F469021

General Info

Members Datasets Scaffolds Average Seq Length
610 327 525 250

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2885350715|2885355443
Length 278
Sequence KSTEVVLSVRGIEKSFGTHHVLRGVDLDVHRGKVVCLIGSSGSGKTSLLRCMNLLMEPDQGEIVIHGASLFRRTDSERLRLSSRQVSAVRLKTGLVFQNFNLFPHRTALGNIIEAPLVVKKVPRAEAEALAHELLTRMGLSDAGHKYPSQLSGGQQQRIAIARALAMQPTIMLFDEPTSALDPELVSDVLAAIRQLAADGMTMVIVTHEIGFAYELADRVVFIDQGVVAASGAPRELLLSGANARLAAFVGRFTEQARLLGPLAVPAEAPPTTSPNKG

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
4 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
7 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
10 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
11 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
12 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
13 2547132181 Kosakonia sacchari SP1 Isolate Stem
14 2561511199 Enterobacter sp. R4-368 Isolate Nodule
15 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
16 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
17 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
18 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
19 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
20 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
21 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
22 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
23 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
24 2643221647 Streptomyces sp. Root369 Isolate Unclassified
25 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
26 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
27 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
28 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
29 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
30 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
31 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
32 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
33 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
34 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
35 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
36 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
37 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
38 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
39 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
40 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
41 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
42 2818991450 Burkholderia sp. 604 Isolate Unclassified
43 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
44 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
45 2876601092 Pantoea endophytica 596 Isolate Unclassified
46 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
47 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
48 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
49 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
50 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
51 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
52 2904504865 Serratia marcescens 1822 Isolate Unclassified
53 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
54 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
55 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
56 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
57 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
58 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
59 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
60 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
61 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
62 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
63 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
64 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
65 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
66 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
67 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
68 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
69 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
70 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
71 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
72 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
73 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
74 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
75 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
76 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
77 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
78 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
79 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
80 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
81 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
82 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
83 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
84 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
85 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
86 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
87 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
88 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
89 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
90 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
95 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
98 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
99 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
128 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
176 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
197 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
258 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
283 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
291 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
313 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
314 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
315 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
316 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
317 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
318 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
319 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
320 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
321 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
322 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
323 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
324 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
325 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
326 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
327 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.07
Metatranscriptomes 0
Isolates 13.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 5.25
Nodule 2.62
Rhizoplane 7.7
Rhizosphere 70
Stem 0.16
Stem Tuber 0.16
Unclassified 13.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001878 3300001979 Bacteria 9618
2 JGI24739J22299_10000001 3300001989 Bacteria 99744
3 JGI24739J22299_10004903 3300001989 Bacteria 5097
4 JGI24739J22299_10089993 3300001989 Bacteria 935
5 JGI24737J22298_10023300 3300001990 Bacteria 1965
6 JGI24735J21928_10000685 3300002067 Bacteria 12009
7 JGI24735J21928_10004604 3300002067 Bacteria 4626
8 JGI25156J39149_1001043 3300002705 Bacteria 12870
9 JGI25156J39149_1002098 3300002705 Bacteria 7544
10 JGI25165J46597_1001640 3300003214 Bacteria 10439
11 JGI25160J50197_1000017 3300003354 Bacteria 246175
12 JGI25160J50197_1010024 3300003354 Bacteria 3461
13 Ga0055533_1000070 3300003756 Bacteria 153414
14 Ga0055533_1000701 3300003756 Bacteria 11000
15 Ga0055532_1000011 3300003758 Bacteria 385294
16 Ga0055527_1000009 3300003760 Bacteria 385294
17 Ga0055535_1000008 3300003761 Bacteria 385294
18 Ga0055542_1000014 3300003762 Bacteria 385294
19 Ga0055529_1000010 3300003763 Bacteria 385294
20 Ga0055529_1000999 3300003763 Bacteria 13815
21 Ga0058692_1000476 3300003856 Bacteria 17951
22 Ga0058692_1001363 3300003856 Bacteria 9061
23 Ga0065165_1000975 3300005262 Bacteria 35655
24 Ga0070658_10005856 3300005327 Bacteria 9968
25 Ga0070658_10113836 3300005327 Bacteria 2243
26 Ga0070660_100079367 3300005339 Bacteria 2575
27 Ga0070671_100024176 3300005355 Bacteria 4973
28 Ga0070659_100005984 3300005366 Bacteria 8768
29 Ga0070667_100006471 3300005367 Bacteria 9740
30 Ga0070714_100049864 3300005435 Bacteria 3564
31 Ga0070713_100111284 3300005436 Bacteria 2388
32 Ga0070663_100534353 3300005455 Bacteria 978
33 Ga0070678_100748006 3300005456 Bacteria 884
34 Ga0070665_100002857 3300005548 Bacteria 18676
35 Ga0070665_100334034 3300005548 Bacteria 1520
36 Ga0068855_100002407 3300005563 Bacteria 23077
37 Ga0068863_100032189 3300005841 Bacteria 4998
38 Ga0070717_10046023 3300006028 Bacteria 3569
39 Ga0070712_100088923 3300006175 Bacteria 2258
40 Ga0075434_100591127 3300006871 Bacteria 1129
41 Ga0105251_10001546 3300009011 Bacteria 19747
42 Ga0105251_10002864 3300009011 Bacteria 13019
43 Ga0105251_10003477 3300009011 Bacteria 11413
44 Ga0105251_10045880 3300009011 Bacteria 2105
45 Ga0105244_10000268 3300009036 Bacteria 52462
46 Ga0105244_10000469 3300009036 Bacteria 36819
47 Ga0105250_10000002 3300009092 Bacteria 566949
48 Ga0105250_10007627 3300009092 Bacteria 4638
49 Ga0105240_10081177 3300009093 Bacteria 3985
50 Ga0105240_10234385 3300009093 Bacteria 2131
51 Ga0105240_10394014 3300009093 Bacteria 1561
52 Ga0105240_10683709 3300009093 Bacteria 1122
53 Ga0105247_10147347 3300009101 Bacteria 1548
54 Ga0105241_10117547 3300009174 Bacteria 2137
55 Ga0105248_10247344 3300009177 Bacteria 2007
56 Ga0105248_10347091 3300009177 Bacteria 1671
57 Ga0105248_10771415 3300009177 Bacteria 1085
58 Ga0105237_10000393 3300009545 Bacteria 62266
59 Ga0105237_10007084 3300009545 Bacteria 12328
60 Ga0105237_10039666 3300009545 Bacteria 4753
61 Ga0105237_10099324 3300009545 Bacteria 2902
62 Ga0105237_10312970 3300009545 Bacteria 1573
63 Ga0105238_10125022 3300009551 Bacteria 2551
64 Ga0105239_10142845 3300010375 Bacteria 2668
65 Ga0105246_10067632 3300011119 Bacteria 2504
66 Ga0105246_10111920 3300011119 Bacteria 2007
67 Ga0157373_10027289 3300013100 Bacteria 4119
68 Ga0157371_10001516 3300013102 Bacteria 24004
69 Ga0157371_10009895 3300013102 Bacteria 7466
70 Ga0157370_10000162 3300013104 Bacteria 81640
71 Ga0157370_10000660 3300013104 Bacteria 42859
72 Ga0157370_10001586 3300013104 Bacteria 28104
73 Ga0157370_10016906 3300013104 Bacteria 7374
74 Ga0157370_10570767 3300013104 Bacteria 1037
75 Ga0157369_10000846 3300013105 Bacteria 39124
76 Ga0157369_10083665 3300013105 Bacteria 3412
77 Ga0157369_10971871 3300013105 Bacteria 870
78 Ga0157374_10020005 3300013296 Bacteria 5934
79 Ga0163162_10324087 3300013306 Bacteria 1673
80 Ga0163162_10376535 3300013306 Bacteria 1553
81 Ga0163162_11381282 3300013306 Bacteria 801
82 Ga0163163_10018653 3300014325 Bacteria 6499
83 Ga0182008_10066799 3300014497 Bacteria 1770
84 Ga0157376_10392337 3300014969 Bacteria 1340
85 Ga0182007_10000380 3300015262 Bacteria 28019
86 Ga0183361_10020 3300016635 Bacteria 128627
87 Ga0213876_10000025 3300021384 Bacteria 236747
88 Ga0209435_110427 3300025206 Bacteria 1006
89 Ga0209674_100011 3300025226 Bacteria 997175
90 Ga0209674_100526 3300025226 Bacteria 15502
91 Ga0209672_100002 3300025228 Bacteria 1733325
92 Ga0209672_100287 3300025228 Bacteria 35521
93 Ga0209147_100003 3300025229 Bacteria 1733325
94 Ga0207427_103843 3300025231 Bacteria 2861
95 Ga0209258_100005 3300025242 Bacteria 1087938
96 Ga0209258_109557 3300025242 Bacteria 1296
97 Ga0209148_1000006 3300025254 Bacteria 1733325
98 Ga0209759_1000006 3300025256 Bacteria 492407
99 Ga0209759_1000334 3300025256 Bacteria 62007
100 Ga0209759_1002442 3300025256 Bacteria 8148
101 Ga0209233_1000018 3300025261 Bacteria 886857
102 Ga0209455_1000003 3300025272 Bacteria 1471893
103 Ga0209455_1000359 3300025272 Bacteria 42537
104 Ga0209130_1002136 3300025284 Bacteria 10482
105 Ga0207426_1000107 3300025302 Bacteria 242623
106 Ga0207426_1006297 3300025302 Bacteria 5190
107 Ga0207696_1000021 3300025711 Bacteria 432606
108 Ga0207696_1000323 3300025711 Bacteria 51241
109 Ga0207655_1000158 3300025728 Bacteria 124597
110 Ga0207655_1007766 3300025728 Bacteria 6916
111 Ga0207655_1068811 3300025728 Bacteria 1326
112 Ga0207713_1000765 3300025735 Bacteria 29767
113 Ga0207713_1005572 3300025735 Bacteria 7841
114 Ga0207713_1044142 3300025735 Bacteria 1833
115 Ga0207710_10071646 3300025900 Bacteria 1590
116 Ga0207647_10015528 3300025904 Bacteria 5217
117 Ga0207647_10017128 3300025904 Bacteria 4932
118 Ga0207647_10073648 3300025904 Bacteria 2058
119 Ga0207705_10000492 3300025909 Bacteria 33671
120 Ga0207695_10162409 3300025913 Bacteria 2164
121 Ga0207671_10000138 3300025914 Bacteria 112019
122 Ga0207671_10023425 3300025914 Bacteria 4656
123 Ga0207671_10129325 3300025914 Bacteria 1937
124 Ga0207693_10064210 3300025915 Bacteria 2875
125 Ga0207694_10024919 3300025924 Bacteria 4544
126 Ga0207664_10348841 3300025929 Bacteria 1310
127 Ga0207644_10017280 3300025931 Bacteria 4869
128 Ga0207690_10010596 3300025932 Bacteria 5487
129 Ga0207711_10722027 3300025941 Bacteria 929
130 Ga0207667_10000216 3300025949 Bacteria 80609
131 Ga0207658_10022311 3300025986 Bacteria 4407
132 Ga0207678_10115993 3300026067 Bacteria 2285
133 Ga0207641_10024469 3300026088 Bacteria 4977
134 Ga0209371_1000161 3300027312 Bacteria 103536
135 Ga0209371_1000317 3300027312 Bacteria 52767
136 Ga0209371_1003030 3300027312 Bacteria 8666
137 Ga0268266_10008547 3300028379 Bacteria 9099
138 Ga0268256_1000012 3300030500 Bacteria 794553
139 Ga0268256_1000217 3300030500 Bacteria 63864
140 Ga0268256_1002012 3300030500 Bacteria 11008
141 Ga0265339_10062385 3300031249 Bacteria 2004
142 Ga0307408_100471077 3300031548 Bacteria 1094
143 Ga0307508_10007249 3300031616 Bacteria 10329
144 Ga0307412_10000064 3300031911 Bacteria 125607
145 Ga0307416_100664677 3300032002 Bacteria 1128
146 Ga0373931_0110669 3300035691 Bacteria 1558
147 Ga0316582_0037516 3300036647 Bacteria 3005
148 Ga0395899_0000005 3300037312 Bacteria 772966
149 Ga0395900_0000003 3300037418 Bacteria 587648
150 Ga0395900_0036167 3300037418 Bacteria 5089
151 Ga0395898_0000003 3300037466 Bacteria 772986
152 Ga0395898_0066156 3300037466 Bacteria 3503
153 Ga0395898_0100166 3300037466 Bacteria 2783
154 Ga0395898_0261364 3300037466 Bacteria 1651
155 Ga0395898_0315498 3300037466 Bacteria 1491
156 Ga0395905_0000024 3300037471 Bacteria 318806
157 Ga0395905_0045215 3300037471 Bacteria 4129
158 Ga0395901_0000026 3300038443 Bacteria 249248
159 Ga0395901_0000432 3300038443 Bacteria 49091
160 Ga0395901_0002868 3300038443 Bacteria 17405
161 Ga0395901_0006320 3300038443 Bacteria 11997
162 Ga0400488_47554 3300038741 Bacteria 1102
163 Ga0436365_1279401 3300039437 Bacteria 294819
164 Ga0439448_0004175 3300042005 Bacteria 4066
165 Ga0439452_000009 3300042010 Bacteria 569493
166 Ga0450903_000201 3300042138 Bacteria 13181
167 Ga0439458_0000683 3300042157 Bacteria 8765
168 Ga0450901_002051 3300042533 Bacteria 2229
169 Ga0466969_0000298 3300044656 Bacteria 27190
170 Ga0466969_0002451 3300044656 Bacteria 9894
171 Ga0466969_0036645 3300044656 Bacteria 2476
172 Ga0466972_0081335 3300044658 Bacteria 1542
173 Ga0466972_0088147 3300044658 Bacteria 1473
174 Ga0466972_0122829 3300044658 Bacteria 1224
175 Ga0466965_0000535 3300044683 Bacteria 13684
176 Ga0466965_0003132 3300044683 Bacteria 7210
177 Ga0466966_0000035 3300044684 Bacteria 98928
178 Ga0466966_0004180 3300044684 Bacteria 9536
179 Ga0466966_0008510 3300044684 Bacteria 6791
180 Ga0466966_0034120 3300044684 Bacteria 3293
181 Ga0466961_0000336 3300044693 Bacteria 30807
182 Ga0466961_0002619 3300044693 Bacteria 11182
183 Ga0466961_0004863 3300044693 Bacteria 8452
184 Ga0466961_0011588 3300044693 Bacteria 5636
185 Ga0466961_0184773 3300044693 Bacteria 1293
186 Ga0466963_0000457 3300044694 Bacteria 18964
187 Ga0466963_0015861 3300044694 Bacteria 4677
188 Ga0466963_0024032 3300044694 Bacteria 3876
189 Ga0466963_0157671 3300044694 Bacteria 1579
190 Ga0466963_0190004 3300044694 Bacteria 1435
191 Ga0466964_0023790 3300044706 Bacteria 2383
192 Ga0466971_0001718 3300044719 Bacteria 9282
193 Ga0466971_0002220 3300044719 Bacteria 8211
194 Ga0466971_0013667 3300044719 Bacteria 3569
195 Ga0466971_0203818 3300044719 Bacteria 934
196 Ga0466968_0009869 3300044735 Bacteria 3685
197 Ga0466970_0002400 3300044765 Bacteria 9051
198 Ga0466970_0029344 3300044765 Bacteria 2895
199 Ga0466970_0044208 3300044765 Bacteria 2371
200 Ga0466957_0003313 3300044842 Bacteria 8823
201 Ga0466957_0005789 3300044842 Bacteria 6950
202 Ga0466957_0013143 3300044842 Bacteria 4800
203 Ga0466957_0080659 3300044842 Bacteria 2026
204 Ga0466960_0111934 3300044901 Bacteria 1419
205 Ga0466959_0003277 3300045049 Bacteria 10552
206 Ga0466959_0004374 3300045049 Bacteria 9452
207 Ga0466959_0005542 3300045049 Bacteria 8660
208 Ga0466958_0001730 3300045836 Bacteria 10556
209 Ga0466958_0006838 3300045836 Bacteria 6237
210 Ga0466958_0028963 3300045836 Bacteria 3285
211 Ga0466958_0211440 3300045836 Bacteria 1236
212 Ga0466967_0000884 3300045976 Bacteria 15971
213 Ga0466967_0003330 3300045976 Bacteria 10442
214 Ga0466967_0035042 3300045976 Bacteria 4267
215 Ga0466967_0081944 3300045976 Bacteria 2915
216 Ga0466967_0299098 3300045976 Bacteria 1548
217 Ga0495592_0022334 3300046454 Bacteria 4815
218 Ga0495592_0081985 3300046454 Bacteria 2332
219 Ga0495592_0099149 3300046454 Bacteria 2078
220 Ga0495592_0419953 3300046454 Bacteria 843
221 Ga0495603_0005880 3300046455 Bacteria 7332
222 Ga0495603_0013887 3300046455 Bacteria 4872
223 Ga0495603_0125334 3300046455 Bacteria 1497
224 Ga0495590_0000461 3300046457 Bacteria 20075
225 Ga0495590_0031379 3300046457 Bacteria 1861
226 Ga0495591_000006 3300046458 Bacteria 390570
227 Ga0495591_001367 3300046458 Bacteria 15287
228 Ga0495629_0007483 3300046459 Bacteria 8049
229 Ga0495629_0021642 3300046459 Bacteria 4589
230 Ga0495629_0040504 3300046459 Bacteria 3277
231 Ga0495629_0059006 3300046459 Bacteria 2682
232 Ga0495651_0015253 3300046462 Bacteria 5940
233 Ga0495651_0019273 3300046462 Bacteria 5287
234 Ga0495653_0007269 3300046463 Bacteria 9072
235 Ga0495653_0083100 3300046463 Bacteria 2362
236 Ga0495653_0295260 3300046463 Bacteria 1058
237 Ga0495650_0022357 3300046471 Bacteria 3034
238 Ga0495650_0085280 3300046471 Bacteria 1210
239 Ga0495580_0011377 3300046472 Bacteria 6885
240 Ga0495580_0043626 3300046472 Bacteria 3191
241 Ga0495580_0180326 3300046472 Bacteria 1458
242 Ga0495605_0011342 3300046474 Bacteria 4974
243 Ga0495605_0030110 3300046474 Bacteria 2786
244 Ga0495662_0020007 3300046476 Bacteria 3239
245 Ga0495662_0046947 3300046476 Bacteria 2085
246 Ga0495664_0010330 3300046477 Bacteria 5238
247 Ga0495664_0031542 3300046477 Bacteria 3107
248 Ga0495664_0083051 3300046477 Bacteria 1922
249 Ga0495596_0001178 3300046500 Bacteria 15314
250 Ga0495596_0004753 3300046500 Bacteria 6540
251 Ga0495583_0006993 3300046506 Bacteria 7225
252 Ga0495606_0006929 3300046507 Bacteria 10307
253 Ga0495606_0019384 3300046507 Bacteria 5064
254 Ga0495606_0023043 3300046507 Bacteria 4523
255 Ga0495606_0048519 3300046507 Bacteria 2791
256 Ga0495606_0116527 3300046507 Bacteria 1604
257 Ga0495608_0017411 3300046511 Bacteria 4969
258 Ga0495610_0002795 3300046512 Bacteria 14276
259 Ga0495616_0114173 3300046513 Bacteria 1252
260 Ga0495618_0021643 3300046514 Bacteria 3965
261 Ga0495618_0045254 3300046514 Bacteria 2776
262 Ga0495620_0004445 3300046515 Bacteria 7902
263 Ga0495628_0034018 3300046516 Bacteria 4103
264 Ga0495628_0036321 3300046516 Bacteria 3955
265 Ga0495628_0096991 3300046516 Bacteria 2277
266 Ga0495628_0145597 3300046516 Bacteria 1806
267 Ga0495628_0263994 3300046516 Bacteria 1282
268 Ga0495628_0420193 3300046516 Bacteria 974
269 Ga0495630_0035182 3300046517 Bacteria 3742
270 Ga0495630_0218955 3300046517 Bacteria 1453
271 Ga0495630_0500707 3300046517 Bacteria 931
272 Ga0495632_0155362 3300046519 Bacteria 1056
273 Ga0495643_0000785 3300046522 Bacteria 35224
274 Ga0495648_0019338 3300046524 Bacteria 4792
275 Ga0495648_0048222 3300046524 Bacteria 2624
276 Ga0495648_0048496 3300046524 Bacteria 2613
277 Ga0495648_0069859 3300046524 Bacteria 2042
278 Ga0495666_0015639 3300046526 Bacteria 3777
279 Ga0495666_0022917 3300046526 Bacteria 3090
280 Ga0495666_0058033 3300046526 Bacteria 1852
281 Ga0495652_0023083 3300046529 Bacteria 5516
282 Ga0495652_0034676 3300046529 Bacteria 4397
283 Ga0495652_0069274 3300046529 Bacteria 2953
284 Ga0495652_0082246 3300046529 Bacteria 2655
285 Ga0495652_0144340 3300046529 Bacteria 1868
286 Ga0495654_0000013 3300046530 Bacteria 327576
287 Ga0495665_0000102 3300046531 Bacteria 39799
288 Ga0495665_0080276 3300046531 Bacteria 1716
289 Ga0495640_0095936 3300046533 Bacteria 1951
290 Ga0495640_0316876 3300046533 Bacteria 966
291 Ga0495586_0017713 3300046535 Bacteria 3789
292 Ga0495587_0004758 3300046536 Bacteria 8913
293 Ga0495587_0024854 3300046536 Bacteria 3666
294 Ga0495587_0265722 3300046536 Bacteria 963
295 Ga0495597_0002725 3300046542 Bacteria 10898
296 Ga0495645_0001556 3300046543 Bacteria 15527
297 Ga0495645_0098001 3300046543 Bacteria 2087
298 Ga0495645_0395503 3300046543 Bacteria 881
299 Ga0495622_0038120 3300046557 Bacteria 2238
300 Ga0495667_0378276 3300046559 Bacteria 893
301 Ga0495634_0060903 3300046642 Bacteria 2511
302 Ga0495634_0061852 3300046642 Bacteria 2487
303 Ga0495634_0258713 3300046642 Bacteria 1063
304 Ga0495634_0351554 3300046642 Bacteria 882
305 Ga0495634_0419744 3300046642 Bacteria 792
306 Ga0495611_0135446 3300046648 Bacteria 1150
307 Ga0495625_0366519 3300046660 Bacteria 907
308 Ga0495635_0019026 3300046663 Bacteria 4794
309 Ga0495635_0037086 3300046663 Bacteria 3375
310 Ga0495635_0072029 3300046663 Bacteria 2368
311 Ga0495635_0109227 3300046663 Bacteria 1889
312 Ga0495661_0001989 3300046665 Bacteria 16150
313 Ga0495661_0007570 3300046665 Bacteria 7568
314 Ga0495657_0000530 3300046675 Bacteria 35507
315 Ga0495657_0014785 3300046675 Bacteria 5727
316 Ga0495657_0096285 3300046675 Bacteria 1891
317 Ga0495599_0018743 3300046678 Bacteria 4313
318 Ga0495599_0043543 3300046678 Bacteria 2817
319 Ga0495599_0197742 3300046678 Bacteria 1235
320 Ga0495623_0001423 3300046679 Bacteria 16219
321 Ga0495623_0016919 3300046679 Bacteria 4710
322 Ga0495623_0080661 3300046679 Bacteria 2013
323 Ga0495623_0109431 3300046679 Bacteria 1676
324 Ga0495623_0283686 3300046679 Bacteria 920
325 Ga0495646_0022901 3300046680 Bacteria 3935
326 Ga0495646_0033865 3300046680 Bacteria 3175
327 Ga0495646_0049355 3300046680 Bacteria 2554
328 Ga0495646_0137938 3300046680 Bacteria 1366
329 Ga0495669_0089571 3300046684 Bacteria 1419
330 Ga0495613_0003360 3300046689 Bacteria 11960
331 Ga0495613_0004790 3300046689 Bacteria 10151
332 Ga0495613_0019046 3300046689 Bacteria 5115
333 Ga0495613_0024094 3300046689 Bacteria 4535
334 Ga0495624_0030223 3300046690 Bacteria 3530
335 Ga0495624_0067455 3300046690 Bacteria 2231
336 Ga0495624_0100144 3300046690 Bacteria 1784
337 Ga0495624_0134628 3300046690 Bacteria 1514
338 Ga0495624_0284520 3300046690 Bacteria 998
339 Ga0495671_0040606 3300046692 Bacteria 2346
340 Ga0495671_0146284 3300046692 Bacteria 1151
341 Ga0495649_0032406 3300046694 Bacteria 2878
342 Ga0495649_0070560 3300046694 Bacteria 1873
343 Ga0495649_0109614 3300046694 Bacteria 1464
344 Ga0495589_0001497 3300046794 Bacteria 13435
345 Ga0495589_0119925 3300046794 Bacteria 1267
346 Ga0495600_0002290 3300046809 Bacteria 10911
347 Ga0495600_0006375 3300046809 Bacteria 7180
348 Ga0495600_0021240 3300046809 Bacteria 4155
349 Ga0495600_0127094 3300046809 Bacteria 1658
350 Ga0495600_0132185 3300046809 Bacteria 1622
351 Ga0495600_0209926 3300046809 Bacteria 1248
352 Ga0495660_0092369 3300046810 Bacteria 1571
353 Ga0495581_0002915 3300047315 Bacteria 9787
354 Ga0495581_0015424 3300047315 Bacteria 4436
355 Ga0495604_0005673 3300047317 Bacteria 9900
356 Ga0495604_0005954 3300047317 Bacteria 9675
357 Ga0495604_0031737 3300047317 Bacteria 4190
358 Ga0495604_0045529 3300047317 Bacteria 3423
359 Ga0495604_0088548 3300047317 Bacteria 2302
360 Ga0495674_0018761 3300047319 Bacteria 6437
361 Ga0495674_0022235 3300047319 Bacteria 5848
362 Ga0495674_0038986 3300047319 Bacteria 4260
363 Ga0495674_0075942 3300047319 Bacteria 2890
364 Ga0495674_0208910 3300047319 Bacteria 1617
365 Ga0495674_0219662 3300047319 Bacteria 1571
366 Ga0495672_0037723 3300047320 Bacteria 2954
367 Ga0495672_0042961 3300047320 Bacteria 2721
368 Ga0495676_0130776 3300047321 Bacteria 1812
369 Ga0495680_0004532 3300047322 Bacteria 13276
370 Ga0495680_0018779 3300047322 Bacteria 5859
371 Ga0495680_0025784 3300047322 Bacteria 4860
372 Ga0495680_0088079 3300047322 Bacteria 2333
373 Ga0495680_0112503 3300047322 Bacteria 2016
374 Ga0495680_0413607 3300047322 Bacteria 929
375 Ga0495683_0001679 3300047323 Bacteria 14083
376 Ga0495683_0004837 3300047323 Bacteria 7553
377 Ga0495683_0013209 3300047323 Bacteria 4324
378 Ga0495683_0060731 3300047323 Bacteria 1872
379 Ga0495683_0072409 3300047323 Bacteria 1690
380 Ga0495687_000005 3300047443 Bacteria 610401
381 Ga0495687_008902 3300047443 Bacteria 5684
382 Ga0495687_011982 3300047443 Bacteria 4620
383 Ga0495687_012882 3300047443 Bacteria 4395
384 Ga0495675_0003077 3300047444 Bacteria 10026
385 Ga0495675_0025690 3300047444 Bacteria 3754
386 Ga0495675_0054056 3300047444 Bacteria 2549
387 Ga0495677_0016088 3300047445 Bacteria 2715
388 Ga0495679_003063 3300047446 Bacteria 8210
389 Ga0495679_004217 3300047446 Bacteria 6688
390 Ga0495673_0001572 3300047469 Bacteria 17908
391 Ga0495673_0015450 3300047469 Bacteria 3932
392 Ga0495684_0090832 3300047471 Bacteria 2313
393 Ga0495686_0000063 3300047472 Bacteria 228575
394 Ga0495686_0042415 3300047472 Bacteria 2894
395 Ga0495593_0015212 3300047673 Bacteria 4364
396 Ga0495593_0023239 3300047673 Bacteria 3448
397 Ga0495593_0244023 3300047673 Bacteria 899
398 Ga0495602_0012016 3300048088 Bacteria 8927
399 Ga0495602_0053197 3300048088 Bacteria 3588
400 Ga0495602_0079061 3300048088 Bacteria 2775
401 Ga0495602_0084737 3300048088 Bacteria 2650
402 Ga0495602_0124417 3300048088 Bacteria 2068
403 Ga0495614_0003256 3300048089 Bacteria 7253
404 Ga0495614_0006309 3300048089 Bacteria 5328
405 Ga0495614_0013145 3300048089 Bacteria 3630
406 Ga0495614_0040003 3300048089 Bacteria 2012
407 Ga0495626_0012971 3300048091 Bacteria 4346
408 Ga0496100_0000034 3300048903 Bacteria 98593
409 Ga0496100_0001840 3300048903 Bacteria 10601
410 Ga0496100_0077536 3300048903 Bacteria 2234
411 Ga0496101_0000006 3300048904 Bacteria 329135
412 Ga0496101_0001039 3300048904 Bacteria 16389
413 Ga0496101_0005083 3300048904 Bacteria 8368
414 Ga0496101_0052178 3300048904 Bacteria 2948
415 Ga0496102_0000278 3300048905 Bacteria 65244
416 Ga0496102_0003653 3300048905 Bacteria 13014
417 Ga0496102_0006172 3300048905 Bacteria 10219
418 Ga0496102_0024176 3300048905 Bacteria 5401
419 Ga0496102_0529202 3300048905 Bacteria 1101
420 Ga0496103_0000283 3300048906 Bacteria 47857
421 Ga0496103_0005649 3300048906 Bacteria 7478
422 Ga0496103_0171510 3300048906 Bacteria 1393
423 Ga0496103_0303531 3300048906 Bacteria 1027
424 Ga0496104_0022795 3300048907 Bacteria 5752
425 Ga0496104_0062551 3300048907 Bacteria 3529
426 Ga0496104_0073213 3300048907 Bacteria 3259
427 Ga0496104_0150942 3300048907 Bacteria 2230
428 Ga0496105_0024753 3300048908 Bacteria 4879
429 Ga0496105_0060533 3300048908 Bacteria 3125
430 Ga0496105_0181238 3300048908 Bacteria 1725
431 Ga0496106_0000007 3300048909 Bacteria 248548
432 Ga0496106_0004947 3300048909 Bacteria 9857
433 Ga0496106_0010465 3300048909 Bacteria 6850
434 Ga0496106_0269781 3300048909 Bacteria 1362
435 Ga0496107_0003924 3300048910 Bacteria 9999
436 Ga0496108_0318447 3300048911 Bacteria 1356
437 Ga0496110_0008025 3300048913 Bacteria 8463
438 Ga0496110_0148223 3300048913 Bacteria 2123
439 Ga0496111_0004850 3300048914 Bacteria 8536
440 Ga0496112_0002744 3300048915 Bacteria 14271
441 Ga0496112_0011434 3300048915 Bacteria 8105
442 Ga0496113_0000400 3300048916 Bacteria 20916
443 Ga0496113_0002560 3300048916 Bacteria 10618
444 Ga0496114_0284999 3300048917 Bacteria 1457
445 Ga0496116_0000308 3300048919 Bacteria 82039
446 Ga0496116_0014881 3300048919 Bacteria 6180
447 Ga0496116_0024168 3300048919 Bacteria 4501
448 Ga0496117_0000240 3300048920 Bacteria 103752
449 Ga0496117_0000700 3300048920 Bacteria 53137
450 Ga0496117_0001038 3300048920 Bacteria 42361
451 Ga0496117_0036700 3300048920 Bacteria 3663
452 Ga0496117_0130840 3300048920 Bacteria 1521
453 Ga0496118_0000200 3300048921 Bacteria 105546
454 Ga0496118_0000846 3300048921 Bacteria 48639
455 Ga0496118_0002091 3300048921 Bacteria 28056
456 Ga0496118_0009268 3300048921 Bacteria 9985
457 Ga0496118_0011553 3300048921 Bacteria 8604
458 Ga0496118_0016075 3300048921 Bacteria 6886
459 Ga0496118_0017146 3300048921 Bacteria 6608
460 Ga0496118_0065769 3300048921 Bacteria 2651
461 Ga0496118_0105152 3300048921 Bacteria 1893
462 Ga0496119_0000510 3300048922 Bacteria 52939
463 Ga0496119_0031389 3300048922 Bacteria 3564
464 Ga0496119_0125304 3300048922 Bacteria 1406
465 Ga0496120_0000109 3300048923 Bacteria 137907
466 Ga0496120_0073302 3300048923 Bacteria 1874
467 Ga0496120_0207197 3300048923 Bacteria 945
468 Ga0496121_0001345 3300048924 Bacteria 41995
469 Ga0496121_0002719 3300048924 Bacteria 26393
470 Ga0496121_0008105 3300048924 Bacteria 12498
471 Ga0496121_0008114 3300048924 Bacteria 12485
472 Ga0496121_0023969 3300048924 Bacteria 5852
473 Ga0496121_0076168 3300048924 Bacteria 2676
474 Ga0496122_0003956 3300048925 Bacteria 18933
475 Ga0496122_0005863 3300048925 Bacteria 14401
476 Ga0496123_0000171 3300048926 Bacteria 130780
477 Ga0496123_0020697 3300048926 Bacteria 5138
478 Ga0496124_0016455 3300048927 Bacteria 7028
479 Ga0496124_0020908 3300048927 Bacteria 6038
480 Ga0496124_0347230 3300048927 Bacteria 1051
481 Ga0496125_0006528 3300048928 Bacteria 12578
482 Ga0496125_0245642 3300048928 Bacteria 1133
483 Ga0496126_0000065 3300048929 Bacteria 252549
484 Ga0496126_0000216 3300048929 Bacteria 126985
485 Ga0496126_0002411 3300048929 Bacteria 25348
486 Ga0496126_0093198 3300048929 Bacteria 2645
487 Ga0496126_0405412 3300048929 Bacteria 1105
488 Ga0495678_053840 3300049459 Bacteria 1543
489 Ga0495682_0032652 3300049460 Bacteria 1923
490 Ga0501032_0001805 3300049569 Bacteria 16902
491 Ga0501033_0001286 3300049570 Bacteria 22393
492 Ga0501034_0003756 3300049571 Bacteria 17153
493 Ga0501034_0027770 3300049571 Bacteria 5754
494 Ga0501034_0116974 3300049571 Bacteria 2654
495 Ga0501034_0768014 3300049571 Bacteria 858
496 Ga0501036_0021321 3300049572 Bacteria 5445
497 Ga0501036_0166648 3300049572 Bacteria 1857
498 Ga0501037_0000284 3300049573 Bacteria 42983
499 Ga0501038_0000436 3300049574 Bacteria 36343
500 Ga0501039_0000665 3300049575 Bacteria 24733
501 Ga0501043_0007419 3300049579 Bacteria 8703
502 Ga0501043_0008543 3300049579 Bacteria 8070
503 Ga0501046_0003409 3300049580 Bacteria 14596
504 Ga0501047_0032577 3300049581 Bacteria 5031
505 Ga0501047_0040183 3300049581 Bacteria 4524
506 Ga0501048_0064756 3300049582 Bacteria 2585
507 Ga0501070_0000762 3300049586 Bacteria 29400
508 Ga0501070_0001401 3300049586 Bacteria 21576
509 Ga0501080_0395029 3300049742 Bacteria 1245
510 Ga0501035_0032278 3300049822 Bacteria 4765
511 Ga0501044_0075522 3300049823 Bacteria 3422
512 Ga0501044_0092663 3300049823 Bacteria 3047
513 nmdc:mga00v17_135382_c1 3300050491 Bacteria 1577
514 nmdc:mga05p37_933121_c1 3300050507 Bacteria 931
515 nmdc:mga0n895_391314_c1 3300050512 Bacteria 1406
516 nmdc:mga0n895_675307_c1 3300050512 Bacteria 1030
517 nmdc:mga0sz30_37121_c1 3300050516 Bacteria 2038
518 Ga0495595_0054784 3300053084 Bacteria 1855
519 Ga0500643_026601 3300053087 Bacteria 1809
520 Ga0500560_004006 3300053107 Bacteria 3070
521 Ga0500573_0052625 3300053140 Bacteria 2340
522 Ga0466962_0000180 3300061719 Bacteria 26200
523 Ga0466962_0016167 3300061719 Bacteria 3599
524 Ga0466962_0022265 3300061719 Bacteria 3044
525 Ga0466962_0169458 3300061719 Bacteria 1063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2922185730 2922187313 191
2 3300046455 Ga0495603_0125334 Ga0495603_0125334_846_1481 211
3 3300046809 Ga0495600_0209926 Ga0495600_0209926_363_1082 232
4 3300013306 Ga0163162_11381282 Ga0163162_113812821 234
5 3300005548 Ga0070665_100334034 Ga0070665_1003340342 236
6 3300047472 Ga0495686_0042415 Ga0495686_0042415_1155_1913 237
7 iso_pu_bacteria 2842805378 2842805535 237
8 iso_pu_bacteria 2938649242 2938649516 237
9 iso_pu_bacteria 2968558590 2968560049 237
10 iso_pu_bacteria 2984527788 2984532308 237
11 iso_pu_bacteria 2984532647 2984533568 237
12 iso_pu_bacteria 2988225383 2988227886 237
13 iso_pu_bacteria 2996632988 2996633744 237
14 iso_pu_bacteria 8002745576 8002748434 237
15 3300046660 Ga0495625_0366519 Ga0495625_0366519_152_895 238
16 3300038741 Ga0400488_47554 Ga0400488_47554_94_840 240
17 3300050507 nmdc:mga05p37_933121_c1 nmdc:mga05p37_933121_c1_108_857 240
18 3300050512 nmdc:mga0n895_675307_c1 nmdc:mga0n895_675307_c1_231_980 240
19 3300013104 Ga0157370_10000162 Ga0157370_100001622 241
20 3300031249 Ga0265339_10062385 Ga0265339_100623852 241
21 3300044694 Ga0466963_0015861 Ga0466963_0015861_1715_2440 241
22 3300044842 Ga0466957_0080659 Ga0466957_0080659_800_1525 241
23 3300044901 Ga0466960_0111934 Ga0466960_0111934_612_1337 241
24 3300045976 Ga0466967_0035042 Ga0466967_0035042_58_783 241
25 iso_pu_bacteria 2508501042 2508696665 241
26 iso_pu_bacteria 2511231025 2511382171 241
27 iso_pu_bacteria 2513237094 2513643518 241
28 iso_pu_bacteria 2547132181 2547694900 241
29 iso_pu_bacteria 2561511199 2562466923 241
30 iso_pu_bacteria 2599185299 2599928848 241
31 iso_pu_bacteria 2600255256 2601533782 241
32 iso_pu_bacteria 2600255257 2601540997 241
33 iso_pu_bacteria 2600255310 2601759362 241
34 iso_pu_bacteria 2600255311 2601762584 241
35 iso_pu_bacteria 2602042046 2603640421 241
36 iso_pu_bacteria 2609459761 2609912634 241
37 iso_pu_bacteria 2648501693 2650897557 241
38 iso_pu_bacteria 2684622997 2686354932 241
39 iso_pu_bacteria 2706794495 2707099037 241
40 iso_pu_bacteria 2791354903 2791921962 241
41 iso_pu_bacteria 2791355010 2792311597 241
42 iso_pu_bacteria 2808606414 2809126355 241
43 iso_pu_bacteria 2811995292 2813730803 241
44 iso_pu_bacteria 2814123068 2814698419 241
45 iso_pu_bacteria 2847797336 2847798519 241
46 iso_pu_bacteria 2876601092 2876604638 241
47 iso_pu_bacteria 2900051742 2900055101 241
48 iso_pu_bacteria 2939602548 2939603719 241
49 iso_pu_bacteria 2945874760 2945879530 241
50 iso_pu_bacteria 2984494565 2984495336 241
51 iso_pu_bacteria 2990261002 2990265047 241
52 iso_pu_bacteria 8016733728 8016738198 241
53 iso_pu_bacteria 8019499862 8019500573 241
54 3300013105 Ga0157369_10971871 Ga0157369_109718712 242
55 iso_pu_bacteria 2885350715 2885355443 242
56 iso_pu_bacteria 2904504865 2904507944 242
57 3300014969 Ga0157376_10392337 Ga0157376_103923372 243
58 3300035691 Ga0373931_0110669 Ga0373931_0110669_463_1212 243
59 3300036647 Ga0316582_0037516 Ga0316582_0037516_549_1361 243
60 3300046522 Ga0495643_0000785 Ga0495643_0000785_34153_34929 243
61 3300046559 Ga0495667_0378276 Ga0495667_0378276_37_801 243
62 3300053084 Ga0495595_0054784 Ga0495595_0054784_308_1072 243
63 3300006028 Ga0070717_10046023 Ga0070717_100460232 244
64 3300027312 Ga0209371_1000317 Ga0209371_100031747 244
65 3300030500 Ga0268256_1000217 Ga0268256_100021731 244
66 3300031616 Ga0307508_10007249 Ga0307508_100072496 244
67 3300047472 Ga0495686_0000063 Ga0495686_0000063_71007_71768 244
68 3300048922 Ga0496119_0000510 Ga0496119_0000510_42911_43675 244
69 iso_pu_bacteria 2954380949 2954389471 244
70 3300001989 JGI24739J22299_10000001 JGI24739J22299_1000000141 245
71 3300003856 Ga0058692_1000476 Ga0058692_100047616 245
72 3300003856 Ga0058692_1001363 Ga0058692_10013635 245
73 3300009011 Ga0105251_10001546 Ga0105251_1000154620 245
74 3300009036 Ga0105244_10000268 Ga0105244_1000026813 245
75 3300009036 Ga0105244_10000469 Ga0105244_100004695 245
76 3300009092 Ga0105250_10007627 Ga0105250_100076272 245
77 3300011119 Ga0105246_10067632 Ga0105246_100676322 245
78 3300013100 Ga0157373_10027289 Ga0157373_100272893 245
79 3300013102 Ga0157371_10001516 Ga0157371_100015168 245
80 3300013102 Ga0157371_10009895 Ga0157371_100098958 245
81 3300013104 Ga0157370_10000660 Ga0157370_1000066034 245
82 3300013104 Ga0157370_10001586 Ga0157370_1000158614 245
83 3300013306 Ga0163162_10324087 Ga0163162_103240872 245
84 3300021384 Ga0213876_10000025 Ga0213876_1000002515 245
85 3300025711 Ga0207696_1000323 Ga0207696_100032344 245
86 3300025728 Ga0207655_1000158 Ga0207655_100015876 245
87 3300025728 Ga0207655_1007766 Ga0207655_10077668 245
88 3300025728 Ga0207655_1068811 Ga0207655_10688112 245
89 3300025735 Ga0207713_1044142 Ga0207713_10441422 245
90 3300027312 Ga0209371_1000161 Ga0209371_100016151 245
91 3300027312 Ga0209371_1003030 Ga0209371_100303011 245
92 3300030500 Ga0268256_1000012 Ga0268256_1000012405 245
93 3300030500 Ga0268256_1002012 Ga0268256_100201210 245
94 3300031548 Ga0307408_100471077 Ga0307408_1004710772 245
95 3300039437 Ga0436365_1279401 Ga0436365_1279401_71729_72466 245
96 3300042010 Ga0439452_000009 Ga0439452_000009_52190_52927 245
97 3300046458 Ga0495591_000006 Ga0495591_000006_54784_55521 245
98 3300046519 Ga0495632_0155362 Ga0495632_0155362_92_829 245
99 3300046530 Ga0495654_0000013 Ga0495654_0000013_59375_60112 245
100 3300046690 Ga0495624_0030223 Ga0495624_0030223_153_908 245
101 3300048904 Ga0496101_0000006 Ga0496101_0000006_45282_46019 245
102 3300048919 Ga0496116_0000308 Ga0496116_0000308_41761_42498 245
103 3300048919 Ga0496116_0024168 Ga0496116_0024168_1972_2709 245
104 3300048920 Ga0496117_0001038 Ga0496117_0001038_20986_21723 245
105 3300048921 Ga0496118_0002091 Ga0496118_0002091_3350_4087 245
106 3300048921 Ga0496118_0065769 Ga0496118_0065769_382_1119 245
107 3300048922 Ga0496119_0031389 Ga0496119_0031389_1019_1756 245
108 3300048923 Ga0496120_0000109 Ga0496120_0000109_64092_64829 245
109 3300048925 Ga0496122_0003956 Ga0496122_0003956_18114_18851 245
110 3300048925 Ga0496122_0005863 Ga0496122_0005863_5625_6362 245
111 3300048926 Ga0496123_0000171 Ga0496123_0000171_15430_16167 245
112 3300048926 Ga0496123_0020697 Ga0496123_0020697_2026_2763 245
113 3300048927 Ga0496124_0020908 Ga0496124_0020908_1609_2346 245
114 3300048928 Ga0496125_0245642 Ga0496125_0245642_185_922 245
115 3300049459 Ga0495678_053840 Ga0495678_053840_587_1324 245
116 3300050491 nmdc:mga00v17_135382_c1 nmdc:mga00v17_135382_c1_692_1429 245
117 3300053107 Ga0500560_004006 Ga0500560_004006_547_1302 245
118 3300053140 Ga0500573_0052625 Ga0500573_0052625_734_1489 245
119 3300009092 Ga0105250_10000002 Ga0105250_10000002288 246
120 3300025711 Ga0207696_1000021 Ga0207696_1000021219 246
121 3300042005 Ga0439448_0004175 Ga0439448_0004175_1642_2406 246
122 3300042138 Ga0450903_000201 Ga0450903_000201_2375_3139 246
123 3300042157 Ga0439458_0000683 Ga0439458_0000683_1522_2286 246
124 3300042533 Ga0450901_002051 Ga0450901_002051_1110_1874 246
125 iso_pu_bacteria 2501025504 2501406958 246
126 iso_pu_bacteria 2508501125 2509126536 246
127 iso_pu_bacteria 2510065045 2510253288 246
128 iso_pu_bacteria 2510917014 2511097860 246
129 iso_pu_bacteria 2512047030 2512347463 246
130 iso_pu_bacteria 2513237166 2514053882 246
131 iso_pu_bacteria 2515154122 2515679476 246
132 iso_pu_bacteria 2526164713 2527079582 246
133 iso_pu_bacteria 2562617112 2563062693 246
134 iso_pu_bacteria 2600255067 2600812324 246
135 iso_pu_bacteria 2643221647 2644270227 246
136 iso_pu_bacteria 2711768613 2713476930 246
137 iso_pu_bacteria 2718217991 2719639077 246
138 iso_pu_bacteria 2738541296 2738823722 246
139 iso_pu_bacteria 2738541298 2738836014 246
140 iso_pu_bacteria 2738541306 2738877544 246
141 iso_pu_bacteria 2738543002 2739189349 246
142 iso_pu_bacteria 2738543008 2739224137 246
143 iso_pu_bacteria 2786546132 2786667336 246
144 iso_pu_bacteria 2818991450 2819619257 246
145 iso_pu_bacteria 2885270888 2885277376 246
146 iso_pu_bacteria 2902682994 2902689243 246
147 iso_pu_bacteria 2904483920 2904486298 246
148 iso_pu_bacteria 2904615490 2904616276 246
149 iso_pu_bacteria 2919527303 2919527641 246
150 iso_pu_bacteria 2928108538 2928113699 246
151 iso_pu_bacteria 2928135762 2928141211 246
152 iso_pu_bacteria 2928503688 2928504661 246
153 iso_pu_bacteria 2945934425 2945941099 246
154 iso_pu_bacteria 2954673503 2954682424 246
155 iso_pu_bacteria 2954682443 2954690500 246
156 iso_pu_bacteria 2990703756 2990708146 246
157 iso_pu_bacteria 641736151 642421963 246
158 iso_pu_bacteria 642555112 642598349 246
159 iso_pu_bacteria 8054563764 8054565580 246
160 iso_pu_bacteria 8055266321 8055270504 246
161 iso_pu_bacteria 8055301274 8055306932 246
162 3300049570 Ga0501033_0001286 Ga0501033_0001286_4905_5672 247
163 3300049571 Ga0501034_0027770 Ga0501034_0027770_1294_2061 247
164 3300049572 Ga0501036_0166648 Ga0501036_0166648_453_1220 247
165 3300049581 Ga0501047_0032577 Ga0501047_0032577_1784_2551 247
166 3300049582 Ga0501048_0064756 Ga0501048_0064756_1300_2067 247
167 3300049742 Ga0501080_0395029 Ga0501080_0395029_69_836 247
168 3300049823 Ga0501044_0092663 Ga0501044_0092663_959_1726 247
169 3300013306 Ga0163162_10376535 Ga0163162_103765353 248
170 3300045976 Ga0466967_0000884 Ga0466967_0000884_6691_7521 248
171 iso_pu_bacteria 2515154123 2515691507 248
172 3300005456 Ga0070678_100748006 Ga0070678_1007480061 249
173 3300006871 Ga0075434_100591127 Ga0075434_1005911272 249
174 3300053087 Ga0500643_026601 Ga0500643_026601_860_1609 249
175 3300001979 JGI24740J21852_10001878 JGI24740J21852_100018783 250
176 3300001989 JGI24739J22299_10004903 JGI24739J22299_100049035 250
177 3300001989 JGI24739J22299_10089993 JGI24739J22299_100899931 250
178 3300001990 JGI24737J22298_10023300 JGI24737J22298_100233002 250
179 3300002067 JGI24735J21928_10000685 JGI24735J21928_100006852 250
180 3300002067 JGI24735J21928_10004604 JGI24735J21928_100046043 250
181 3300002705 JGI25156J39149_1001043 JGI25156J39149_10010436 250
182 3300002705 JGI25156J39149_1002098 JGI25156J39149_10020982 250
183 3300003214 JGI25165J46597_1001640 JGI25165J46597_10016407 250
184 3300003354 JGI25160J50197_1000017 JGI25160J50197_100001775 250
185 3300003354 JGI25160J50197_1010024 JGI25160J50197_10100245 250
186 3300003756 Ga0055533_1000070 Ga0055533_10000708 250
187 3300003756 Ga0055533_1000701 Ga0055533_10007015 250
188 3300003758 Ga0055532_1000011 Ga0055532_1000011360 250
189 3300003760 Ga0055527_1000009 Ga0055527_1000009359 250
190 3300003761 Ga0055535_1000008 Ga0055535_10000088 250
191 3300003762 Ga0055542_1000014 Ga0055542_10000148 250
192 3300003763 Ga0055529_1000010 Ga0055529_10000108 250
193 3300003763 Ga0055529_1000999 Ga0055529_10009998 250
194 3300005262 Ga0065165_1000975 Ga0065165_100097526 250
195 3300005327 Ga0070658_10005856 Ga0070658_100058565 250
196 3300005327 Ga0070658_10113836 Ga0070658_101138361 250
197 3300005339 Ga0070660_100079367 Ga0070660_1000793673 250
198 3300005355 Ga0070671_100024176 Ga0070671_1000241764 250
199 3300005366 Ga0070659_100005984 Ga0070659_1000059848 250
200 3300005367 Ga0070667_100006471 Ga0070667_1000064719 250
201 3300005435 Ga0070714_100049864 Ga0070714_1000498644 250
202 3300005436 Ga0070713_100111284 Ga0070713_1001112843 250
203 3300005455 Ga0070663_100534353 Ga0070663_1005343532 250
204 3300005548 Ga0070665_100002857 Ga0070665_10000285719 250
205 3300005563 Ga0068855_100002407 Ga0068855_10000240721 250
206 3300005841 Ga0068863_100032189 Ga0068863_1000321893 250
207 3300006175 Ga0070712_100088923 Ga0070712_1000889232 250
208 3300009011 Ga0105251_10002864 Ga0105251_100028642 250
209 3300009011 Ga0105251_10003477 Ga0105251_100034777 250
210 3300009011 Ga0105251_10045880 Ga0105251_100458802 250
211 3300009093 Ga0105240_10081177 Ga0105240_100811772 250
212 3300009093 Ga0105240_10234385 Ga0105240_102343852 250
213 3300009093 Ga0105240_10394014 Ga0105240_103940142 250
214 3300009093 Ga0105240_10683709 Ga0105240_106837091 250
215 3300009101 Ga0105247_10147347 Ga0105247_101473472 250
216 3300009174 Ga0105241_10117547 Ga0105241_101175472 250
217 3300009177 Ga0105248_10247344 Ga0105248_102473442 250
218 3300009177 Ga0105248_10347091 Ga0105248_103470912 250
219 3300009177 Ga0105248_10771415 Ga0105248_107714152 250
220 3300009545 Ga0105237_10000393 Ga0105237_1000039315 250
221 3300009545 Ga0105237_10007084 Ga0105237_1000708410 250
222 3300009545 Ga0105237_10039666 Ga0105237_100396664 250
223 3300009545 Ga0105237_10099324 Ga0105237_100993244 250
224 3300009545 Ga0105237_10312970 Ga0105237_103129702 250
225 3300009551 Ga0105238_10125022 Ga0105238_101250222 250
226 3300010375 Ga0105239_10142845 Ga0105239_101428454 250
227 3300011119 Ga0105246_10111920 Ga0105246_101119203 250
228 3300013104 Ga0157370_10016906 Ga0157370_100169068 250
229 3300013104 Ga0157370_10570767 Ga0157370_105707672 250
230 3300013105 Ga0157369_10000846 Ga0157369_1000084624 250
231 3300013105 Ga0157369_10083665 Ga0157369_100836653 250
232 3300013296 Ga0157374_10020005 Ga0157374_100200053 250
233 3300014325 Ga0163163_10018653 Ga0163163_100186536 250
234 3300014497 Ga0182008_10066799 Ga0182008_100667993 250
235 3300015262 Ga0182007_10000380 Ga0182007_1000038026 250
236 3300016635 Ga0183361_10020 Ga0183361_10020110 250
237 3300025206 Ga0209435_110427 Ga0209435_1104272 250
238 3300025226 Ga0209674_100011 Ga0209674_100011554 250
239 3300025226 Ga0209674_100526 Ga0209674_1005267 250
240 3300025228 Ga0209672_100002 Ga0209672_100002550 250
241 3300025228 Ga0209672_100287 Ga0209672_1002874 250
242 3300025229 Ga0209147_100003 Ga0209147_100003550 250
243 3300025231 Ga0207427_103843 Ga0207427_1038433 250
244 3300025242 Ga0209258_100005 Ga0209258_100005191 250
245 3300025242 Ga0209258_109557 Ga0209258_1095572 250
246 3300025254 Ga0209148_1000006 Ga0209148_1000006550 250
247 3300025256 Ga0209759_1000006 Ga0209759_1000006445 250
248 3300025256 Ga0209759_1000334 Ga0209759_10003349 250
249 3300025256 Ga0209759_1002442 Ga0209759_10024426 250
250 3300025261 Ga0209233_1000018 Ga0209233_1000018805 250
251 3300025272 Ga0209455_1000003 Ga0209455_1000003550 250
252 3300025272 Ga0209455_1000359 Ga0209455_100035935 250
253 3300025284 Ga0209130_1002136 Ga0209130_10021364 250
254 3300025302 Ga0207426_1000107 Ga0207426_1000107102 250
255 3300025302 Ga0207426_1006297 Ga0207426_10062976 250
256 3300025735 Ga0207713_1000765 Ga0207713_100076534 250
257 3300025735 Ga0207713_1005572 Ga0207713_10055725 250
258 3300025900 Ga0207710_10071646 Ga0207710_100716462 250
259 3300025904 Ga0207647_10015528 Ga0207647_100155285 250
260 3300025904 Ga0207647_10017128 Ga0207647_100171285 250
261 3300025904 Ga0207647_10073648 Ga0207647_100736483 250
262 3300025909 Ga0207705_10000492 Ga0207705_1000049212 250
263 3300025913 Ga0207695_10162409 Ga0207695_101624093 250
264 3300025914 Ga0207671_10000138 Ga0207671_1000013875 250
265 3300025914 Ga0207671_10023425 Ga0207671_100234254 250
266 3300025914 Ga0207671_10129325 Ga0207671_101293252 250
267 3300025915 Ga0207693_10064210 Ga0207693_100642103 250
268 3300025924 Ga0207694_10024919 Ga0207694_100249195 250
269 3300025929 Ga0207664_10348841 Ga0207664_103488412 250
270 3300025931 Ga0207644_10017280 Ga0207644_100172804 250
271 3300025932 Ga0207690_10010596 Ga0207690_100105963 250
272 3300025941 Ga0207711_10722027 Ga0207711_107220272 250
273 3300025949 Ga0207667_10000216 Ga0207667_1000021645 250
274 3300025986 Ga0207658_10022311 Ga0207658_100223114 250
275 3300026067 Ga0207678_10115993 Ga0207678_101159932 250
276 3300026088 Ga0207641_10024469 Ga0207641_100244694 250
277 3300028379 Ga0268266_10008547 Ga0268266_100085476 250
278 3300031911 Ga0307412_10000064 Ga0307412_10000064108 250
279 3300032002 Ga0307416_100664677 Ga0307416_1006646772 250
280 3300037312 Ga0395899_0000005 Ga0395899_0000005_639230_639982 250
281 3300037418 Ga0395900_0000003 Ga0395900_0000003_132985_133737 250
282 3300037418 Ga0395900_0036167 Ga0395900_0036167_3448_4200 250
283 3300037466 Ga0395898_0000003 Ga0395898_0000003_639250_640002 250
284 3300037466 Ga0395898_0066156 Ga0395898_0066156_1224_1976 250
285 3300037466 Ga0395898_0100166 Ga0395898_0100166_937_1689 250
286 3300037466 Ga0395898_0261364 Ga0395898_0261364_197_949 250
287 3300037466 Ga0395898_0315498 Ga0395898_0315498_386_1141 250
288 3300037471 Ga0395905_0000024 Ga0395905_0000024_51697_52449 250
289 3300037471 Ga0395905_0045215 Ga0395905_0045215_1812_2564 250
290 3300038443 Ga0395901_0000026 Ga0395901_0000026_132381_133133 250
291 3300038443 Ga0395901_0000432 Ga0395901_0000432_10774_11526 250
292 3300038443 Ga0395901_0002868 Ga0395901_0002868_3161_3913 250
293 3300038443 Ga0395901_0006320 Ga0395901_0006320_7938_8690 250
294 3300044656 Ga0466969_0000298 Ga0466969_0000298_18172_18924 250
295 3300044656 Ga0466969_0002451 Ga0466969_0002451_4875_5633 250
296 3300044656 Ga0466969_0036645 Ga0466969_0036645_1292_2044 250
297 3300044658 Ga0466972_0081335 Ga0466972_0081335_120_872 250
298 3300044658 Ga0466972_0088147 Ga0466972_0088147_235_987 250
299 3300044658 Ga0466972_0122829 Ga0466972_0122829_413_1165 250
300 3300044683 Ga0466965_0000535 Ga0466965_0000535_8496_9248 250
301 3300044683 Ga0466965_0003132 Ga0466965_0003132_4399_5151 250
302 3300044684 Ga0466966_0000035 Ga0466966_0000035_28146_28898 250
303 3300044684 Ga0466966_0004180 Ga0466966_0004180_4208_4960 250
304 3300044684 Ga0466966_0008510 Ga0466966_0008510_3435_4193 250
305 3300044684 Ga0466966_0034120 Ga0466966_0034120_1269_2021 250
306 3300044693 Ga0466961_0000336 Ga0466961_0000336_2160_2912 250
307 3300044693 Ga0466961_0002619 Ga0466961_0002619_6235_6993 250
308 3300044693 Ga0466961_0004863 Ga0466961_0004863_2315_3067 250
309 3300044693 Ga0466961_0011588 Ga0466961_0011588_1250_2002 250
310 3300044693 Ga0466961_0184773 Ga0466961_0184773_65_817 250
311 3300044694 Ga0466963_0000457 Ga0466963_0000457_9965_10717 250
312 3300044694 Ga0466963_0024032 Ga0466963_0024032_2242_2994 250
313 3300044694 Ga0466963_0157671 Ga0466963_0157671_370_1158 250
314 3300044694 Ga0466963_0190004 Ga0466963_0190004_485_1237 250
315 3300044706 Ga0466964_0023790 Ga0466964_0023790_953_1726 250
316 3300044719 Ga0466971_0001718 Ga0466971_0001718_1338_2090 250
317 3300044719 Ga0466971_0002220 Ga0466971_0002220_2057_2809 250
318 3300044719 Ga0466971_0013667 Ga0466971_0013667_686_1438 250
319 3300044719 Ga0466971_0203818 Ga0466971_0203818_138_890 250
320 3300044735 Ga0466968_0009869 Ga0466968_0009869_590_1342 250
321 3300044765 Ga0466970_0002400 Ga0466970_0002400_4348_5100 250
322 3300044765 Ga0466970_0029344 Ga0466970_0029344_165_917 250
323 3300044765 Ga0466970_0044208 Ga0466970_0044208_674_1432 250
324 3300044842 Ga0466957_0003313 Ga0466957_0003313_2451_3203 250
325 3300044842 Ga0466957_0005789 Ga0466957_0005789_2058_2810 250
326 3300044842 Ga0466957_0013143 Ga0466957_0013143_2915_3667 250
327 3300045049 Ga0466959_0003277 Ga0466959_0003277_6420_7172 250
328 3300045049 Ga0466959_0004374 Ga0466959_0004374_4528_5286 250
329 3300045049 Ga0466959_0005542 Ga0466959_0005542_6855_7607 250
330 3300045836 Ga0466958_0001730 Ga0466958_0001730_1591_2343 250
331 3300045836 Ga0466958_0006838 Ga0466958_0006838_2498_3250 250
332 3300045836 Ga0466958_0028963 Ga0466958_0028963_1444_2196 250
333 3300045836 Ga0466958_0211440 Ga0466958_0211440_132_920 250
334 3300045976 Ga0466967_0003330 Ga0466967_0003330_4639_5412 250
335 3300045976 Ga0466967_0081944 Ga0466967_0081944_581_1333 250
336 3300045976 Ga0466967_0299098 Ga0466967_0299098_627_1415 250
337 3300046454 Ga0495592_0022334 Ga0495592_0022334_1846_2598 250
338 3300046454 Ga0495592_0081985 Ga0495592_0081985_1488_2240 250
339 3300046454 Ga0495592_0099149 Ga0495592_0099149_165_917 250
340 3300046454 Ga0495592_0419953 Ga0495592_0419953_46_798 250
341 3300046455 Ga0495603_0005880 Ga0495603_0005880_1998_2750 250
342 3300046455 Ga0495603_0013887 Ga0495603_0013887_3318_4070 250
343 3300046457 Ga0495590_0000461 Ga0495590_0000461_8387_9139 250
344 3300046457 Ga0495590_0031379 Ga0495590_0031379_929_1681 250
345 3300046458 Ga0495591_001367 Ga0495591_001367_10441_11193 250
346 3300046459 Ga0495629_0007483 Ga0495629_0007483_1259_2011 250
347 3300046459 Ga0495629_0021642 Ga0495629_0021642_911_1663 250
348 3300046459 Ga0495629_0040504 Ga0495629_0040504_1387_2139 250
349 3300046459 Ga0495629_0059006 Ga0495629_0059006_1828_2580 250
350 3300046462 Ga0495651_0015253 Ga0495651_0015253_2066_2818 250
351 3300046462 Ga0495651_0019273 Ga0495651_0019273_3777_4547 250
352 3300046463 Ga0495653_0007269 Ga0495653_0007269_2647_3399 250
353 3300046463 Ga0495653_0083100 Ga0495653_0083100_108_860 250
354 3300046463 Ga0495653_0295260 Ga0495653_0295260_152_904 250
355 3300046471 Ga0495650_0022357 Ga0495650_0022357_819_1571 250
356 3300046471 Ga0495650_0085280 Ga0495650_0085280_73_825 250
357 3300046472 Ga0495580_0011377 Ga0495580_0011377_3806_4558 250
358 3300046472 Ga0495580_0043626 Ga0495580_0043626_1162_1914 250
359 3300046472 Ga0495580_0180326 Ga0495580_0180326_195_947 250
360 3300046474 Ga0495605_0011342 Ga0495605_0011342_3391_4143 250
361 3300046474 Ga0495605_0030110 Ga0495605_0030110_106_858 250
362 3300046476 Ga0495662_0020007 Ga0495662_0020007_1968_2720 250
363 3300046476 Ga0495662_0046947 Ga0495662_0046947_578_1330 250
364 3300046477 Ga0495664_0010330 Ga0495664_0010330_3646_4398 250
365 3300046477 Ga0495664_0031542 Ga0495664_0031542_1344_2096 250
366 3300046477 Ga0495664_0083051 Ga0495664_0083051_759_1511 250
367 3300046500 Ga0495596_0001178 Ga0495596_0001178_3988_4740 250
368 3300046500 Ga0495596_0004753 Ga0495596_0004753_1624_2376 250
369 3300046506 Ga0495583_0006993 Ga0495583_0006993_2107_2859 250
370 3300046507 Ga0495606_0006929 Ga0495606_0006929_378_1130 250
371 3300046507 Ga0495606_0019384 Ga0495606_0019384_3319_4095 250
372 3300046507 Ga0495606_0023043 Ga0495606_0023043_607_1359 250
373 3300046507 Ga0495606_0048519 Ga0495606_0048519_1804_2556 250
374 3300046507 Ga0495606_0116527 Ga0495606_0116527_32_784 250
375 3300046511 Ga0495608_0017411 Ga0495608_0017411_2269_3021 250
376 3300046512 Ga0495610_0002795 Ga0495610_0002795_10019_10771 250
377 3300046513 Ga0495616_0114173 Ga0495616_0114173_484_1236 250
378 3300046514 Ga0495618_0021643 Ga0495618_0021643_915_1667 250
379 3300046514 Ga0495618_0045254 Ga0495618_0045254_1949_2701 250
380 3300046515 Ga0495620_0004445 Ga0495620_0004445_6556_7308 250
381 3300046516 Ga0495628_0034018 Ga0495628_0034018_2416_3168 250
382 3300046516 Ga0495628_0036321 Ga0495628_0036321_1162_1914 250
383 3300046516 Ga0495628_0096991 Ga0495628_0096991_196_948 250
384 3300046516 Ga0495628_0145597 Ga0495628_0145597_852_1604 250
385 3300046516 Ga0495628_0263994 Ga0495628_0263994_13_765 250
386 3300046516 Ga0495628_0420193 Ga0495628_0420193_33_806 250
387 3300046517 Ga0495630_0035182 Ga0495630_0035182_2235_2987 250
388 3300046517 Ga0495630_0218955 Ga0495630_0218955_479_1231 250
389 3300046517 Ga0495630_0500707 Ga0495630_0500707_61_813 250
390 3300046524 Ga0495648_0019338 Ga0495648_0019338_2784_3536 250
391 3300046524 Ga0495648_0048222 Ga0495648_0048222_743_1495 250
392 3300046524 Ga0495648_0048496 Ga0495648_0048496_157_909 250
393 3300046524 Ga0495648_0069859 Ga0495648_0069859_1273_2025 250
394 3300046526 Ga0495666_0015639 Ga0495666_0015639_2849_3601 250
395 3300046526 Ga0495666_0022917 Ga0495666_0022917_52_804 250
396 3300046526 Ga0495666_0058033 Ga0495666_0058033_85_837 250
397 3300046529 Ga0495652_0023083 Ga0495652_0023083_943_1695 250
398 3300046529 Ga0495652_0034676 Ga0495652_0034676_2484_3236 250
399 3300046529 Ga0495652_0069274 Ga0495652_0069274_320_1072 250
400 3300046529 Ga0495652_0082246 Ga0495652_0082246_923_1696 250
401 3300046529 Ga0495652_0144340 Ga0495652_0144340_205_957 250
402 3300046531 Ga0495665_0000102 Ga0495665_0000102_32421_33173 250
403 3300046531 Ga0495665_0080276 Ga0495665_0080276_712_1464 250
404 3300046533 Ga0495640_0095936 Ga0495640_0095936_1157_1909 250
405 3300046533 Ga0495640_0316876 Ga0495640_0316876_37_789 250
406 3300046535 Ga0495586_0017713 Ga0495586_0017713_2235_2987 250
407 3300046536 Ga0495587_0004758 Ga0495587_0004758_4954_5706 250
408 3300046536 Ga0495587_0024854 Ga0495587_0024854_1449_2201 250
409 3300046536 Ga0495587_0265722 Ga0495587_0265722_15_767 250
410 3300046542 Ga0495597_0002725 Ga0495597_0002725_387_1139 250
411 3300046543 Ga0495645_0001556 Ga0495645_0001556_5168_5920 250
412 3300046543 Ga0495645_0098001 Ga0495645_0098001_1074_1826 250
413 3300046543 Ga0495645_0395503 Ga0495645_0395503_15_767 250
414 3300046557 Ga0495622_0038120 Ga0495622_0038120_529_1281 250
415 3300046642 Ga0495634_0060903 Ga0495634_0060903_1370_2143 250
416 3300046642 Ga0495634_0061852 Ga0495634_0061852_1581_2333 250
417 3300046642 Ga0495634_0258713 Ga0495634_0258713_136_888 250
418 3300046642 Ga0495634_0351554 Ga0495634_0351554_27_779 250
419 3300046642 Ga0495634_0419744 Ga0495634_0419744_24_776 250
420 3300046648 Ga0495611_0135446 Ga0495611_0135446_373_1125 250
421 3300046663 Ga0495635_0019026 Ga0495635_0019026_3616_4368 250
422 3300046663 Ga0495635_0037086 Ga0495635_0037086_2305_3057 250
423 3300046663 Ga0495635_0072029 Ga0495635_0072029_1465_2217 250
424 3300046663 Ga0495635_0109227 Ga0495635_0109227_97_870 250
425 3300046665 Ga0495661_0001989 Ga0495661_0001989_13531_14283 250
426 3300046665 Ga0495661_0007570 Ga0495661_0007570_3609_4361 250
427 3300046675 Ga0495657_0000530 Ga0495657_0000530_33059_33832 250
428 3300046675 Ga0495657_0014785 Ga0495657_0014785_3911_4663 250
429 3300046675 Ga0495657_0096285 Ga0495657_0096285_716_1486 250
430 3300046678 Ga0495599_0018743 Ga0495599_0018743_1347_2099 250
431 3300046678 Ga0495599_0043543 Ga0495599_0043543_1114_1866 250
432 3300046678 Ga0495599_0197742 Ga0495599_0197742_314_1066 250
433 3300046679 Ga0495623_0001423 Ga0495623_0001423_2429_3181 250
434 3300046679 Ga0495623_0016919 Ga0495623_0016919_952_1704 250
435 3300046679 Ga0495623_0080661 Ga0495623_0080661_100_852 250
436 3300046679 Ga0495623_0109431 Ga0495623_0109431_852_1604 250
437 3300046679 Ga0495623_0283686 Ga0495623_0283686_129_902 250
438 3300046680 Ga0495646_0022901 Ga0495646_0022901_1166_1918 250
439 3300046680 Ga0495646_0033865 Ga0495646_0033865_2300_3052 250
440 3300046680 Ga0495646_0049355 Ga0495646_0049355_372_1124 250
441 3300046680 Ga0495646_0137938 Ga0495646_0137938_602_1354 250
442 3300046684 Ga0495669_0089571 Ga0495669_0089571_93_845 250
443 3300046689 Ga0495613_0003360 Ga0495613_0003360_3852_4625 250
444 3300046689 Ga0495613_0004790 Ga0495613_0004790_9353_10105 250
445 3300046689 Ga0495613_0019046 Ga0495613_0019046_2279_3031 250
446 3300046689 Ga0495613_0024094 Ga0495613_0024094_2600_3370 250
447 3300046690 Ga0495624_0067455 Ga0495624_0067455_27_779 250
448 3300046690 Ga0495624_0100144 Ga0495624_0100144_133_885 250
449 3300046690 Ga0495624_0134628 Ga0495624_0134628_695_1447 250
450 3300046690 Ga0495624_0284520 Ga0495624_0284520_106_879 250
451 3300046692 Ga0495671_0040606 Ga0495671_0040606_985_1737 250
452 3300046692 Ga0495671_0146284 Ga0495671_0146284_258_1010 250
453 3300046694 Ga0495649_0032406 Ga0495649_0032406_1281_2033 250
454 3300046694 Ga0495649_0070560 Ga0495649_0070560_335_1087 250
455 3300046694 Ga0495649_0109614 Ga0495649_0109614_29_781 250
456 3300046794 Ga0495589_0001497 Ga0495589_0001497_9557_10309 250
457 3300046794 Ga0495589_0119925 Ga0495589_0119925_384_1136 250
458 3300046809 Ga0495600_0002290 Ga0495600_0002290_8998_9750 250
459 3300046809 Ga0495600_0006375 Ga0495600_0006375_6366_7118 250
460 3300046809 Ga0495600_0021240 Ga0495600_0021240_278_1030 250
461 3300046809 Ga0495600_0127094 Ga0495600_0127094_45_797 250
462 3300046809 Ga0495600_0132185 Ga0495600_0132185_11_781 250
463 3300046810 Ga0495660_0092369 Ga0495660_0092369_639_1391 250
464 3300047315 Ga0495581_0002915 Ga0495581_0002915_8121_8873 250
465 3300047315 Ga0495581_0015424 Ga0495581_0015424_1688_2440 250
466 3300047317 Ga0495604_0005673 Ga0495604_0005673_8980_9753 250
467 3300047317 Ga0495604_0005954 Ga0495604_0005954_4974_5726 250
468 3300047317 Ga0495604_0031737 Ga0495604_0031737_216_968 250
469 3300047317 Ga0495604_0045529 Ga0495604_0045529_1134_1886 250
470 3300047317 Ga0495604_0088548 Ga0495604_0088548_1483_2235 250
471 3300047319 Ga0495674_0018761 Ga0495674_0018761_3151_3903 250
472 3300047319 Ga0495674_0022235 Ga0495674_0022235_5068_5820 250
473 3300047319 Ga0495674_0038986 Ga0495674_0038986_1675_2427 250
474 3300047319 Ga0495674_0075942 Ga0495674_0075942_1198_1950 250
475 3300047319 Ga0495674_0208910 Ga0495674_0208910_670_1422 250
476 3300047319 Ga0495674_0219662 Ga0495674_0219662_679_1431 250
477 3300047320 Ga0495672_0037723 Ga0495672_0037723_1791_2543 250
478 3300047320 Ga0495672_0042961 Ga0495672_0042961_1255_2007 250
479 3300047321 Ga0495676_0130776 Ga0495676_0130776_333_1085 250
480 3300047322 Ga0495680_0004532 Ga0495680_0004532_4755_5507 250
481 3300047322 Ga0495680_0018779 Ga0495680_0018779_3729_4502 250
482 3300047322 Ga0495680_0025784 Ga0495680_0025784_1118_1870 250
483 3300047322 Ga0495680_0088079 Ga0495680_0088079_176_928 250
484 3300047322 Ga0495680_0112503 Ga0495680_0112503_103_855 250
485 3300047322 Ga0495680_0413607 Ga0495680_0413607_47_799 250
486 3300047323 Ga0495683_0001679 Ga0495683_0001679_9808_10560 250
487 3300047323 Ga0495683_0004837 Ga0495683_0004837_4106_4858 250
488 3300047323 Ga0495683_0013209 Ga0495683_0013209_17_769 250
489 3300047323 Ga0495683_0060731 Ga0495683_0060731_682_1434 250
490 3300047323 Ga0495683_0072409 Ga0495683_0072409_415_1167 250
491 3300047443 Ga0495687_000005 Ga0495687_000005_545432_546184 250
492 3300047443 Ga0495687_008902 Ga0495687_008902_4392_5144 250
493 3300047443 Ga0495687_011982 Ga0495687_011982_682_1434 250
494 3300047443 Ga0495687_012882 Ga0495687_012882_2541_3293 250
495 3300047444 Ga0495675_0003077 Ga0495675_0003077_1465_2217 250
496 3300047444 Ga0495675_0025690 Ga0495675_0025690_1920_2672 250
497 3300047444 Ga0495675_0054056 Ga0495675_0054056_194_946 250
498 3300047445 Ga0495677_0016088 Ga0495677_0016088_449_1201 250
499 3300047446 Ga0495679_003063 Ga0495679_003063_947_1699 250
500 3300047446 Ga0495679_004217 Ga0495679_004217_803_1555 250
501 3300047469 Ga0495673_0001572 Ga0495673_0001572_2270_3022 250
502 3300047469 Ga0495673_0015450 Ga0495673_0015450_148_900 250
503 3300047471 Ga0495684_0090832 Ga0495684_0090832_1141_1911 250
504 3300047673 Ga0495593_0015212 Ga0495593_0015212_633_1385 250
505 3300047673 Ga0495593_0023239 Ga0495593_0023239_1438_2190 250
506 3300047673 Ga0495593_0244023 Ga0495593_0244023_70_822 250
507 3300048088 Ga0495602_0012016 Ga0495602_0012016_1575_2327 250
508 3300048088 Ga0495602_0053197 Ga0495602_0053197_1586_2338 250
509 3300048088 Ga0495602_0079061 Ga0495602_0079061_38_790 250
510 3300048088 Ga0495602_0084737 Ga0495602_0084737_1365_2117 250
511 3300048088 Ga0495602_0124417 Ga0495602_0124417_971_1723 250
512 3300048089 Ga0495614_0003256 Ga0495614_0003256_3351_4103 250
513 3300048089 Ga0495614_0006309 Ga0495614_0006309_3098_3871 250
514 3300048089 Ga0495614_0013145 Ga0495614_0013145_1465_2217 250
515 3300048089 Ga0495614_0040003 Ga0495614_0040003_1141_1893 250
516 3300048091 Ga0495626_0012971 Ga0495626_0012971_148_900 250
517 3300048903 Ga0496100_0000034 Ga0496100_0000034_60846_61598 250
518 3300048903 Ga0496100_0001840 Ga0496100_0001840_7180_7932 250
519 3300048903 Ga0496100_0077536 Ga0496100_0077536_70_822 250
520 3300048904 Ga0496101_0001039 Ga0496101_0001039_15494_16246 250
521 3300048904 Ga0496101_0005083 Ga0496101_0005083_2338_3090 250
522 3300048904 Ga0496101_0052178 Ga0496101_0052178_2133_2885 250
523 3300048905 Ga0496102_0000278 Ga0496102_0000278_60866_61618 250
524 3300048905 Ga0496102_0003653 Ga0496102_0003653_10674_11438 250
525 3300048905 Ga0496102_0006172 Ga0496102_0006172_6763_7515 250
526 3300048905 Ga0496102_0024176 Ga0496102_0024176_3860_4624 250
527 3300048905 Ga0496102_0529202 Ga0496102_0529202_13_765 250
528 3300048906 Ga0496103_0000283 Ga0496103_0000283_10825_11577 250
529 3300048906 Ga0496103_0005649 Ga0496103_0005649_5859_6611 250
530 3300048906 Ga0496103_0171510 Ga0496103_0171510_84_848 250
531 3300048906 Ga0496103_0303531 Ga0496103_0303531_130_894 250
532 3300048907 Ga0496104_0022795 Ga0496104_0022795_328_1092 250
533 3300048907 Ga0496104_0062551 Ga0496104_0062551_1648_2400 250
534 3300048907 Ga0496104_0073213 Ga0496104_0073213_2005_2757 250
535 3300048907 Ga0496104_0150942 Ga0496104_0150942_1122_1874 250
536 3300048908 Ga0496105_0024753 Ga0496105_0024753_2911_3663 250
537 3300048908 Ga0496105_0060533 Ga0496105_0060533_2094_2846 250
538 3300048908 Ga0496105_0181238 Ga0496105_0181238_811_1575 250
539 3300048909 Ga0496106_0000007 Ga0496106_0000007_140885_141637 250
540 3300048909 Ga0496106_0004947 Ga0496106_0004947_2338_3090 250
541 3300048909 Ga0496106_0010465 Ga0496106_0010465_982_1746 250
542 3300048909 Ga0496106_0269781 Ga0496106_0269781_445_1197 250
543 3300048910 Ga0496107_0003924 Ga0496107_0003924_4765_5517 250
544 3300048911 Ga0496108_0318447 Ga0496108_0318447_462_1226 250
545 3300048913 Ga0496110_0008025 Ga0496110_0008025_4171_4923 250
546 3300048913 Ga0496110_0148223 Ga0496110_0148223_70_834 250
547 3300048914 Ga0496111_0004850 Ga0496111_0004850_3336_4088 250
548 3300048915 Ga0496112_0002744 Ga0496112_0002744_7387_8139 250
549 3300048915 Ga0496112_0011434 Ga0496112_0011434_1301_2053 250
550 3300048916 Ga0496113_0000400 Ga0496113_0000400_1254_2006 250
551 3300048916 Ga0496113_0002560 Ga0496113_0002560_7389_8141 250
552 3300048917 Ga0496114_0284999 Ga0496114_0284999_416_1168 250
553 3300048919 Ga0496116_0014881 Ga0496116_0014881_2537_3289 250
554 3300048920 Ga0496117_0000240 Ga0496117_0000240_60848_61600 250
555 3300048920 Ga0496117_0000700 Ga0496117_0000700_18414_19166 250
556 3300048920 Ga0496117_0036700 Ga0496117_0036700_2134_2886 250
557 3300048920 Ga0496117_0130840 Ga0496117_0130840_473_1225 250
558 3300048921 Ga0496118_0000200 Ga0496118_0000200_62110_62862 250
559 3300048921 Ga0496118_0000846 Ga0496118_0000846_40174_40926 250
560 3300048921 Ga0496118_0009268 Ga0496118_0009268_7093_7845 250
561 3300048921 Ga0496118_0011553 Ga0496118_0011553_4980_5732 250
562 3300048921 Ga0496118_0016075 Ga0496118_0016075_2771_3523 250
563 3300048921 Ga0496118_0017146 Ga0496118_0017146_456_1208 250
564 3300048921 Ga0496118_0105152 Ga0496118_0105152_634_1386 250
565 3300048922 Ga0496119_0125304 Ga0496119_0125304_608_1360 250
566 3300048923 Ga0496120_0073302 Ga0496120_0073302_615_1367 250
567 3300048923 Ga0496120_0207197 Ga0496120_0207197_29_781 250
568 3300048924 Ga0496121_0001345 Ga0496121_0001345_40887_41639 250
569 3300048924 Ga0496121_0002719 Ga0496121_0002719_12410_13162 250
570 3300048924 Ga0496121_0008105 Ga0496121_0008105_10693_11445 250
571 3300048924 Ga0496121_0008114 Ga0496121_0008114_569_1321 250
572 3300048924 Ga0496121_0023969 Ga0496121_0023969_3061_3813 250
573 3300048924 Ga0496121_0076168 Ga0496121_0076168_1805_2557 250
574 3300048927 Ga0496124_0016455 Ga0496124_0016455_1236_1988 250
575 3300048927 Ga0496124_0347230 Ga0496124_0347230_281_1033 250
576 3300048928 Ga0496125_0006528 Ga0496125_0006528_6552_7304 250
577 3300048929 Ga0496126_0000065 Ga0496126_0000065_34116_34868 250
578 3300048929 Ga0496126_0000216 Ga0496126_0000216_81034_81786 250
579 3300048929 Ga0496126_0002411 Ga0496126_0002411_9161_9913 250
580 3300048929 Ga0496126_0093198 Ga0496126_0093198_1575_2330 250
581 3300048929 Ga0496126_0405412 Ga0496126_0405412_143_895 250
582 3300049460 Ga0495682_0032652 Ga0495682_0032652_195_947 250
583 3300049569 Ga0501032_0001805 Ga0501032_0001805_235_999 250
584 3300049571 Ga0501034_0003756 Ga0501034_0003756_12003_12767 250
585 3300049571 Ga0501034_0116974 Ga0501034_0116974_1618_2403 250
586 3300049571 Ga0501034_0768014 Ga0501034_0768014_44_808 250
587 3300049572 Ga0501036_0021321 Ga0501036_0021321_2221_2985 250
588 3300049573 Ga0501037_0000284 Ga0501037_0000284_34648_35412 250
589 3300049574 Ga0501038_0000436 Ga0501038_0000436_35104_35868 250
590 3300049575 Ga0501039_0000665 Ga0501039_0000665_16032_16796 250
591 3300049579 Ga0501043_0007419 Ga0501043_0007419_1775_2539 250
592 3300049579 Ga0501043_0008543 Ga0501043_0008543_3877_4662 250
593 3300049580 Ga0501046_0003409 Ga0501046_0003409_12417_13202 250
594 3300049581 Ga0501047_0040183 Ga0501047_0040183_3327_4112 250
595 3300049586 Ga0501070_0000762 Ga0501070_0000762_11039_11803 250
596 3300049586 Ga0501070_0001401 Ga0501070_0001401_1532_2317 250
597 3300049822 Ga0501035_0032278 Ga0501035_0032278_3801_4553 250
598 3300049823 Ga0501044_0075522 Ga0501044_0075522_957_1721 250
599 3300050512 nmdc:mga0n895_391314_c1 nmdc:mga0n895_391314_c1_291_1055 250
600 3300050516 nmdc:mga0sz30_37121_c1 nmdc:mga0sz30_37121_c1_864_1628 250
601 3300061719 Ga0466962_0000180 Ga0466962_0000180_13400_14152 250
602 3300061719 Ga0466962_0016167 Ga0466962_0016167_2058_2810 250
603 3300061719 Ga0466962_0022265 Ga0466962_0022265_236_988 250
604 3300061719 Ga0466962_0169458 Ga0466962_0169458_33_821 250
605 iso_pu_bacteria 2791355406 2793977463 250
606 iso_pu_bacteria 2902792274 2902792510 250
607 iso_pu_bacteria 8047893842 8047894725 250
608 iso_pu_bacteria 8048356638 8048364324 250
609 iso_pu_bacteria 8048369669 8048371745 250
610 iso_pu_bacteria 8048379754 8048380678 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

22

179

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9863 9 247
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9798 9 247
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9777 11 247
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9742 9 247
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9639 9 247
ID Description Score Start End Superfamily
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.976 11 247 3.40.50.300
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9601 11 247 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9499 9 227 3.40.50.300
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9493 11 244 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9476 9 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2S6DDZ0-F1-model_v4 deleted 0.9956 145 241
AF-S6L2W2-F1-model_v4 deleted 0.9908 133 248
AF-A0A843JDG0-F1-model_v4 Amino acid ABC transporter ATP-binding protein 0.9868 123 247 GO:0005524
GO:0005886
GO:0015716
GO:0016887
AF-A0A651DPK3-F1-model_v4 Amino acid ABC transporter ATP-binding protein 0.9847 9 249 GO:0005524
GO:0015424
GO:0016887
AF-A0A7Y8S784-F1-model_v4 deleted 0.9827 99 248

Feature Viewer

pLDDT pTM Quality
93.09 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map