F469093

General Info

Members Datasets Scaffolds Average Seq Length
611 235 1222 119

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0112048|Ga0495629_0112048_918_1319
Length 133
Sequence MLPRCPGALKLSQTMDAAAVRELIERYNAAWNAQDLDTIDDLHHPDIVFDNHTAGERAEGAAAVREHIGQIFRNNPTLRFATRSLLTGDDFAVCEWTASTGSKEWDGVDVFPLRDGRIARKDVYSSSHRSREL

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
231 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 11.95
Rhizosphere 87.4
Stem 0
Stem Tuber 0
Unclassified 10.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0112048 3300046459 Bacteria 1902
2 Ga0070658_10014304 3300005327 Bacteria 6367
3 Ga0070658_10524216 3300005327 Bacteria 1024
4 Ga0070683_100155761 3300005329 Bacteria 2166
5 Ga0070680_100015767 3300005336 Bacteria 5932
6 Ga0070680_100108730 3300005336 Bacteria 2307
7 Ga0070680_100342970 3300005336 Bacteria 1269
8 Ga0070682_100049476 3300005337 Bacteria 2620
9 Ga0068868_100193541 3300005338 Bacteria 1692
10 Ga0068868_102133850 3300005338 Bacteria 533
11 Ga0070660_100004010 3300005339 Bacteria 10165
12 Ga0070660_100616883 3300005339 Bacteria 907
13 Ga0070661_100080662 3300005344 Bacteria 2401
14 Ga0070661_100445262 3300005344 Bacteria 1030
15 Ga0070671_100152865 3300005355 Bacteria 1949
16 Ga0070659_100315245 3300005366 Bacteria 1306
17 Ga0070659_100446233 3300005366 Bacteria 1097
18 Ga0070709_10122443 3300005434 Bacteria 1765
19 Ga0070709_10260118 3300005434 Unclassified 1253
20 Ga0070714_100004472 3300005435 Bacteria 10534
21 Ga0070714_100021145 3300005435 Bacteria 5321
22 Ga0070714_100025096 3300005435 Bacteria 4917
23 Ga0070714_100049468 3300005435 Bacteria 3578
24 Ga0070714_100085391 3300005435 Bacteria 2756
25 Ga0070714_100096400 3300005435 Bacteria 2599
26 Ga0070714_100301114 3300005435 Bacteria 1495
27 Ga0070714_100464355 3300005435 Bacteria 1204
28 Ga0070714_101507707 3300005435 Bacteria 657
29 Ga0070713_100070946 3300005436 Bacteria 2942
30 Ga0070713_100074903 3300005436 Bacteria 2869
31 Ga0070713_101161972 3300005436 Unclassified 747
32 Ga0070710_10004780 3300005437 Bacteria 6408
33 Ga0070710_10049156 3300005437 Unclassified 2358
34 Ga0070710_10084418 3300005437 Bacteria 1861
35 Ga0070678_101643697 3300005456 Unclassified 604
36 Ga0070681_10028662 3300005458 Bacteria 5598
37 Ga0070681_10337503 3300005458 Bacteria 1416
38 Ga0070707_100432906 3300005468 Bacteria 1276
39 Ga0070679_100040029 3300005530 Bacteria 4661
40 Ga0070679_100292030 3300005530 Bacteria 1581
41 Ga0070679_100373598 3300005530 Bacteria 1372
42 Ga0070684_100060703 3300005535 Bacteria 3308
43 Ga0070684_100062092 3300005535 Bacteria 3272
44 Ga0070684_100064232 3300005535 Bacteria 3220
45 Ga0070695_100000209 3300005545 Bacteria 28514
46 Ga0070693_100614042 3300005547 Bacteria 787
47 Ga0070693_101089355 3300005547 Archaea 609
48 Ga0070704_100074586 3300005549 Bacteria 2475
49 Ga0068855_100003360 3300005563 Bacteria 19591
50 Ga0068855_100046068 3300005563 Bacteria 5156
51 Ga0068855_100074314 3300005563 Bacteria 3948
52 Ga0068855_100500241 3300005563 Bacteria 1321
53 Ga0070664_100116865 3300005564 Bacteria 2332
54 Ga0070664_100893262 3300005564 Unclassified 833
55 Ga0068854_100738357 3300005578 Bacteria 853
56 Ga0068856_100021002 3300005614 Bacteria 6346
57 Ga0068856_100181401 3300005614 Bacteria 2118
58 Ga0070702_100107017 3300005615 Bacteria 1726
59 Ga0068852_100343541 3300005616 Bacteria 1455
60 Ga0068852_100666338 3300005616 Bacteria 1049
61 Ga0068863_100159153 3300005841 Bacteria 2163
62 Ga0068863_100833490 3300005841 Unclassified 921
63 Ga0068858_101653707 3300005842 Archaea 632
64 Ga0070717_10005447 3300006028 Bacteria 9291
65 Ga0070717_10071120 3300006028 Bacteria 2901
66 Ga0070717_10186749 3300006028 Bacteria 1809
67 Ga0070717_10259440 3300006028 Bacteria 1537
68 Ga0070717_10984636 3300006028 Bacteria 768
69 Ga0070715_10004505 3300006163 Archaea 4579
70 Ga0070716_100010808 3300006173 Archaea 4589
71 Ga0070712_100197508 3300006175 Unclassified 1578
72 Ga0070712_100225462 3300006175 Bacteria 1486
73 Ga0075433_10063490 3300006852 Bacteria 3236
74 Ga0075434_100003661 3300006871 Bacteria 13731
75 Ga0105240_10045671 3300009093 Bacteria 5556
76 Ga0105240_10125870 3300009093 Bacteria 3079
77 Ga0105240_10347756 3300009093 Bacteria 1682
78 Ga0111539_10492799 3300009094 Bacteria 1427
79 Ga0105245_10073532 3300009098 Bacteria 3108
80 Ga0105245_11258430 3300009098 Bacteria 788
81 Ga0105247_10116298 3300009101 Bacteria 1727
82 Ga0105241_11047555 3300009174 Bacteria 765
83 Ga0105248_10161088 3300009177 Bacteria 2531
84 Ga0105237_10057657 3300009545 Archaea 3886
85 Ga0105237_11671447 3300009545 Unclassified 644
86 Ga0105237_12490976 3300009545 Unclassified 528
87 Ga0105238_10292280 3300009551 Bacteria 1612
88 Ga0105238_10514425 3300009551 Bacteria 1199
89 Ga0105249_11357221 3300009553 Unclassified 783
90 Ga0105239_10374628 3300010375 Bacteria 1609
91 Ga0105239_10650335 3300010375 Bacteria 1204
92 Ga0157373_10220183 3300013100 Unclassified 1339
93 Ga0157373_10821346 3300013100 Bacteria 686
94 Ga0157373_11238404 3300013100 Unclassified 563
95 Ga0157371_11188968 3300013102 Bacteria 587
96 Ga0157370_10014156 3300013104 Bacteria 8179
97 Ga0157370_10033313 3300013104 Bacteria 5023
98 Ga0157370_10103091 3300013104 Bacteria 2671
99 Ga0157370_11256309 3300013104 Unclassified 668
100 Ga0157370_11895795 3300013104 Unclassified 535
101 Ga0157369_10003612 3300013105 Bacteria 18376
102 Ga0157369_10080356 3300013105 Bacteria 3491
103 Ga0157369_10091877 3300013105 Bacteria 3239
104 Ga0157369_10106006 3300013105 Bacteria 2991
105 Ga0157369_10208307 3300013105 Bacteria 2050
106 Ga0157369_10470582 3300013105 Archaea 1301
107 Ga0157369_10828419 3300013105 Unclassified 950
108 Ga0157374_10510228 3300013296 Bacteria 1208
109 Ga0157378_11862620 3300013297 Unclassified 650
110 Ga0163162_10113156 3300013306 Bacteria 2812
111 Ga0157372_10041853 3300013307 Bacteria 5065
112 Ga0157372_10171537 3300013307 Bacteria 2510
113 Ga0157372_10317187 3300013307 Unclassified 1815
114 Ga0157372_11685737 3300013307 Archaea 729
115 Ga0157375_10816674 3300013308 Bacteria 1080
116 Ga0163163_10466153 3300014325 Bacteria 1324
117 Ga0182008_10016646 3300014497 Bacteria 3819
118 Ga0182008_10094727 3300014497 Bacteria 1473
119 Ga0157377_10579864 3300014745 Unclassified 797
120 Ga0157379_10236095 3300014968 Unclassified 1658
121 Ga0157376_10011045 3300014969 Bacteria 6639
122 Ga0157376_10390598 3300014969 Unclassified 1343
123 Ga0157376_10545332 3300014969 Bacteria 1147
124 Ga0182006_1053155 3300015261 Bacteria 1554
125 Ga0182007_10015979 3300015262 Bacteria 2781
126 Ga0197907_10922662 3300020069 Bacteria 1032
127 Ga0206356_10555049 3300020070 Bacteria 6261
128 Ga0206356_11018159 3300020070 Archaea 614
129 Ga0206354_10931922 3300020081 Bacteria 2189
130 Ga0207692_10112462 3300025898 Unclassified 1512
131 Ga0207692_10352888 3300025898 Archaea 907
132 Ga0207710_10065176 3300025900 Bacteria 1660
133 Ga0207685_10083206 3300025905 Bacteria 1330
134 Ga0207699_10022920 3300025906 Archaea 3391
135 Ga0207699_10046159 3300025906 Bacteria 2546
136 Ga0207705_10017542 3300025909 Bacteria 5125
137 Ga0207705_10033212 3300025909 Bacteria 3686
138 Ga0207705_10145772 3300025909 Bacteria 1771
139 Ga0207707_10021329 3300025912 Bacteria 5663
140 Ga0207707_11002651 3300025912 Bacteria 685
141 Ga0207695_10113723 3300025913 Bacteria 2683
142 Ga0207695_11018663 3300025913 Archaea 708
143 Ga0207671_10037202 3300025914 Archaea 3610
144 Ga0207671_11193477 3300025914 Unclassified 595
145 Ga0207693_10001707 3300025915 Bacteria 19335
146 Ga0207693_10011495 3300025915 Bacteria 7161
147 Ga0207693_10438377 3300025915 Bacteria 1021
148 Ga0207663_10357479 3300025916 Unclassified 1107
149 Ga0207660_10014625 3300025917 Bacteria 5167
150 Ga0207660_10252329 3300025917 Bacteria 1393
151 Ga0207657_10003122 3300025919 Bacteria 17709
152 Ga0207657_10017269 3300025919 Bacteria 6927
153 Ga0207657_10037527 3300025919 Bacteria 4325
154 Ga0207649_10647045 3300025920 Bacteria 816
155 Ga0207652_10238177 3300025921 Bacteria 1640
156 Ga0207652_10494717 3300025921 Bacteria 1101
157 Ga0207652_11644827 3300025921 Unclassified 547
158 Ga0207646_10587166 3300025922 Bacteria 1000
159 Ga0207646_10592275 3300025922 Bacteria 996
160 Ga0207694_10353466 3300025924 Bacteria 1217
161 Ga0207687_10109897 3300025927 Bacteria 2043
162 Ga0207687_10627400 3300025927 Bacteria 908
163 Ga0207700_10043790 3300025928 Bacteria 3291
164 Ga0207700_10913642 3300025928 Bacteria 786
165 Ga0207700_11020297 3300025928 Bacteria 740
166 Ga0207664_10009176 3300025929 Bacteria 6932
167 Ga0207664_10012552 3300025929 Bacteria 6061
168 Ga0207664_10040599 3300025929 Bacteria 3620
169 Ga0207664_10041301 3300025929 Archaea 3592
170 Ga0207664_10081892 3300025929 Bacteria 2628
171 Ga0207664_10121958 3300025929 Bacteria 2183
172 Ga0207664_10304100 3300025929 Bacteria 1404
173 Ga0207664_10572047 3300025929 Bacteria 1014
174 Ga0207664_11348513 3300025929 Bacteria 633
175 Ga0207644_10265915 3300025931 Unclassified 1373
176 Ga0207709_10547211 3300025935 Bacteria 910
177 Ga0207665_10000359 3300025939 Bacteria 31672
178 Ga0207665_10226086 3300025939 Bacteria 1374
179 Ga0207711_10546164 3300025941 Bacteria 1081
180 Ga0207661_10283078 3300025944 Bacteria 1482
181 Ga0207679_10041300 3300025945 Bacteria 3307
182 Ga0207667_10325883 3300025949 Bacteria 1568
183 Ga0207667_10369298 3300025949 Unclassified 1462
184 Ga0207667_10374866 3300025949 Bacteria 1450
185 Ga0207667_10403488 3300025949 Bacteria 1392
186 Ga0207667_10411530 3300025949 Unclassified 1376
187 Ga0207712_10310649 3300025961 Bacteria 1297
188 Ga0207640_10576214 3300025981 Bacteria 949
189 Ga0207677_10283440 3300026023 Bacteria 1361
190 Ga0207639_11182321 3300026041 Bacteria 718
191 Ga0207702_10082274 3300026078 Bacteria 2799
192 Ga0207702_10181474 3300026078 Bacteria 1939
193 Ga0207702_10559244 3300026078 Unclassified 1120
194 Ga0207702_10777372 3300026078 Unclassified 946
195 Ga0207641_10267236 3300026088 Bacteria 1604
196 Ga0207676_10429652 3300026095 Bacteria 1241
197 Ga0207674_10109393 3300026116 Bacteria 2740
198 Ga0207683_10213792 3300026121 Unclassified 1755
199 Ga0207698_11027810 3300026142 Archaea 835
200 Ga0265327_10003744 3300031251 Bacteria 14140
201 Ga0265327_10149645 3300031251 Bacteria 1085
202 Ga0307409_100747724 3300031995 Bacteria 981
203 Ga0307414_11479435 3300032004 Bacteria 632
204 Ga0373944_0013395 3300035089 Bacteria 2274
205 Ga0373951_0118530 3300035091 Unclassified 718
206 Ga0373952_0077387 3300035092 Unclassified 843
207 Ga0373936_0058588 3300035113 Bacteria 1568
208 Ga0373945_0053323 3300035116 Bacteria 1492
209 Ga0373954_0166670 3300035118 Bacteria 1079
210 Ga0373943_0024384 3300035170 Unclassified 2819
211 Ga0373943_0202457 3300035170 Bacteria 1099
212 Ga0373943_0554473 3300035170 Unclassified 675
213 Ga0373946_0035830 3300035171 Bacteria 2009
214 Ga0373946_0202867 3300035171 Bacteria 951
215 Ga0373955_0212240 3300035172 Bacteria 1154
216 Ga0373962_0233450 3300035242 Unclassified 633
217 Ga0373924_0171361 3300035410 Bacteria 954
218 Ga0373931_0038067 3300035691 Bacteria 2514
219 Ga0373935_0085744 3300035692 Bacteria 2054
220 Ga0373935_0321928 3300035692 Bacteria 1097
221 Ga0373935_0524561 3300035692 Bacteria 862
222 Ga0373927_0143384 3300035695 Bacteria 1563
223 Ga0373947_0012051 3300035725 Bacteria 4951
224 Ga0373947_0123119 3300035725 Unclassified 1649
225 Ga0373947_0247185 3300035725 Bacteria 1179
226 Ga0373947_0466872 3300035725 Bacteria 856
227 Ga0373937_0194127 3300036401 Bacteria 1908
228 Ga0373937_1392805 3300036401 Unclassified 649
229 Ga0373937_1954251 3300036401 Bacteria 533
230 Ga0373925_0004988 3300037068 Bacteria 9968
231 Ga0395899_0053994 3300037312 Bacteria 2974
232 Ga0395899_0101431 3300037312 Bacteria 2077
233 Ga0395899_0339259 3300037312 Bacteria 1008
234 Ga0395900_0023098 3300037418 Bacteria 6365
235 Ga0395900_0547415 3300037418 Bacteria 1102
236 Ga0395900_0778857 3300037418 Bacteria 885
237 Ga0395900_0982172 3300037418 Bacteria 765
238 Ga0395900_1836595 3300037418 Unclassified 517
239 Ga0395898_0040888 3300037466 Bacteria 4582
240 Ga0395898_0050830 3300037466 Bacteria 4055
241 Ga0395898_0355273 3300037466 Bacteria 1397
242 Ga0395905_0139704 3300037471 Bacteria 2279
243 Ga0395905_0244628 3300037471 Bacteria 1676
244 Ga0395905_0480568 3300037471 Bacteria 1142
245 Ga0395901_0007588 3300038443 Bacteria 10957
246 Ga0395901_0058497 3300038443 Bacteria 4008
247 Ga0395901_0535062 3300038443 Unclassified 1189
248 Ga0395901_0773028 3300038443 Bacteria 952
249 Ga0439439_0160569 3300041406 Bacteria 641
250 Ga0451853_1830562 3300041512 Unclassified 629
251 Ga0439446_0005057 3300042156 Bacteria 3375
252 Ga0439434_0052622 3300042435 Bacteria 1264
253 Ga0466969_0327353 3300044656 Bacteria 693
254 Ga0466965_0049680 3300044683 Bacteria 2079
255 Ga0466965_0108780 3300044683 Bacteria 1423
256 Ga0466966_0194116 3300044684 Bacteria 1229
257 Ga0466961_0049112 3300044693 Bacteria 2697
258 Ga0466961_0342577 3300044693 Bacteria 910
259 Ga0466961_0612373 3300044693 Bacteria 654
260 Ga0466963_0001297 3300044694 Bacteria 13282
261 Ga0466963_0003091 3300044694 Bacteria 9437
262 Ga0466963_0004599 3300044694 Bacteria 8035
263 Ga0466963_0040268 3300044694 Bacteria 3062
264 Ga0466963_0047917 3300044694 Bacteria 2822
265 Ga0466963_0086995 3300044694 Bacteria 2124
266 Ga0466963_0090831 3300044694 Bacteria 2079
267 Ga0466963_0115981 3300044694 Bacteria 1841
268 Ga0466963_0206053 3300044694 Bacteria 1375
269 Ga0466963_0540819 3300044694 Bacteria 823
270 Ga0466964_0007533 3300044706 Bacteria 4073
271 Ga0466964_0009765 3300044706 Bacteria 3615
272 Ga0466964_0032548 3300044706 Bacteria 2073
273 Ga0466964_0033658 3300044706 Bacteria 2042
274 Ga0466964_0063836 3300044706 Bacteria 1539
275 Ga0466964_0085035 3300044706 Bacteria 1365
276 Ga0466964_0125170 3300044706 Bacteria 1164
277 Ga0466964_0126704 3300044706 Unclassified 1158
278 Ga0466964_0148505 3300044706 Bacteria 1084
279 Ga0466971_0003684 3300044719 Bacteria 6552
280 Ga0466971_0048454 3300044719 Bacteria 1910
281 Ga0466971_0056969 3300044719 Bacteria 1763
282 Ga0466971_0238708 3300044719 Unclassified 864
283 Ga0466971_0529878 3300044719 Bacteria 583
284 Ga0466968_0006616 3300044735 Bacteria 4375
285 Ga0466968_0006945 3300044735 Bacteria 4288
286 Ga0466968_0014165 3300044735 Bacteria 3148
287 Ga0466968_0065302 3300044735 Bacteria 1575
288 Ga0466968_0072939 3300044735 Bacteria 1497
289 Ga0466968_0100763 3300044735 Bacteria 1289
290 Ga0466968_0398452 3300044735 Unclassified 674
291 Ga0466970_0038365 3300044765 Bacteria 2541
292 Ga0466957_0006625 3300044842 Bacteria 6547
293 Ga0466957_0007304 3300044842 Bacteria 6243
294 Ga0466957_0030565 3300044842 Bacteria 3216
295 Ga0466957_0193830 3300044842 Bacteria 1332
296 Ga0466960_0005535 3300044901 Bacteria 5007
297 Ga0466960_0448252 3300044901 Unclassified 750
298 Ga0466959_0190129 3300045049 Bacteria 1433
299 Ga0466959_0215294 3300045049 Bacteria 1334
300 Ga0466959_0462955 3300045049 Bacteria 859
301 Ga0466959_0620802 3300045049 Bacteria 726
302 Ga0466958_0005267 3300045836 Bacteria 6933
303 Ga0466958_0022705 3300045836 Bacteria 3678
304 Ga0466958_0092308 3300045836 Bacteria 1874
305 Ga0466958_0239415 3300045836 Bacteria 1159
306 Ga0466958_0299704 3300045836 Bacteria 1032
307 Ga0466958_0337800 3300045836 Bacteria 969
308 Ga0466958_0542426 3300045836 Bacteria 755
309 Ga0466958_0605933 3300045836 Unclassified 712
310 Ga0466967_0009453 3300045976 Bacteria 7233
311 Ga0466967_0011239 3300045976 Bacteria 6766
312 Ga0466967_0021796 3300045976 Bacteria 5213
313 Ga0466967_0021971 3300045976 Bacteria 5195
314 Ga0466967_0029939 3300045976 Bacteria 4562
315 Ga0466967_0032549 3300045976 Bacteria 4403
316 Ga0466967_0035151 3300045976 Bacteria 4261
317 Ga0466967_0045747 3300045976 Bacteria 3805
318 Ga0466967_0058108 3300045976 Bacteria 3417
319 Ga0466967_0149311 3300045976 Bacteria 2183
320 Ga0466967_0160211 3300045976 Bacteria 2111
321 Ga0466967_0272586 3300045976 Bacteria 1622
322 Ga0466967_0303539 3300045976 Bacteria 1536
323 Ga0466967_0380930 3300045976 Unclassified 1369
324 Ga0466967_0413844 3300045976 Bacteria 1313
325 Ga0466967_0425032 3300045976 Bacteria 1295
326 Ga0466967_0488093 3300045976 Bacteria 1207
327 Ga0466967_0504683 3300045976 Bacteria 1187
328 Ga0466967_0505600 3300045976 Bacteria 1186
329 Ga0466967_0561939 3300045976 Bacteria 1123
330 Ga0466967_1131762 3300045976 Bacteria 780
331 Ga0495592_0005488 3300046454 Bacteria 9371
332 Ga0495592_0011072 3300046454 Bacteria 6809
333 Ga0495592_0260917 3300046454 Bacteria 1141
334 Ga0495603_0088596 3300046455 Bacteria 1811
335 Ga0495629_0007462 3300046459 Bacteria 8057
336 Ga0495629_0047802 3300046459 Bacteria 3001
337 Ga0495629_0267264 3300046459 Bacteria 1175
338 Ga0495629_0640376 3300046459 Bacteria 709
339 Ga0495629_1080034 3300046459 Bacteria 519
340 Ga0495641_0017824 3300046461 Bacteria 3686
341 Ga0495641_0035909 3300046461 Bacteria 2332
342 Ga0495641_0050037 3300046461 Bacteria 1911
343 Ga0495641_0060395 3300046461 Bacteria 1713
344 Ga0495641_0223936 3300046461 Bacteria 844
345 Ga0495641_0358690 3300046461 Bacteria 659
346 Ga0495651_0035851 3300046462 Bacteria 3861
347 Ga0495651_0354030 3300046462 Bacteria 969
348 Ga0495653_0011970 3300046463 Bacteria 7084
349 Ga0495653_0154697 3300046463 Bacteria 1598
350 Ga0495653_0194916 3300046463 Bacteria 1379
351 Ga0495653_0484321 3300046463 Bacteria 773
352 Ga0495653_0778308 3300046463 Bacteria 576
353 Ga0495580_0221294 3300046472 Bacteria 1301
354 Ga0495580_0508599 3300046472 Bacteria 803
355 Ga0495582_0006876 3300046473 Archaea 6322
356 Ga0495582_0037974 3300046473 Bacteria 2649
357 Ga0495582_0038635 3300046473 Bacteria 2627
358 Ga0495582_0087822 3300046473 Bacteria 1731
359 Ga0495639_0002130 3300046475 Bacteria 8726
360 Ga0495662_0003067 3300046476 Bacteria 8423
361 Ga0495662_0144968 3300046476 Bacteria 1169
362 Ga0495662_0541137 3300046476 Bacteria 570
363 Ga0495664_0011563 3300046477 Bacteria 4978
364 Ga0495664_0014362 3300046477 Bacteria 4488
365 Ga0495664_0088756 3300046477 Bacteria 1858
366 Ga0495664_0131167 3300046477 Bacteria 1517
367 Ga0495584_0021287 3300046491 Bacteria 3295
368 Ga0495585_0029947 3300046492 Bacteria 3097
369 Ga0495594_0217352 3300046499 Bacteria 1090
370 Ga0495594_0554215 3300046499 Unclassified 652
371 Ga0495607_0021962 3300046501 Bacteria 4013
372 Ga0495608_0003297 3300046511 Bacteria 11540
373 Ga0495608_0041985 3300046511 Bacteria 3058
374 Ga0495608_0111352 3300046511 Bacteria 1760
375 Ga0495618_0188558 3300046514 Bacteria 1308
376 Ga0495618_0233835 3300046514 Bacteria 1156
377 Ga0495618_0373207 3300046514 Bacteria 876
378 Ga0495628_0087989 3300046516 Bacteria 2407
379 Ga0495630_0017884 3300046517 Bacteria 5199
380 Ga0495630_0020061 3300046517 Bacteria 4923
381 Ga0495630_0097410 3300046517 Bacteria 2224
382 Ga0495630_0163203 3300046517 Bacteria 1696
383 Ga0495630_0180478 3300046517 Bacteria 1609
384 Ga0495630_0719826 3300046517 Archaea 763
385 Ga0495630_0853787 3300046517 Bacteria 694
386 Ga0495631_0301634 3300046518 Bacteria 682
387 Ga0495644_0016352 3300046523 Archaea 2839
388 Ga0495666_0002953 3300046526 Bacteria 8519
389 Ga0495666_0077440 3300046526 Bacteria 1576
390 Ga0495642_0134777 3300046528 Bacteria 1064
391 Ga0495652_0018236 3300046529 Bacteria 6261
392 Ga0495652_0076542 3300046529 Archaea 2775
393 Ga0495652_0157007 3300046529 Bacteria 1770
394 Ga0495652_0346571 3300046529 Bacteria 1065
395 Ga0495665_0007699 3300046531 Bacteria 5832
396 Ga0495665_0374645 3300046531 Bacteria 724
397 Ga0495640_0005377 3300046533 Bacteria 10188
398 Ga0495640_0110828 3300046533 Bacteria 1794
399 Ga0495640_0164193 3300046533 Bacteria 1421
400 Ga0495640_0316256 3300046533 Bacteria 967
401 Ga0495586_0008736 3300046535 Bacteria 5393
402 Ga0495586_0011589 3300046535 Bacteria 4692
403 Ga0495586_0016899 3300046535 Bacteria 3881
404 Ga0495586_0019143 3300046535 Bacteria 3642
405 Ga0495586_0195936 3300046535 Bacteria 1144
406 Ga0495586_0342176 3300046535 Bacteria 859
407 Ga0495587_0021469 3300046536 Bacteria 3982
408 Ga0495587_0108659 3300046536 Bacteria 1594
409 Ga0495598_0333688 3300046537 Bacteria 580
410 Ga0495621_0180533 3300046539 Bacteria 842
411 Ga0495645_0010720 3300046543 Bacteria 6437
412 Ga0495645_0020500 3300046543 Bacteria 4771
413 Ga0495645_0116887 3300046543 Bacteria 1882
414 Ga0495667_0065416 3300046559 Bacteria 2378
415 Ga0495667_0476032 3300046559 Bacteria 783
416 Ga0495656_0005025 3300046615 Bacteria 4556
417 Ga0495668_0064887 3300046616 Bacteria 2010
418 Ga0495634_0007256 3300046642 Bacteria 8353
419 Ga0495634_0080250 3300046642 Bacteria 2135
420 Ga0495634_0245587 3300046642 Bacteria 1096
421 Ga0495634_0308699 3300046642 Bacteria 955
422 Ga0495634_0519599 3300046642 Bacteria 696
423 Ga0495635_0020313 3300046663 Bacteria 4628
424 Ga0495635_0027689 3300046663 Bacteria 3941
425 Ga0495635_0054871 3300046663 Bacteria 2744
426 Ga0495635_0060084 3300046663 Bacteria 2613
427 Ga0495635_0458520 3300046663 Bacteria 842
428 Ga0495635_0869162 3300046663 Bacteria 578
429 Ga0495659_0030357 3300046664 Bacteria 1881
430 Ga0495661_0157939 3300046665 Unclassified 1220
431 Ga0495588_0735472 3300046674 Bacteria 516
432 Ga0495657_0019689 3300046675 Bacteria 4865
433 Ga0495657_0038452 3300046675 Bacteria 3293
434 Ga0495657_0147493 3300046675 Bacteria 1463
435 Ga0495657_0294105 3300046675 Bacteria 969
436 Ga0495599_0004995 3300046678 Bacteria 7890
437 Ga0495599_0009444 3300046678 Bacteria 5963
438 Ga0495599_0061519 3300046678 Bacteria 2346
439 Ga0495599_0540197 3300046678 Bacteria 683
440 Ga0495623_0008557 3300046679 Bacteria 6645
441 Ga0495646_0065453 3300046680 Bacteria 2152
442 Ga0495646_0308720 3300046680 Bacteria 835
443 Ga0495647_0000373 3300046681 Bacteria 12661
444 Ga0495647_0257317 3300046681 Unclassified 778
445 Ga0495647_0558867 3300046681 Bacteria 535
446 Ga0495658_0027177 3300046683 Bacteria 3075
447 Ga0495658_0049640 3300046683 Bacteria 2371
448 Ga0495658_0066628 3300046683 Bacteria 2080
449 Ga0495658_0551059 3300046683 Bacteria 738
450 Ga0495613_0001141 3300046689 Bacteria 20239
451 Ga0495613_0061267 3300046689 Bacteria 2755
452 Ga0495613_0089607 3300046689 Bacteria 2228
453 Ga0495613_0204788 3300046689 Bacteria 1390
454 Ga0495613_0691972 3300046689 Bacteria 672
455 Ga0495624_0011331 3300046690 Bacteria 6128
456 Ga0495624_0014449 3300046690 Bacteria 5356
457 Ga0495624_0015890 3300046690 Bacteria 5070
458 Ga0495624_0060813 3300046690 Bacteria 2368
459 Ga0495624_0890978 3300046690 Unclassified 524
460 Ga0495589_0141569 3300046794 Bacteria 1151
461 Ga0495600_0013238 3300046809 Bacteria 5178
462 Ga0495600_0141267 3300046809 Bacteria 1562
463 Ga0495600_0177960 3300046809 Bacteria 1371
464 Ga0495600_0196042 3300046809 Bacteria 1298
465 Ga0495600_0294987 3300046809 Bacteria 1024
466 Ga0495581_0003607 3300047315 Bacteria 8910
467 Ga0495581_0013081 3300047315 Bacteria 4811
468 Ga0495581_0156404 3300047315 Bacteria 1332
469 Ga0495581_0306017 3300047315 Bacteria 929
470 Ga0495581_0702789 3300047315 Bacteria 583
471 Ga0495604_0191574 3300047317 Bacteria 1424
472 Ga0495604_0202927 3300047317 Bacteria 1374
473 Ga0495674_0019490 3300047319 Bacteria 6294
474 Ga0495674_0031686 3300047319 Bacteria 4800
475 Ga0495674_0043407 3300047319 Bacteria 4002
476 Ga0495674_0052220 3300047319 Bacteria 3598
477 Ga0495674_0294103 3300047319 Bacteria 1327
478 Ga0495676_0070435 3300047321 Bacteria 2693
479 Ga0495676_0309549 3300047321 Bacteria 1063
480 Ga0495676_0517946 3300047321 Bacteria 782
481 Ga0495676_0718525 3300047321 Bacteria 646
482 Ga0495676_0890549 3300047321 Bacteria 570
483 Ga0495680_0048863 3300047322 Archaea 3319
484 Ga0495680_0063608 3300047322 Bacteria 2833
485 Ga0495680_0067235 3300047322 Bacteria 2740
486 Ga0495680_0368721 3300047322 Bacteria 997
487 Ga0495675_0130270 3300047444 Bacteria 1564
488 Ga0495677_0031153 3300047445 Bacteria 1941
489 Ga0495685_046141 3300047447 Bacteria 1483
490 Ga0495684_0004825 3300047471 Bacteria 10522
491 Ga0495684_0024046 3300047471 Archaea 4687
492 Ga0495684_0036890 3300047471 Bacteria 3747
493 Ga0495684_0075567 3300047471 Bacteria 2559
494 Ga0495684_0181563 3300047471 Bacteria 1559
495 Ga0495593_0005681 3300047673 Bacteria 7359
496 Ga0495593_0458702 3300047673 Bacteria 638
497 Ga0495602_0038366 3300048088 Bacteria 4430
498 Ga0495602_0110712 3300048088 Bacteria 2231
499 Ga0495602_0539677 3300048088 Bacteria 810
500 Ga0495614_0003371 3300048089 Bacteria 7141
501 Ga0495614_0507971 3300048089 Unclassified 574
502 Ga0496100_0050526 3300048903 Bacteria 2694
503 Ga0496100_0092921 3300048903 Bacteria 2063
504 Ga0496100_0098783 3300048903 Bacteria 2007
505 Ga0496100_0405684 3300048903 Bacteria 1039
506 Ga0496100_0440033 3300048903 Bacteria 998
507 Ga0496101_0058602 3300048904 Bacteria 2789
508 Ga0496101_0145543 3300048904 Bacteria 1809
509 Ga0496101_0349605 3300048904 Bacteria 1162
510 Ga0496101_0394037 3300048904 Bacteria 1090
511 Ga0496101_0525943 3300048904 Unclassified 935
512 Ga0496101_0591618 3300048904 Bacteria 877
513 Ga0496101_0625399 3300048904 Bacteria 851
514 Ga0496102_0066819 3300048905 Bacteria 3296
515 Ga0496102_0227818 3300048905 Bacteria 1757
516 Ga0496102_0381191 3300048905 Bacteria 1327
517 Ga0496102_1806211 3300048905 Archaea 528
518 Ga0496103_0019511 3300048906 Archaea 4071
519 Ga0496103_0034640 3300048906 Bacteria 3089
520 Ga0496103_0642500 3300048906 Unclassified 675
521 Ga0496104_0096019 3300048907 Bacteria 2836
522 Ga0496104_0373432 3300048907 Bacteria 1338
523 Ga0496104_0379010 3300048907 Bacteria 1327
524 Ga0496105_0007590 3300048908 Bacteria 8406
525 Ga0496105_0110415 3300048908 Bacteria 2270
526 Ga0496105_0116265 3300048908 Bacteria 2206
527 Ga0496105_0202260 3300048908 Bacteria 1621
528 Ga0496105_0362660 3300048908 Bacteria 1156
529 Ga0496105_1046072 3300048908 Archaea 608
530 Ga0496106_0029233 3300048909 Bacteria 4106
531 Ga0496106_0069672 3300048909 Bacteria 2685
532 Ga0496107_0035216 3300048910 Bacteria 3588
533 Ga0496107_0167674 3300048910 Bacteria 1629
534 Ga0496107_0192048 3300048910 Bacteria 1517
535 Ga0496108_0039446 3300048911 Bacteria 3936
536 Ga0496108_0069555 3300048911 Bacteria 2970
537 Ga0496108_0081514 3300048911 Bacteria 2742
538 Ga0496108_0253693 3300048911 Bacteria 1530
539 Ga0496108_1201907 3300048911 Unclassified 641
540 Ga0496109_0009017 3300048912 Bacteria 8497
541 Ga0496109_0070370 3300048912 Bacteria 3210
542 Ga0496109_0078936 3300048912 Bacteria 3031
543 Ga0496109_0623958 3300048912 Unclassified 1014
544 Ga0496109_0665893 3300048912 Bacteria 978
545 Ga0496110_0044659 3300048913 Bacteria 3870
546 Ga0496110_0044891 3300048913 Bacteria 3860
547 Ga0496110_0156152 3300048913 Bacteria 2067
548 Ga0496110_0284168 3300048913 Bacteria 1507
549 Ga0496110_0498287 3300048913 Unclassified 1109
550 Ga0496111_0006168 3300048914 Bacteria 7760
551 Ga0496111_0027581 3300048914 Bacteria 4019
552 Ga0496111_0145688 3300048914 Bacteria 1756
553 Ga0496111_0242738 3300048914 Bacteria 1337
554 Ga0496112_0128751 3300048915 Bacteria 2502
555 Ga0496112_0136419 3300048915 Bacteria 2423
556 Ga0496112_0164407 3300048915 Bacteria 2185
557 Ga0496112_0277755 3300048915 Bacteria 1623
558 Ga0496112_0783775 3300048915 Unclassified 878
559 Ga0496113_0094452 3300048916 Bacteria 2310
560 Ga0496113_0395517 3300048916 Bacteria 1109
561 Ga0496113_0514740 3300048916 Bacteria 961
562 Ga0496113_0529346 3300048916 Bacteria 946
563 Ga0496113_0745180 3300048916 Bacteria 780
564 Ga0496113_1051166 3300048916 Unclassified 640
565 Ga0496114_0050046 3300048917 Bacteria 3477
566 Ga0496114_0051836 3300048917 Bacteria 3417
567 Ga0496114_0083518 3300048917 Bacteria 2702
568 Ga0496114_0125052 3300048917 Bacteria 2216
569 Ga0496114_0457409 3300048917 Bacteria 1130
570 Ga0496115_0026779 3300048918 Bacteria 4504
571 Ga0496115_0055972 3300048918 Bacteria 3169
572 Ga0496115_0058769 3300048918 Bacteria 3095
573 Ga0496115_0109022 3300048918 Bacteria 2273
574 Ga0496115_1358445 3300048918 Unclassified 526
575 Ga0501067_0037582 3300049583 Unclassified 2689
576 Ga0501067_0077777 3300049583 Bacteria 1838
577 Ga0501069_0030304 3300049585 Bacteria 2971
578 Ga0501069_0072769 3300049585 Bacteria 1927
579 Ga0501074_0763432 3300049590 Bacteria 682
580 nmdc:mga08y16_127362_c2 3300050511 Bacteria 1754
581 nmdc:mga0a205_198998_c1 3300050515 Bacteria 1894
582 Ga0495601_0086481 3300053077 Bacteria 2014
583 Ga0495601_0163724 3300053077 Bacteria 1453
584 Ga0495601_0424356 3300053077 Bacteria 861
585 Ga0495601_0425794 3300053077 Bacteria 859
586 Ga0495612_0056294 3300053078 Bacteria 1622
587 Ga0495612_0073936 3300053078 Bacteria 1424
588 Ga0495612_0150839 3300053078 Bacteria 1011
589 Ga0495595_0009556 3300053084 Unclassified 4016
590 Ga0495595_0013060 3300053084 Bacteria 3504
591 Ga0495595_0154513 3300053084 Bacteria 1130
592 Ga0495595_0374940 3300053084 Bacteria 720
593 Ga0495595_0498696 3300053084 Unclassified 620
594 Ga0495619_0039767 3300053085 Bacteria 3071
595 Ga0495619_0071974 3300053085 Bacteria 2314
596 Ga0495619_0123207 3300053085 Bacteria 1778
597 Ga0495619_0146160 3300053085 Bacteria 1630
598 Ga0495619_0258783 3300053085 Bacteria 1206
599 Ga0495619_0513697 3300053085 Bacteria 823
600 Ga0500566_0156752 3300053094 Bacteria 1191
601 Ga0500566_0329768 3300053094 Bacteria 707
602 Ga0500657_173548 3300053728 Bacteria 760
603 Ga0501084_0829823 3300054114 Bacteria 778
604 Ga0501082_0716376 3300060353 Bacteria 876
605 Ga0466962_0001681 3300061719 Bacteria 10380
606 Ga0466962_0031410 3300061719 Bacteria 2543
607 Ga0466962_0068401 3300061719 Bacteria 1696
608 Ga0466962_0110811 3300061719 Bacteria 1321
609 Ga0466962_0143689 3300061719 Bacteria 1156
610 Ga0466962_0415568 3300061719 Bacteria 675
611 Ga0530510_0099543 3300061734 Bacteria 2126
612 Ga0495629_0112048
613 Ga0070658_10014304
614 Ga0070658_10524216
615 Ga0070683_100155761
616 Ga0070680_100015767
617 Ga0070680_100108730
618 Ga0070680_100342970
619 Ga0070682_100049476
620 Ga0068868_100193541
621 Ga0068868_102133850
622 Ga0070660_100004010
623 Ga0070660_100616883
624 Ga0070661_100080662
625 Ga0070661_100445262
626 Ga0070671_100152865
627 Ga0070659_100315245
628 Ga0070659_100446233
629 Ga0070709_10122443
630 Ga0070709_10260118
631 Ga0070714_100004472
632 Ga0070714_100021145
633 Ga0070714_100025096
634 Ga0070714_100049468
635 Ga0070714_100085391
636 Ga0070714_100096400
637 Ga0070714_100301114
638 Ga0070714_100464355
639 Ga0070714_101507707
640 Ga0070713_100070946
641 Ga0070713_100074903
642 Ga0070713_101161972
643 Ga0070710_10004780
644 Ga0070710_10049156
645 Ga0070710_10084418
646 Ga0070678_101643697
647 Ga0070681_10028662
648 Ga0070681_10337503
649 Ga0070707_100432906
650 Ga0070679_100040029
651 Ga0070679_100292030
652 Ga0070679_100373598
653 Ga0070684_100060703
654 Ga0070684_100062092
655 Ga0070684_100064232
656 Ga0070695_100000209
657 Ga0070693_100614042
658 Ga0070693_101089355
659 Ga0070704_100074586
660 Ga0068855_100003360
661 Ga0068855_100046068
662 Ga0068855_100074314
663 Ga0068855_100500241
664 Ga0070664_100116865
665 Ga0070664_100893262
666 Ga0068854_100738357
667 Ga0068856_100021002
668 Ga0068856_100181401
669 Ga0070702_100107017
670 Ga0068852_100343541
671 Ga0068852_100666338
672 Ga0068863_100159153
673 Ga0068863_100833490
674 Ga0068858_101653707
675 Ga0070717_10005447
676 Ga0070717_10071120
677 Ga0070717_10186749
678 Ga0070717_10259440
679 Ga0070717_10984636
680 Ga0070715_10004505
681 Ga0070716_100010808
682 Ga0070712_100197508
683 Ga0070712_100225462
684 Ga0075433_10063490
685 Ga0075434_100003661
686 Ga0105240_10045671
687 Ga0105240_10125870
688 Ga0105240_10347756
689 Ga0111539_10492799
690 Ga0105245_10073532
691 Ga0105245_11258430
692 Ga0105247_10116298
693 Ga0105241_11047555
694 Ga0105248_10161088
695 Ga0105237_10057657
696 Ga0105237_11671447
697 Ga0105237_12490976
698 Ga0105238_10292280
699 Ga0105238_10514425
700 Ga0105249_11357221
701 Ga0105239_10374628
702 Ga0105239_10650335
703 Ga0157373_10220183
704 Ga0157373_10821346
705 Ga0157373_11238404
706 Ga0157371_11188968
707 Ga0157370_10014156
708 Ga0157370_10033313
709 Ga0157370_10103091
710 Ga0157370_11256309
711 Ga0157370_11895795
712 Ga0157369_10003612
713 Ga0157369_10080356
714 Ga0157369_10091877
715 Ga0157369_10106006
716 Ga0157369_10208307
717 Ga0157369_10470582
718 Ga0157369_10828419
719 Ga0157374_10510228
720 Ga0157378_11862620
721 Ga0163162_10113156
722 Ga0157372_10041853
723 Ga0157372_10171537
724 Ga0157372_10317187
725 Ga0157372_11685737
726 Ga0157375_10816674
727 Ga0163163_10466153
728 Ga0182008_10016646
729 Ga0182008_10094727
730 Ga0157377_10579864
731 Ga0157379_10236095
732 Ga0157376_10011045
733 Ga0157376_10390598
734 Ga0157376_10545332
735 Ga0182006_1053155
736 Ga0182007_10015979
737 Ga0197907_10922662
738 Ga0206356_10555049
739 Ga0206356_11018159
740 Ga0206354_10931922
741 Ga0207692_10112462
742 Ga0207692_10352888
743 Ga0207710_10065176
744 Ga0207685_10083206
745 Ga0207699_10022920
746 Ga0207699_10046159
747 Ga0207705_10017542
748 Ga0207705_10033212
749 Ga0207705_10145772
750 Ga0207707_10021329
751 Ga0207707_11002651
752 Ga0207695_10113723
753 Ga0207695_11018663
754 Ga0207671_10037202
755 Ga0207671_11193477
756 Ga0207693_10001707
757 Ga0207693_10011495
758 Ga0207693_10438377
759 Ga0207663_10357479
760 Ga0207660_10014625
761 Ga0207660_10252329
762 Ga0207657_10003122
763 Ga0207657_10017269
764 Ga0207657_10037527
765 Ga0207649_10647045
766 Ga0207652_10238177
767 Ga0207652_10494717
768 Ga0207652_11644827
769 Ga0207646_10587166
770 Ga0207646_10592275
771 Ga0207694_10353466
772 Ga0207687_10109897
773 Ga0207687_10627400
774 Ga0207700_10043790
775 Ga0207700_10913642
776 Ga0207700_11020297
777 Ga0207664_10009176
778 Ga0207664_10012552
779 Ga0207664_10040599
780 Ga0207664_10041301
781 Ga0207664_10081892
782 Ga0207664_10121958
783 Ga0207664_10304100
784 Ga0207664_10572047
785 Ga0207664_11348513
786 Ga0207644_10265915
787 Ga0207709_10547211
788 Ga0207665_10000359
789 Ga0207665_10226086
790 Ga0207711_10546164
791 Ga0207661_10283078
792 Ga0207679_10041300
793 Ga0207667_10325883
794 Ga0207667_10369298
795 Ga0207667_10374866
796 Ga0207667_10403488
797 Ga0207667_10411530
798 Ga0207712_10310649
799 Ga0207640_10576214
800 Ga0207677_10283440
801 Ga0207639_11182321
802 Ga0207702_10082274
803 Ga0207702_10181474
804 Ga0207702_10559244
805 Ga0207702_10777372
806 Ga0207641_10267236
807 Ga0207676_10429652
808 Ga0207674_10109393
809 Ga0207683_10213792
810 Ga0207698_11027810
811 Ga0265327_10003744
812 Ga0265327_10149645
813 Ga0307409_100747724
814 Ga0307414_11479435
815 Ga0373944_0013395
816 Ga0373951_0118530
817 Ga0373952_0077387
818 Ga0373936_0058588
819 Ga0373945_0053323
820 Ga0373954_0166670
821 Ga0373943_0024384
822 Ga0373943_0202457
823 Ga0373943_0554473
824 Ga0373946_0035830
825 Ga0373946_0202867
826 Ga0373955_0212240
827 Ga0373962_0233450
828 Ga0373924_0171361
829 Ga0373931_0038067
830 Ga0373935_0085744
831 Ga0373935_0321928
832 Ga0373935_0524561
833 Ga0373927_0143384
834 Ga0373947_0012051
835 Ga0373947_0123119
836 Ga0373947_0247185
837 Ga0373947_0466872
838 Ga0373937_0194127
839 Ga0373937_1392805
840 Ga0373937_1954251
841 Ga0373925_0004988
842 Ga0395899_0053994
843 Ga0395899_0101431
844 Ga0395899_0339259
845 Ga0395900_0023098
846 Ga0395900_0547415
847 Ga0395900_0778857
848 Ga0395900_0982172
849 Ga0395900_1836595
850 Ga0395898_0040888
851 Ga0395898_0050830
852 Ga0395898_0355273
853 Ga0395905_0139704
854 Ga0395905_0244628
855 Ga0395905_0480568
856 Ga0395901_0007588
857 Ga0395901_0058497
858 Ga0395901_0535062
859 Ga0395901_0773028
860 Ga0439439_0160569
861 Ga0451853_1830562
862 Ga0439446_0005057
863 Ga0439434_0052622
864 Ga0466969_0327353
865 Ga0466965_0049680
866 Ga0466965_0108780
867 Ga0466966_0194116
868 Ga0466961_0049112
869 Ga0466961_0342577
870 Ga0466961_0612373
871 Ga0466963_0001297
872 Ga0466963_0003091
873 Ga0466963_0004599
874 Ga0466963_0040268
875 Ga0466963_0047917
876 Ga0466963_0086995
877 Ga0466963_0090831
878 Ga0466963_0115981
879 Ga0466963_0206053
880 Ga0466963_0540819
881 Ga0466964_0007533
882 Ga0466964_0009765
883 Ga0466964_0032548
884 Ga0466964_0033658
885 Ga0466964_0063836
886 Ga0466964_0085035
887 Ga0466964_0125170
888 Ga0466964_0126704
889 Ga0466964_0148505
890 Ga0466971_0003684
891 Ga0466971_0048454
892 Ga0466971_0056969
893 Ga0466971_0238708
894 Ga0466971_0529878
895 Ga0466968_0006616
896 Ga0466968_0006945
897 Ga0466968_0014165
898 Ga0466968_0065302
899 Ga0466968_0072939
900 Ga0466968_0100763
901 Ga0466968_0398452
902 Ga0466970_0038365
903 Ga0466957_0006625
904 Ga0466957_0007304
905 Ga0466957_0030565
906 Ga0466957_0193830
907 Ga0466960_0005535
908 Ga0466960_0448252
909 Ga0466959_0190129
910 Ga0466959_0215294
911 Ga0466959_0462955
912 Ga0466959_0620802
913 Ga0466958_0005267
914 Ga0466958_0022705
915 Ga0466958_0092308
916 Ga0466958_0239415
917 Ga0466958_0299704
918 Ga0466958_0337800
919 Ga0466958_0542426
920 Ga0466958_0605933
921 Ga0466967_0009453
922 Ga0466967_0011239
923 Ga0466967_0021796
924 Ga0466967_0021971
925 Ga0466967_0029939
926 Ga0466967_0032549
927 Ga0466967_0035151
928 Ga0466967_0045747
929 Ga0466967_0058108
930 Ga0466967_0149311
931 Ga0466967_0160211
932 Ga0466967_0272586
933 Ga0466967_0303539
934 Ga0466967_0380930
935 Ga0466967_0413844
936 Ga0466967_0425032
937 Ga0466967_0488093
938 Ga0466967_0504683
939 Ga0466967_0505600
940 Ga0466967_0561939
941 Ga0466967_1131762
942 Ga0495592_0005488
943 Ga0495592_0011072
944 Ga0495592_0260917
945 Ga0495603_0088596
946 Ga0495629_0007462
947 Ga0495629_0047802
948 Ga0495629_0267264
949 Ga0495629_0640376
950 Ga0495629_1080034
951 Ga0495641_0017824
952 Ga0495641_0035909
953 Ga0495641_0050037
954 Ga0495641_0060395
955 Ga0495641_0223936
956 Ga0495641_0358690
957 Ga0495651_0035851
958 Ga0495651_0354030
959 Ga0495653_0011970
960 Ga0495653_0154697
961 Ga0495653_0194916
962 Ga0495653_0484321
963 Ga0495653_0778308
964 Ga0495580_0221294
965 Ga0495580_0508599
966 Ga0495582_0006876
967 Ga0495582_0037974
968 Ga0495582_0038635
969 Ga0495582_0087822
970 Ga0495639_0002130
971 Ga0495662_0003067
972 Ga0495662_0144968
973 Ga0495662_0541137
974 Ga0495664_0011563
975 Ga0495664_0014362
976 Ga0495664_0088756
977 Ga0495664_0131167
978 Ga0495584_0021287
979 Ga0495585_0029947
980 Ga0495594_0217352
981 Ga0495594_0554215
982 Ga0495607_0021962
983 Ga0495608_0003297
984 Ga0495608_0041985
985 Ga0495608_0111352
986 Ga0495618_0188558
987 Ga0495618_0233835
988 Ga0495618_0373207
989 Ga0495628_0087989
990 Ga0495630_0017884
991 Ga0495630_0020061
992 Ga0495630_0097410
993 Ga0495630_0163203
994 Ga0495630_0180478
995 Ga0495630_0719826
996 Ga0495630_0853787
997 Ga0495631_0301634
998 Ga0495644_0016352
999 Ga0495666_0002953
1000 Ga0495666_0077440
1001 Ga0495642_0134777
1002 Ga0495652_0018236
1003 Ga0495652_0076542
1004 Ga0495652_0157007
1005 Ga0495652_0346571
1006 Ga0495665_0007699
1007 Ga0495665_0374645
1008 Ga0495640_0005377
1009 Ga0495640_0110828
1010 Ga0495640_0164193
1011 Ga0495640_0316256
1012 Ga0495586_0008736
1013 Ga0495586_0011589
1014 Ga0495586_0016899
1015 Ga0495586_0019143
1016 Ga0495586_0195936
1017 Ga0495586_0342176
1018 Ga0495587_0021469
1019 Ga0495587_0108659
1020 Ga0495598_0333688
1021 Ga0495621_0180533
1022 Ga0495645_0010720
1023 Ga0495645_0020500
1024 Ga0495645_0116887
1025 Ga0495667_0065416
1026 Ga0495667_0476032
1027 Ga0495656_0005025
1028 Ga0495668_0064887
1029 Ga0495634_0007256
1030 Ga0495634_0080250
1031 Ga0495634_0245587
1032 Ga0495634_0308699
1033 Ga0495634_0519599
1034 Ga0495635_0020313
1035 Ga0495635_0027689
1036 Ga0495635_0054871
1037 Ga0495635_0060084
1038 Ga0495635_0458520
1039 Ga0495635_0869162
1040 Ga0495659_0030357
1041 Ga0495661_0157939
1042 Ga0495588_0735472
1043 Ga0495657_0019689
1044 Ga0495657_0038452
1045 Ga0495657_0147493
1046 Ga0495657_0294105
1047 Ga0495599_0004995
1048 Ga0495599_0009444
1049 Ga0495599_0061519
1050 Ga0495599_0540197
1051 Ga0495623_0008557
1052 Ga0495646_0065453
1053 Ga0495646_0308720
1054 Ga0495647_0000373
1055 Ga0495647_0257317
1056 Ga0495647_0558867
1057 Ga0495658_0027177
1058 Ga0495658_0049640
1059 Ga0495658_0066628
1060 Ga0495658_0551059
1061 Ga0495613_0001141
1062 Ga0495613_0061267
1063 Ga0495613_0089607
1064 Ga0495613_0204788
1065 Ga0495613_0691972
1066 Ga0495624_0011331
1067 Ga0495624_0014449
1068 Ga0495624_0015890
1069 Ga0495624_0060813
1070 Ga0495624_0890978
1071 Ga0495589_0141569
1072 Ga0495600_0013238
1073 Ga0495600_0141267
1074 Ga0495600_0177960
1075 Ga0495600_0196042
1076 Ga0495600_0294987
1077 Ga0495581_0003607
1078 Ga0495581_0013081
1079 Ga0495581_0156404
1080 Ga0495581_0306017
1081 Ga0495581_0702789
1082 Ga0495604_0191574
1083 Ga0495604_0202927
1084 Ga0495674_0019490
1085 Ga0495674_0031686
1086 Ga0495674_0043407
1087 Ga0495674_0052220
1088 Ga0495674_0294103
1089 Ga0495676_0070435
1090 Ga0495676_0309549
1091 Ga0495676_0517946
1092 Ga0495676_0718525
1093 Ga0495676_0890549
1094 Ga0495680_0048863
1095 Ga0495680_0063608
1096 Ga0495680_0067235
1097 Ga0495680_0368721
1098 Ga0495675_0130270
1099 Ga0495677_0031153
1100 Ga0495685_046141
1101 Ga0495684_0004825
1102 Ga0495684_0024046
1103 Ga0495684_0036890
1104 Ga0495684_0075567
1105 Ga0495684_0181563
1106 Ga0495593_0005681
1107 Ga0495593_0458702
1108 Ga0495602_0038366
1109 Ga0495602_0110712
1110 Ga0495602_0539677
1111 Ga0495614_0003371
1112 Ga0495614_0507971
1113 Ga0496100_0050526
1114 Ga0496100_0092921
1115 Ga0496100_0098783
1116 Ga0496100_0405684
1117 Ga0496100_0440033
1118 Ga0496101_0058602
1119 Ga0496101_0145543
1120 Ga0496101_0349605
1121 Ga0496101_0394037
1122 Ga0496101_0525943
1123 Ga0496101_0591618
1124 Ga0496101_0625399
1125 Ga0496102_0066819
1126 Ga0496102_0227818
1127 Ga0496102_0381191
1128 Ga0496102_1806211
1129 Ga0496103_0019511
1130 Ga0496103_0034640
1131 Ga0496103_0642500
1132 Ga0496104_0096019
1133 Ga0496104_0373432
1134 Ga0496104_0379010
1135 Ga0496105_0007590
1136 Ga0496105_0110415
1137 Ga0496105_0116265
1138 Ga0496105_0202260
1139 Ga0496105_0362660
1140 Ga0496105_1046072
1141 Ga0496106_0029233
1142 Ga0496106_0069672
1143 Ga0496107_0035216
1144 Ga0496107_0167674
1145 Ga0496107_0192048
1146 Ga0496108_0039446
1147 Ga0496108_0069555
1148 Ga0496108_0081514
1149 Ga0496108_0253693
1150 Ga0496108_1201907
1151 Ga0496109_0009017
1152 Ga0496109_0070370
1153 Ga0496109_0078936
1154 Ga0496109_0623958
1155 Ga0496109_0665893
1156 Ga0496110_0044659
1157 Ga0496110_0044891
1158 Ga0496110_0156152
1159 Ga0496110_0284168
1160 Ga0496110_0498287
1161 Ga0496111_0006168
1162 Ga0496111_0027581
1163 Ga0496111_0145688
1164 Ga0496111_0242738
1165 Ga0496112_0128751
1166 Ga0496112_0136419
1167 Ga0496112_0164407
1168 Ga0496112_0277755
1169 Ga0496112_0783775
1170 Ga0496113_0094452
1171 Ga0496113_0395517
1172 Ga0496113_0514740
1173 Ga0496113_0529346
1174 Ga0496113_0745180
1175 Ga0496113_1051166
1176 Ga0496114_0050046
1177 Ga0496114_0051836
1178 Ga0496114_0083518
1179 Ga0496114_0125052
1180 Ga0496114_0457409
1181 Ga0496115_0026779
1182 Ga0496115_0055972
1183 Ga0496115_0058769
1184 Ga0496115_0109022
1185 Ga0496115_1358445
1186 Ga0501067_0037582
1187 Ga0501067_0077777
1188 Ga0501069_0030304
1189 Ga0501069_0072769
1190 Ga0501074_0763432
1191 nmdc:mga08y16_127362_c2
1192 nmdc:mga0a205_198998_c1
1193 Ga0495601_0086481
1194 Ga0495601_0163724
1195 Ga0495601_0424356
1196 Ga0495601_0425794
1197 Ga0495612_0056294
1198 Ga0495612_0073936
1199 Ga0495612_0150839
1200 Ga0495595_0009556
1201 Ga0495595_0013060
1202 Ga0495595_0154513
1203 Ga0495595_0374940
1204 Ga0495595_0498696
1205 Ga0495619_0039767
1206 Ga0495619_0071974
1207 Ga0495619_0123207
1208 Ga0495619_0146160
1209 Ga0495619_0258783
1210 Ga0495619_0513697
1211 Ga0500566_0156752
1212 Ga0500566_0329768
1213 Ga0500657_173548
1214 Ga0501084_0829823
1215 Ga0501082_0716376
1216 Ga0466962_0001681
1217 Ga0466962_0031410
1218 Ga0466962_0068401
1219 Ga0466962_0110811
1220 Ga0466962_0143689
1221 Ga0466962_0415568
1222 Ga0530510_0099543

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

24

121

0.95

PF13474

SnoaL_3

SnoaL-like domain

20

105

0.91

PF07366

SnoaL

SnoaL-like polyketide cyclase

21

125

0.89

PF13577

SnoaL_4

SnoaL-like domain

12

111

0.87

PF14534

DUF4440

Domain of unknown function (DUF4440)

20

122

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lmi-assembly1.cif.gz_A crystal structure of putative ketosteroid isomerase from kribbella flavida dsm 17836 0.9217 4 110
4u13-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution 0.9077 5 107
6uae-assembly4.cif.gz_D ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.9068 5 113
3en8-assembly1.cif.gz_A-2 crystal structure of ntf-2 like protein of unknown function (yp_553245.1) from burkholderia xenovorans lb400 at 1.85 a resolution 0.9004 4 109
3f40-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution 0.8977 4 111
ID Description Score Start End Superfamily
4lmiA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9217 4 110 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9074 5 107 3.10.450.50
5aigB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8948 1 107 3.10.450.50
5tgnA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8918 1 108 3.10.450.50
af_B4FV63_52_171_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8863 2 97 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A538IKB4-F1-model_v4 Nuclear transport factor 2 family protein 1.003 1 116
AF-A0A538EWK6-F1-model_v4 Nuclear transport factor 2 family protein 0.9956 4 116
AF-A0A2D7KM25-F1-model_v4 SnoaL-like domain-containing protein 0.9658 5 110
AF-A0A4P6K3Q8-F1-model_v4 Nuclear transport factor 2 family protein 0.9625 3 109
AF-A0A6J6BR24-F1-model_v4 Unannotated protein 0.9623 4 111

Map