 3300048908 | Bacteria | 1156 |
| 529 | Ga0496105_1046072 | 3300048908 | Archaea | 608 |
| 530 | Ga0496106_0029233 | 3300048909 | Bacteria | 4106 |
| 531 | Ga0496106_0069672 | 3300048909 | Bacteria | 2685 |
| 532 | Ga0496107_0035216 | 3300048910 | Bacteria | 3588 |
| 533 | Ga0496107_0167674 | 3300048910 | Bacteria | 1629 |
| 534 | Ga0496107_0192048 | 3300048910 | Bacteria | 1517 |
| 535 | Ga0496108_0039446 | 3300048911 | Bacteria | 3936 |
| 536 | Ga0496108_0069555 | 3300048911 | Bacteria | 2970 |
| 537 | Ga0496108_0081514 | 3300048911 | Bacteria | 2742 |
| 538 | Ga0496108_0253693 | 3300048911 | Bacteria | 1530 |
| 539 | Ga0496108_1201907 | 3300048911 | Unclassified | 641 |
| 540 | Ga0496109_0009017 | 3300048912 | Bacteria | 8497 |
| 541 | Ga0496109_0070370 | 3300048912 | Bacteria | 3210 |
| 542 | Ga0496109_0078936 | 3300048912 | Bacteria | 3031 |
| 543 | Ga0496109_0623958 | 3300048912 | Unclassified | 1014 |
| 544 | Ga0496109_0665893 | 3300048912 | Bacteria | 978 |
| 545 | Ga0496110_0044659 | 3300048913 | Bacteria | 3870 |
| 546 | Ga0496110_0044891 | 3300048913 | Bacteria | 3860 |
| 547 | Ga0496110_0156152 | 3300048913 | Bacteria | 2067 |
| 548 | Ga0496110_0284168 | 3300048913 | Bacteria | 1507 |
| 549 | Ga0496110_0498287 | 3300048913 | Unclassified | 1109 |
| 550 | Ga0496111_0006168 | 3300048914 | Bacteria | 7760 |
| 551 | Ga0496111_0027581 | 3300048914 | Bacteria | 4019 |
| 552 | Ga0496111_0145688 | 3300048914 | Bacteria | 1756 |
| 553 | Ga0496111_0242738 | 3300048914 | Bacteria | 1337 |
| 554 | Ga0496112_0128751 | 3300048915 | Bacteria | 2502 |
| 555 | Ga0496112_0136419 | 3300048915 | Bacteria | 2423 |
| 556 | Ga0496112_0164407 | 3300048915 | Bacteria | 2185 |
| 557 | Ga0496112_0277755 | 3300048915 | Bacteria | 1623 |
| 558 | Ga0496112_0783775 | 3300048915 | Unclassified | 878 |
| 559 | Ga0496113_0094452 | 3300048916 | Bacteria | 2310 |
| 560 | Ga0496113_0395517 | 3300048916 | Bacteria | 1109 |
| 561 | Ga0496113_0514740 | 3300048916 | Bacteria | 961 |
| 562 | Ga0496113_0529346 | 3300048916 | Bacteria | 946 |
| 563 | Ga0496113_0745180 | 3300048916 | Bacteria | 780 |
| 564 | Ga0496113_1051166 | 3300048916 | Unclassified | 640 |
| 565 | Ga0496114_0050046 | 3300048917 | Bacteria | 3477 |
| 566 | Ga0496114_0051836 | 3300048917 | Bacteria | 3417 |
| 567 | Ga0496114_0083518 | 3300048917 | Bacteria | 2702 |
| 568 | Ga0496114_0125052 | 3300048917 | Bacteria | 2216 |
| 569 | Ga0496114_0457409 | 3300048917 | Bacteria | 1130 |
| 570 | Ga0496115_0026779 | 3300048918 | Bacteria | 4504 |
| 571 | Ga0496115_0055972 | 3300048918 | Bacteria | 3169 |
| 572 | Ga0496115_0058769 | 3300048918 | Bacteria | 3095 |
| 573 | Ga0496115_0109022 | 3300048918 | Bacteria | 2273 |
| 574 | Ga0496115_1358445 | 3300048918 | Unclassified | 526 |
| 575 | Ga0501067_0037582 | 3300049583 | Unclassified | 2689 |
| 576 | Ga0501067_0077777 | 3300049583 | Bacteria | 1838 |
| 577 | Ga0501069_0030304 | 3300049585 | Bacteria | 2971 |
| 578 | Ga0501069_0072769 | 3300049585 | Bacteria | 1927 |
| 579 | Ga0501074_0763432 | 3300049590 | Bacteria | 682 |
| 580 | nmdc:mga08y16_127362_c2 | 3300050511 | Bacteria | 1754 |
| 581 | nmdc:mga0a205_198998_c1 | 3300050515 | Bacteria | 1894 |
| 582 | Ga0495601_0086481 | 3300053077 | Bacteria | 2014 |
| 583 | Ga0495601_0163724 | 3300053077 | Bacteria | 1453 |
| 584 | Ga0495601_0424356 | 3300053077 | Bacteria | 861 |
| 585 | Ga0495601_0425794 | 3300053077 | Bacteria | 859 |
| 586 | Ga0495612_0056294 | 3300053078 | Bacteria | 1622 |
| 587 | Ga0495612_0073936 | 3300053078 | Bacteria | 1424 |
| 588 | Ga0495612_0150839 | 3300053078 | Bacteria | 1011 |
| 589 | Ga0495595_0009556 | 3300053084 | Unclassified | 4016 |
| 590 | Ga0495595_0013060 | 3300053084 | Bacteria | 3504 |
| 591 | Ga0495595_0154513 | 3300053084 | Bacteria | 1130 |
| 592 | Ga0495595_0374940 | 3300053084 | Bacteria | 720 |
| 593 | Ga0495595_0498696 | 3300053084 | Unclassified | 620 |
| 594 | Ga0495619_0039767 | 3300053085 | Bacteria | 3071 |
| 595 | Ga0495619_0071974 | 3300053085 | Bacteria | 2314 |
| 596 | Ga0495619_0123207 | 3300053085 | Bacteria | 1778 |
| 597 | Ga0495619_0146160 | 3300053085 | Bacteria | 1630 |
| 598 | Ga0495619_0258783 | 3300053085 | Bacteria | 1206 |
| 599 | Ga0495619_0513697 | 3300053085 | Bacteria | 823 |
| 600 | Ga0500566_0156752 | 3300053094 | Bacteria | 1191 |
| 601 | Ga0500566_0329768 | 3300053094 | Bacteria | 707 |
| 602 | Ga0500657_173548 | 3300053728 | Bacteria | 760 |
| 603 | Ga0501084_0829823 | 3300054114 | Bacteria | 778 |
| 604 | Ga0501082_0716376 | 3300060353 | Bacteria | 876 |
| 605 | Ga0466962_0001681 | 3300061719 | Bacteria | 10380 |
| 606 | Ga0466962_0031410 | 3300061719 | Bacteria | 2543 |
| 607 | Ga0466962_0068401 | 3300061719 | Bacteria | 1696 |
| 608 | Ga0466962_0110811 | 3300061719 | Bacteria | 1321 |
| 609 | Ga0466962_0143689 | 3300061719 | Bacteria | 1156 |
| 610 | Ga0466962_0415568 | 3300061719 | Bacteria | 675 |
| 611 | Ga0530510_0099543 | 3300061734 | Bacteria | 2126 |
| 612 | Ga0495629_0112048 | |||
| 613 | Ga0070658_10014304 | |||
| 614 | Ga0070658_10524216 | |||
| 615 | Ga0070683_100155761 | |||
| 616 | Ga0070680_100015767 | |||
| 617 | Ga0070680_100108730 | |||
| 618 | Ga0070680_100342970 | |||
| 619 | Ga0070682_100049476 | |||
| 620 | Ga0068868_100193541 | |||
| 621 | Ga0068868_102133850 | |||
| 622 | Ga0070660_100004010 | |||
| 623 | Ga0070660_100616883 | |||
| 624 | Ga0070661_100080662 | |||
| 625 | Ga0070661_100445262 | |||
| 626 | Ga0070671_100152865 | |||
| 627 | Ga0070659_100315245 | |||
| 628 | Ga0070659_100446233 | |||
| 629 | Ga0070709_10122443 | |||
| 630 | Ga0070709_10260118 | |||
| 631 | Ga0070714_100004472 | |||
| 632 | Ga0070714_100021145 | |||
| 633 | Ga0070714_100025096 | |||
| 634 | Ga0070714_100049468 | |||
| 635 | Ga0070714_100085391 | |||
| 636 | Ga0070714_100096400 | |||
| 637 | Ga0070714_100301114 | |||
| 638 | Ga0070714_100464355 | |||
| 639 | Ga0070714_101507707 | |||
| 640 | Ga0070713_100070946 | |||
| 641 | Ga0070713_100074903 | |||
| 642 | Ga0070713_101161972 | |||
| 643 | Ga0070710_10004780 | |||
| 644 | Ga0070710_10049156 | |||
| 645 | Ga0070710_10084418 | |||
| 646 | Ga0070678_101643697 | |||
| 647 | Ga0070681_10028662 | |||
| 648 | Ga0070681_10337503 | |||
| 649 | Ga0070707_100432906 | |||
| 650 | Ga0070679_100040029 | |||
| 651 | Ga0070679_100292030 | |||
| 652 | Ga0070679_100373598 | |||
| 653 | Ga0070684_100060703 | |||
| 654 | Ga0070684_100062092 | |||
| 655 | Ga0070684_100064232 | |||
| 656 | Ga0070695_100000209 | |||
| 657 | Ga0070693_100614042 | |||
| 658 | Ga0070693_101089355 | |||
| 659 | Ga0070704_100074586 | |||
| 660 | Ga0068855_100003360 | |||
| 661 | Ga0068855_100046068 | |||
| 662 | Ga0068855_100074314 | |||
| 663 | Ga0068855_100500241 | |||
| 664 | Ga0070664_100116865 | |||
| 665 | Ga0070664_100893262 | |||
| 666 | Ga0068854_100738357 | |||
| 667 | Ga0068856_100021002 | |||
| 668 | Ga0068856_100181401 | |||
| 669 | Ga0070702_100107017 | |||
| 670 | Ga0068852_100343541 | |||
| 671 | Ga0068852_100666338 | |||
| 672 | Ga0068863_100159153 | |||
| 673 | Ga0068863_100833490 | |||
| 674 | Ga0068858_101653707 | |||
| 675 | Ga0070717_10005447 | |||
| 676 | Ga0070717_10071120 | |||
| 677 | Ga0070717_10186749 | |||
| 678 | Ga0070717_10259440 | |||
| 679 | Ga0070717_10984636 | |||
| 680 | Ga0070715_10004505 | |||
| 681 | Ga0070716_100010808 | |||
| 682 | Ga0070712_100197508 | |||
| 683 | Ga0070712_100225462 | |||
| 684 | Ga0075433_10063490 | |||
| 685 | Ga0075434_100003661 | |||
| 686 | Ga0105240_10045671 | |||
| 687 | Ga0105240_10125870 | |||
| 688 | Ga0105240_10347756 | |||
| 689 | Ga0111539_10492799 | |||
| 690 | Ga0105245_10073532 | |||
| 691 | Ga0105245_11258430 | |||
| 692 | Ga0105247_10116298 | |||
| 693 | Ga0105241_11047555 | |||
| 694 | Ga0105248_10161088 | |||
| 695 | Ga0105237_10057657 | |||
| 696 | Ga0105237_11671447 | |||
| 697 | Ga0105237_12490976 | |||
| 698 | Ga0105238_10292280 | |||
| 699 | Ga0105238_10514425 | |||
| 700 | Ga0105249_11357221 | |||
| 701 | Ga0105239_10374628 | |||
| 702 | Ga0105239_10650335 | |||
| 703 | Ga0157373_10220183 | |||
| 704 | Ga0157373_10821346 | |||
| 705 | Ga0157373_11238404 | |||
| 706 | Ga0157371_11188968 | |||
| 707 | Ga0157370_10014156 | |||
| 708 | Ga0157370_10033313 | |||
| 709 | Ga0157370_10103091 | |||
| 710 | Ga0157370_11256309 | |||
| 711 | Ga0157370_11895795 | |||
| 712 | Ga0157369_10003612 | |||
| 713 | Ga0157369_10080356 | |||
| 714 | Ga0157369_10091877 | |||
| 715 | Ga0157369_10106006 | |||
| 716 | Ga0157369_10208307 | |||
| 717 | Ga0157369_10470582 | |||
| 718 | Ga0157369_10828419 | |||
| 719 | Ga0157374_10510228 | |||
| 720 | Ga0157378_11862620 | |||
| 721 | Ga0163162_10113156 | |||
| 722 | Ga0157372_10041853 | |||
| 723 | Ga0157372_10171537 | |||
| 724 | Ga0157372_10317187 | |||
| 725 | Ga0157372_11685737 | |||
| 726 | Ga0157375_10816674 | |||
| 727 | Ga0163163_10466153 | |||
| 728 | Ga0182008_10016646 | |||
| 729 | Ga0182008_10094727 | |||
| 730 | Ga0157377_10579864 | |||
| 731 | Ga0157379_10236095 | |||
| 732 | Ga0157376_10011045 | |||
| 733 | Ga0157376_10390598 | |||
| 734 | Ga0157376_10545332 | |||
| 735 | Ga0182006_1053155 | |||
| 736 | Ga0182007_10015979 | |||
| 737 | Ga0197907_10922662 | |||
| 738 | Ga0206356_10555049 | |||
| 739 | Ga0206356_11018159 | |||
| 740 | Ga0206354_10931922 | |||
| 741 | Ga0207692_10112462 | |||
| 742 | Ga0207692_10352888 | |||
| 743 | Ga0207710_10065176 | |||
| 744 | Ga0207685_10083206 | |||
| 745 | Ga0207699_10022920 | |||
| 746 | Ga0207699_10046159 | |||
| 747 | Ga0207705_10017542 | |||
| 748 | Ga0207705_10033212 | |||
| 749 | Ga0207705_10145772 | |||
| 750 | Ga0207707_10021329 | |||
| 751 | Ga0207707_11002651 | |||
| 752 | Ga0207695_10113723 | |||
| 753 | Ga0207695_11018663 | |||
| 754 | Ga0207671_10037202 | |||
| 755 | Ga0207671_11193477 | |||
| 756 | Ga0207693_10001707 | |||
| 757 | Ga0207693_10011495 | |||
| 758 | Ga0207693_10438377 | |||
| 759 | Ga0207663_10357479 | |||
| 760 | Ga0207660_10014625 | |||
| 761 | Ga0207660_10252329 | |||
| 762 | Ga0207657_10003122 | |||
| 763 | Ga0207657_10017269 | |||
| 764 | Ga0207657_10037527 | |||
| 765 | Ga0207649_10647045 | |||
| 766 | Ga0207652_10238177 | |||
| 767 | Ga0207652_10494717 | |||
| 768 | Ga0207652_11644827 | |||
| 769 | Ga0207646_10587166 | |||
| 770 | Ga0207646_10592275 | |||
| 771 | Ga0207694_10353466 | |||
| 772 | Ga0207687_10109897 | |||
| 773 | Ga0207687_10627400 | |||
| 774 | Ga0207700_10043790 | |||
| 775 | Ga0207700_10913642 | |||
| 776 | Ga0207700_11020297 | |||
| 777 | Ga0207664_10009176 | |||
| 778 | Ga0207664_10012552 | |||
| 779 | Ga0207664_10040599 | |||
| 780 | Ga0207664_10041301 | |||
| 781 | Ga0207664_10081892 | |||
| 782 | Ga0207664_10121958 | |||
| 783 | Ga0207664_10304100 | |||
| 784 | Ga0207664_10572047 | |||
| 785 | Ga0207664_11348513 | |||
| 786 | Ga0207644_10265915 | |||
| 787 | Ga0207709_10547211 | |||
| 788 | Ga0207665_10000359 | |||
| 789 | Ga0207665_10226086 | |||
| 790 | Ga0207711_10546164 | |||
| 791 | Ga0207661_10283078 | |||
| 792 | Ga0207679_10041300 | |||
| 793 | Ga0207667_10325883 | |||
| 794 | Ga0207667_10369298 | |||
| 795 | Ga0207667_10374866 | |||
| 796 | Ga0207667_10403488 | |||
| 797 | Ga0207667_10411530 | |||
| 798 | Ga0207712_10310649 | |||
| 799 | Ga0207640_10576214 | |||
| 800 | Ga0207677_10283440 | |||
| 801 | Ga0207639_11182321 | |||
| 802 | Ga0207702_10082274 | |||
| 803 | Ga0207702_10181474 | |||
| 804 | Ga0207702_10559244 | |||
| 805 | Ga0207702_10777372 | |||
| 806 | Ga0207641_10267236 | |||
| 807 | Ga0207676_10429652 | |||
| 808 | Ga0207674_10109393 | |||
| 809 | Ga0207683_10213792 | |||
| 810 | Ga0207698_11027810 | |||
| 811 | Ga0265327_10003744 | |||
| 812 | Ga0265327_10149645 | |||
| 813 | Ga0307409_100747724 | |||
| 814 | Ga0307414_11479435 | |||
| 815 | Ga0373944_0013395 | |||
| 816 | Ga0373951_0118530 | |||
| 817 | Ga0373952_0077387 | |||
| 818 | Ga0373936_0058588 | |||
| 819 | Ga0373945_0053323 | |||
| 820 | Ga0373954_0166670 | |||
| 821 | Ga0373943_0024384 | |||
| 822 | Ga0373943_0202457 | |||
| 823 | Ga0373943_0554473 | |||
| 824 | Ga0373946_0035830 | |||
| 825 | Ga0373946_0202867 | |||
| 826 | Ga0373955_0212240 | |||
| 827 | Ga0373962_0233450 | |||
| 828 | Ga0373924_0171361 | |||
| 829 | Ga0373931_0038067 | |||
| 830 | Ga0373935_0085744 | |||
| 831 | Ga0373935_0321928 | |||
| 832 | Ga0373935_0524561 | |||
| 833 | Ga0373927_0143384 | |||
| 834 | Ga0373947_0012051 | |||
| 835 | Ga0373947_0123119 | |||
| 836 | Ga0373947_0247185 | |||
| 837 | Ga0373947_0466872 | |||
| 838 | Ga0373937_0194127 | |||
| 839 | Ga0373937_1392805 | |||
| 840 | Ga0373937_1954251 | |||
| 841 | Ga0373925_0004988 | |||
| 842 | Ga0395899_0053994 | |||
| 843 | Ga0395899_0101431 | |||
| 844 | Ga0395899_0339259 | |||
| 845 | Ga0395900_0023098 | |||
| 846 | Ga0395900_0547415 | |||
| 847 | Ga0395900_0778857 | |||
| 848 | Ga0395900_0982172 | |||
| 849 | Ga0395900_1836595 | |||
| 850 | Ga0395898_0040888 | |||
| 851 | Ga0395898_0050830 | |||
| 852 | Ga0395898_0355273 | |||
| 853 | Ga0395905_0139704 | |||
| 854 | Ga0395905_0244628 | |||
| 855 | Ga0395905_0480568 | |||
| 856 | Ga0395901_0007588 | |||
| 857 | Ga0395901_0058497 | |||
| 858 | Ga0395901_0535062 | |||
| 859 | Ga0395901_0773028 | |||
| 860 | Ga0439439_0160569 | |||
| 861 | Ga0451853_1830562 | |||
| 862 | Ga0439446_0005057 | |||
| 863 | Ga0439434_0052622 | |||
| 864 | Ga0466969_0327353 | |||
| 865 | Ga0466965_0049680 | |||
| 866 | Ga0466965_0108780 | |||
| 867 | Ga0466966_0194116 | |||
| 868 | Ga0466961_0049112 | |||
| 869 | Ga0466961_0342577 | |||
| 870 | Ga0466961_0612373 | |||
| 871 | Ga0466963_0001297 | |||
| 872 | Ga0466963_0003091 | |||
| 873 | Ga0466963_0004599 | |||
| 874 | Ga0466963_0040268 | |||
| 875 | Ga0466963_0047917 | |||
| 876 | Ga0466963_0086995 | |||
| 877 | Ga0466963_0090831 | |||
| 878 | Ga0466963_0115981 | |||
| 879 | Ga0466963_0206053 | |||
| 880 | Ga0466963_0540819 | |||
| 881 | Ga0466964_0007533 | |||
| 882 | Ga0466964_0009765 | |||
| 883 | Ga0466964_0032548 | |||
| 884 | Ga0466964_0033658 | |||
| 885 | Ga0466964_0063836 | |||
| 886 | Ga0466964_0085035 | |||
| 887 | Ga0466964_0125170 | |||
| 888 | Ga0466964_0126704 | |||
| 889 | Ga0466964_0148505 | |||
| 890 | Ga0466971_0003684 | |||
| 891 | Ga0466971_0048454 | |||
| 892 | Ga0466971_0056969 | |||
| 893 | Ga0466971_0238708 | |||
| 894 | Ga0466971_0529878 | |||
| 895 | Ga0466968_0006616 | |||
| 896 | Ga0466968_0006945 | |||
| 897 | Ga0466968_0014165 | |||
| 898 | Ga0466968_0065302 | |||
| 899 | Ga0466968_0072939 | |||
| 900 | Ga0466968_0100763 | |||
| 901 | Ga0466968_0398452 | |||
| 902 | Ga0466970_0038365 | |||
| 903 | Ga0466957_0006625 | |||
| 904 | Ga0466957_0007304 | |||
| 905 | Ga0466957_0030565 | |||
| 906 | Ga0466957_0193830 | |||
| 907 | Ga0466960_0005535 | |||
| 908 | Ga0466960_0448252 | |||
| 909 | Ga0466959_0190129 | |||
| 910 | Ga0466959_0215294 | |||
| 911 | Ga0466959_0462955 | |||
| 912 | Ga0466959_0620802 | |||
| 913 | Ga0466958_0005267 | |||
| 914 | Ga0466958_0022705 | |||
| 915 | Ga0466958_0092308 | |||
| 916 | Ga0466958_0239415 | |||
| 917 | Ga0466958_0299704 | |||
| 918 | Ga0466958_0337800 | |||
| 919 | Ga0466958_0542426 | |||
| 920 | Ga0466958_0605933 | |||
| 921 | Ga0466967_0009453 | |||
| 922 | Ga0466967_0011239 | |||
| 923 | Ga0466967_0021796 | |||
| 924 | Ga0466967_0021971 | |||
| 925 | Ga0466967_0029939 | |||
| 926 | Ga0466967_0032549 | |||
| 927 | Ga0466967_0035151 | |||
| 928 | Ga0466967_0045747 | |||
| 929 | Ga0466967_0058108 | |||
| 930 | Ga0466967_0149311 | |||
| 931 | Ga0466967_0160211 | |||
| 932 | Ga0466967_0272586 | |||
| 933 | Ga0466967_0303539 | |||
| 934 | Ga0466967_0380930 | |||
| 935 | Ga0466967_0413844 | |||
| 936 | Ga0466967_0425032 | |||
| 937 | Ga0466967_0488093 | |||
| 938 | Ga0466967_0504683 | |||
| 939 | Ga0466967_0505600 | |||
| 940 | Ga0466967_0561939 | |||
| 941 | Ga0466967_1131762 | |||
| 942 | Ga0495592_0005488 | |||
| 943 | Ga0495592_0011072 | |||
| 944 | Ga0495592_0260917 | |||
| 945 | Ga0495603_0088596 | |||
| 946 | Ga0495629_0007462 | |||
| 947 | Ga0495629_0047802 | |||
| 948 | Ga0495629_0267264 | |||
| 949 | Ga0495629_0640376 | |||
| 950 | Ga0495629_1080034 | |||
| 951 | Ga0495641_0017824 | |||
| 952 | Ga0495641_0035909 | |||
| 953 | Ga0495641_0050037 | |||
| 954 | Ga0495641_0060395 | |||
| 955 | Ga0495641_0223936 | |||
| 956 | Ga0495641_0358690 | |||
| 957 | Ga0495651_0035851 | |||
| 958 | Ga0495651_0354030 | |||
| 959 | Ga0495653_0011970 | |||
| 960 | Ga0495653_0154697 | |||
| 961 | Ga0495653_0194916 | |||
| 962 | Ga0495653_0484321 | |||
| 963 | Ga0495653_0778308 | |||
| 964 | Ga0495580_0221294 | |||
| 965 | Ga0495580_0508599 | |||
| 966 | Ga0495582_0006876 | |||
| 967 | Ga0495582_0037974 | |||
| 968 | Ga0495582_0038635 | |||
| 969 | Ga0495582_0087822 | |||
| 970 | Ga0495639_0002130 | |||
| 971 | Ga0495662_0003067 | |||
| 972 | Ga0495662_0144968 | |||
| 973 | Ga0495662_0541137 | |||
| 974 | Ga0495664_0011563 | |||
| 975 | Ga0495664_0014362 | |||
| 976 | Ga0495664_0088756 | |||
| 977 | Ga0495664_0131167 | |||
| 978 | Ga0495584_0021287 | |||
| 979 | Ga0495585_0029947 | |||
| 980 | Ga0495594_0217352 | |||
| 981 | Ga0495594_0554215 | |||
| 982 | Ga0495607_0021962 | |||
| 983 | Ga0495608_0003297 | |||
| 984 | Ga0495608_0041985 | |||
| 985 | Ga0495608_0111352 | |||
| 986 | Ga0495618_0188558 | |||
| 987 | Ga0495618_0233835 | |||
| 988 | Ga0495618_0373207 | |||
| 989 | Ga0495628_0087989 | |||
| 990 | Ga0495630_0017884 | |||
| 991 | Ga0495630_0020061 | |||
| 992 | Ga0495630_0097410 | |||
| 993 | Ga0495630_0163203 | |||
| 994 | Ga0495630_0180478 | |||
| 995 | Ga0495630_0719826 | |||
| 996 | Ga0495630_0853787 | |||
| 997 | Ga0495631_0301634 | |||
| 998 | Ga0495644_0016352 | |||
| 999 | Ga0495666_0002953 | |||
| 1000 | Ga0495666_0077440 | |||
| 1001 | Ga0495642_0134777 | |||
| 1002 | Ga0495652_0018236 | |||
| 1003 | Ga0495652_0076542 | |||
| 1004 | Ga0495652_0157007 | |||
| 1005 | Ga0495652_0346571 | |||
| 1006 | Ga0495665_0007699 | |||
| 1007 | Ga0495665_0374645 | |||
| 1008 | Ga0495640_0005377 | |||
| 1009 | Ga0495640_0110828 | |||
| 1010 | Ga0495640_0164193 | |||
| 1011 | Ga0495640_0316256 | |||
| 1012 | Ga0495586_0008736 | |||
| 1013 | Ga0495586_0011589 | |||
| 1014 | Ga0495586_0016899 | |||
| 1015 | Ga0495586_0019143 | |||
| 1016 | Ga0495586_0195936 | |||
| 1017 | Ga0495586_0342176 | |||
| 1018 | Ga0495587_0021469 | |||
| 1019 | Ga0495587_0108659 | |||
| 1020 | Ga0495598_0333688 | |||
| 1021 | Ga0495621_0180533 | |||
| 1022 | Ga0495645_0010720 | |||
| 1023 | Ga0495645_0020500 | |||
| 1024 | Ga0495645_0116887 | |||
| 1025 | Ga0495667_0065416 | |||
| 1026 | Ga0495667_0476032 | |||
| 1027 | Ga0495656_0005025 | |||
| 1028 | Ga0495668_0064887 | |||
| 1029 | Ga0495634_0007256 | |||
| 1030 | Ga0495634_0080250 | |||
| 1031 | Ga0495634_0245587 | |||
| 1032 | Ga0495634_0308699 | |||
| 1033 | Ga0495634_0519599 | |||
| 1034 | Ga0495635_0020313 | |||
| 1035 | Ga0495635_0027689 | |||
| 1036 | Ga0495635_0054871 | |||
| 1037 | Ga0495635_0060084 | |||
| 1038 | Ga0495635_0458520 | |||
| 1039 | Ga0495635_0869162 | |||
| 1040 | Ga0495659_0030357 | |||
| 1041 | Ga0495661_0157939 | |||
| 1042 | Ga0495588_0735472 | |||
| 1043 | Ga0495657_0019689 | |||
| 1044 | Ga0495657_0038452 | |||
| 1045 | Ga0495657_0147493 | |||
| 1046 | Ga0495657_0294105 | |||
| 1047 | Ga0495599_0004995 | |||
| 1048 | Ga0495599_0009444 | |||
| 1049 | Ga0495599_0061519 | |||
| 1050 | Ga0495599_0540197 | |||
| 1051 | Ga0495623_0008557 | |||
| 1052 | Ga0495646_0065453 | |||
| 1053 | Ga0495646_0308720 | |||
| 1054 | Ga0495647_0000373 | |||
| 1055 | Ga0495647_0257317 | |||
| 1056 | Ga0495647_0558867 | |||
| 1057 | Ga0495658_0027177 | |||
| 1058 | Ga0495658_0049640 | |||
| 1059 | Ga0495658_0066628 | |||
| 1060 | Ga0495658_0551059 | |||
| 1061 | Ga0495613_0001141 | |||
| 1062 | Ga0495613_0061267 | |||
| 1063 | Ga0495613_0089607 | |||
| 1064 | Ga0495613_0204788 | |||
| 1065 | Ga0495613_0691972 | |||
| 1066 | Ga0495624_0011331 | |||
| 1067 | Ga0495624_0014449 | |||
| 1068 | Ga0495624_0015890 | |||
| 1069 | Ga0495624_0060813 | |||
| 1070 | Ga0495624_0890978 | |||
| 1071 | Ga0495589_0141569 | |||
| 1072 | Ga0495600_0013238 | |||
| 1073 | Ga0495600_0141267 | |||
| 1074 | Ga0495600_0177960 | |||
| 1075 | Ga0495600_0196042 | |||
| 1076 | Ga0495600_0294987 | |||
| 1077 | Ga0495581_0003607 | |||
| 1078 | Ga0495581_0013081 | |||
| 1079 | Ga0495581_0156404 | |||
| 1080 | Ga0495581_0306017 | |||
| 1081 | Ga0495581_0702789 | |||
| 1082 | Ga0495604_0191574 | |||
| 1083 | Ga0495604_0202927 | |||
| 1084 | Ga0495674_0019490 | |||
| 1085 | Ga0495674_0031686 | |||
| 1086 | Ga0495674_0043407 | |||
| 1087 | Ga0495674_0052220 | |||
| 1088 | Ga0495674_0294103 | |||
| 1089 | Ga0495676_0070435 | |||
| 1090 | Ga0495676_0309549 | |||
| 1091 | Ga0495676_0517946 | |||
| 1092 | Ga0495676_0718525 | |||
| 1093 | Ga0495676_0890549 | |||
| 1094 | Ga0495680_0048863 | |||
| 1095 | Ga0495680_0063608 | |||
| 1096 | Ga0495680_0067235 | |||
| 1097 | Ga0495680_0368721 | |||
| 1098 | Ga0495675_0130270 | |||
| 1099 | Ga0495677_0031153 | |||
| 1100 | Ga0495685_046141 | |||
| 1101 | Ga0495684_0004825 | |||
| 1102 | Ga0495684_0024046 | |||
| 1103 | Ga0495684_0036890 | |||
| 1104 | Ga0495684_0075567 | |||
| 1105 | Ga0495684_0181563 | |||
| 1106 | Ga0495593_0005681 | |||
| 1107 | Ga0495593_0458702 | |||
| 1108 | Ga0495602_0038366 | |||
| 1109 | Ga0495602_0110712 | |||
| 1110 | Ga0495602_0539677 | |||
| 1111 | Ga0495614_0003371 | |||
| 1112 | Ga0495614_0507971 | |||
| 1113 | Ga0496100_0050526 | |||
| 1114 | Ga0496100_0092921 | |||
| 1115 | Ga0496100_0098783 | |||
| 1116 | Ga0496100_0405684 | |||
| 1117 | Ga0496100_0440033 | |||
| 1118 | Ga0496101_0058602 | |||
| 1119 | Ga0496101_0145543 | |||
| 1120 | Ga0496101_0349605 | |||
| 1121 | Ga0496101_0394037 | |||
| 1122 | Ga0496101_0525943 | |||
| 1123 | Ga0496101_0591618 | |||
| 1124 | Ga0496101_0625399 | |||
| 1125 | Ga0496102_0066819 | |||
| 1126 | Ga0496102_0227818 | |||
| 1127 | Ga0496102_0381191 | |||
| 1128 | Ga0496102_1806211 | |||
| 1129 | Ga0496103_0019511 | |||
| 1130 | Ga0496103_0034640 | |||
| 1131 | Ga0496103_0642500 | |||
| 1132 | Ga0496104_0096019 | |||
| 1133 | Ga0496104_0373432 | |||
| 1134 | Ga0496104_0379010 | |||
| 1135 | Ga0496105_0007590 | |||
| 1136 | Ga0496105_0110415 | |||
| 1137 | Ga0496105_0116265 | |||
| 1138 | Ga0496105_0202260 | |||
| 1139 | Ga0496105_0362660 | |||
| 1140 | Ga0496105_1046072 | |||
| 1141 | Ga0496106_0029233 | |||
| 1142 | Ga0496106_0069672 | |||
| 1143 | Ga0496107_0035216 | |||
| 1144 | Ga0496107_0167674 | |||
| 1145 | Ga0496107_0192048 | |||
| 1146 | Ga0496108_0039446 | |||
| 1147 | Ga0496108_0069555 | |||
| 1148 | Ga0496108_0081514 | |||
| 1149 | Ga0496108_0253693 | |||
| 1150 | Ga0496108_1201907 | |||
| 1151 | Ga0496109_0009017 | |||
| 1152 | Ga0496109_0070370 | |||
| 1153 | Ga0496109_0078936 | |||
| 1154 | Ga0496109_0623958 | |||
| 1155 | Ga0496109_0665893 | |||
| 1156 | Ga0496110_0044659 | |||
| 1157 | Ga0496110_0044891 | |||
| 1158 | Ga0496110_0156152 | |||
| 1159 | Ga0496110_0284168 | |||
| 1160 | Ga0496110_0498287 | |||
| 1161 | Ga0496111_0006168 | |||
| 1162 | Ga0496111_0027581 | |||
| 1163 | Ga0496111_0145688 | |||
| 1164 | Ga0496111_0242738 | |||
| 1165 | Ga0496112_0128751 | |||
| 1166 | Ga0496112_0136419 | |||
| 1167 | Ga0496112_0164407 | |||
| 1168 | Ga0496112_0277755 | |||
| 1169 | Ga0496112_0783775 | |||
| 1170 | Ga0496113_0094452 | |||
| 1171 | Ga0496113_0395517 | |||
| 1172 | Ga0496113_0514740 | |||
| 1173 | Ga0496113_0529346 | |||
| 1174 | Ga0496113_0745180 | |||
| 1175 | Ga0496113_1051166 | |||
| 1176 | Ga0496114_0050046 | |||
| 1177 | Ga0496114_0051836 | |||
| 1178 | Ga0496114_0083518 | |||
| 1179 | Ga0496114_0125052 | |||
| 1180 | Ga0496114_0457409 | |||
| 1181 | Ga0496115_0026779 | |||
| 1182 | Ga0496115_0055972 | |||
| 1183 | Ga0496115_0058769 | |||
| 1184 | Ga0496115_0109022 | |||
| 1185 | Ga0496115_1358445 | |||
| 1186 | Ga0501067_0037582 | |||
| 1187 | Ga0501067_0077777 | |||
| 1188 | Ga0501069_0030304 | |||
| 1189 | Ga0501069_0072769 | |||
| 1190 | Ga0501074_0763432 | |||
| 1191 | nmdc:mga08y16_127362_c2 | |||
| 1192 | nmdc:mga0a205_198998_c1 | |||
| 1193 | Ga0495601_0086481 | |||
| 1194 | Ga0495601_0163724 | |||
| 1195 | Ga0495601_0424356 | |||
| 1196 | Ga0495601_0425794 | |||
| 1197 | Ga0495612_0056294 | |||
| 1198 | Ga0495612_0073936 | |||
| 1199 | Ga0495612_0150839 | |||
| 1200 | Ga0495595_0009556 | |||
| 1201 | Ga0495595_0013060 | |||
| 1202 | Ga0495595_0154513 | |||
| 1203 | Ga0495595_0374940 | |||
| 1204 | Ga0495595_0498696 | |||
| 1205 | Ga0495619_0039767 | |||
| 1206 | Ga0495619_0071974 | |||
| 1207 | Ga0495619_0123207 | |||
| 1208 | Ga0495619_0146160 | |||
| 1209 | Ga0495619_0258783 | |||
| 1210 | Ga0495619_0513697 | |||
| 1211 | Ga0500566_0156752 | |||
| 1212 | Ga0500566_0329768 | |||
| 1213 | Ga0500657_173548 | |||
| 1214 | Ga0501084_0829823 | |||
| 1215 | Ga0501082_0716376 | |||
| 1216 | Ga0466962_0001681 | |||
| 1217 | Ga0466962_0031410 | |||
| 1218 | Ga0466962_0068401 | |||
| 1219 | Ga0466962_0110811 | |||
| 1220 | Ga0466962_0143689 | |||
| 1221 | Ga0466962_0415568 | |||
| 1222 | Ga0530510_0099543 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lmi-assembly1.cif.gz_A | crystal structure of putative ketosteroid isomerase from kribbella flavida dsm 17836 | 0.9217 | 4 | 110 |
| 4u13-assembly1.cif.gz_B | crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution | 0.9077 | 5 | 107 |
| 6uae-assembly4.cif.gz_D | ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 | 0.9068 | 5 | 113 |
| 3en8-assembly1.cif.gz_A-2 | crystal structure of ntf-2 like protein of unknown function (yp_553245.1) from burkholderia xenovorans lb400 at 1.85 a resolution | 0.9004 | 4 | 109 |
| 3f40-assembly1.cif.gz_A-2 | crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution | 0.8977 | 4 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lmiA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9217 | 4 | 110 | 3.10.450.50 |
| 4u13B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9074 | 5 | 107 | 3.10.450.50 |
| 5aigB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8948 | 1 | 107 | 3.10.450.50 |
| 5tgnA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8918 | 1 | 108 | 3.10.450.50 |
| af_B4FV63_52_171_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8863 | 2 | 97 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538IKB4-F1-model_v4 | Nuclear transport factor 2 family protein | 1.003 | 1 | 116 |
|
| AF-A0A538EWK6-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9956 | 4 | 116 |
|
| AF-A0A2D7KM25-F1-model_v4 | SnoaL-like domain-containing protein | 0.9658 | 5 | 110 |
|
| AF-A0A4P6K3Q8-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9625 | 3 | 109 |
|
| AF-A0A6J6BR24-F1-model_v4 | Unannotated protein | 0.9623 | 4 | 111 |
|