F468999

General Info

Members Datasets Scaffolds Average Seq Length
610 271 1220 121

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0044509|Ga0495641_0044509_1587_1979
Length 130
Sequence MSMQRKRLKVLEQPCCAPGAPPLRPEIAEGLARRFKALSDPTRVAIVNRLAGADEVCVCDFTLRLRLSQPTVSHHLRVLREAGLIEVSRKRGTWVFYRLVPEAVEQLAFALGGAPTPEGVLATAERTVAW

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
161 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
162 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
163 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
190 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
191 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
192 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
193 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
229 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 12.62
Rhizosphere 86.39
Stem 0
Stem Tuber 0
Unclassified 8.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0044509 3300046461 Bacteria 2047
2 JGI25404J52841_10109434 3300003659 Bacteria 580
3 Ga0070676_11004889 3300005328 Bacteria 626
4 Ga0070683_100013410 3300005329 Bacteria 7147
5 Ga0070683_100025504 3300005329 Bacteria 5310
6 Ga0070683_100032147 3300005329 Bacteria 4776
7 Ga0070683_100143319 3300005329 Bacteria 2263
8 Ga0070690_100139100 3300005330 Bacteria 1647
9 Ga0068869_100402729 3300005334 Bacteria 1126
10 Ga0068869_100741550 3300005334 Bacteria 840
11 Ga0068869_101046808 3300005334 Bacteria 712
12 Ga0070666_10301245 3300005335 Bacteria 1142
13 Ga0070680_100056108 3300005336 Bacteria 3219
14 Ga0070682_100048015 3300005337 Bacteria 2656
15 Ga0068868_100059277 3300005338 Bacteria 3028
16 Ga0070660_100101425 3300005339 Bacteria 2281
17 Ga0070660_100613418 3300005339 Bacteria 910
18 Ga0070691_10010845 3300005341 Bacteria 4159
19 Ga0070661_100502456 3300005344 Bacteria 971
20 Ga0070692_10465852 3300005345 Bacteria 812
21 Ga0070668_100171050 3300005347 Bacteria 1769
22 Ga0070668_101014888 3300005347 Bacteria 746
23 Ga0070669_100272339 3300005353 Bacteria 1354
24 Ga0070675_100441396 3300005354 Bacteria 1166
25 Ga0070671_100494457 3300005355 Bacteria 1052
26 Ga0070674_100210673 3300005356 Bacteria 1506
27 Ga0070674_100553442 3300005356 Bacteria 966
28 Ga0070674_101643076 3300005356 Unclassified 580
29 Ga0070673_100424124 3300005364 Bacteria 1193
30 Ga0070673_100793034 3300005364 Unclassified 874
31 Ga0070688_100080827 3300005365 Bacteria 2103
32 Ga0070659_100163148 3300005366 Bacteria 1823
33 Ga0070659_100306579 3300005366 Bacteria 1325
34 Ga0070703_10041167 3300005406 Bacteria 1439
35 Ga0070703_10489720 3300005406 Bacteria 551
36 Ga0070709_10101035 3300005434 Unclassified 1921
37 Ga0070714_100102425 3300005435 Bacteria 2524
38 Ga0070714_100369288 3300005435 Bacteria 1351
39 Ga0070714_101056740 3300005435 Bacteria 791
40 Ga0070710_10116164 3300005437 Bacteria 1613
41 Ga0070711_100573427 3300005439 Bacteria 939
42 Ga0070705_100029009 3300005440 Bacteria 3037
43 Ga0070705_100042479 3300005440 Bacteria 2599
44 Ga0070705_100059639 3300005440 Bacteria 2260
45 Ga0070705_100437145 3300005440 Bacteria 978
46 Ga0070705_101772343 3300005440 Bacteria 523
47 Ga0070700_100150367 3300005441 Bacteria 1592
48 Ga0070700_100150973 3300005441 Bacteria 1589
49 Ga0070700_101500189 3300005441 Bacteria 573
50 Ga0070694_100052875 3300005444 Bacteria 2747
51 Ga0070694_100079948 3300005444 Unclassified 2271
52 Ga0070694_100253693 3300005444 Bacteria 1332
53 Ga0070708_100110511 3300005445 Unclassified 2526
54 Ga0070708_100127447 3300005445 Bacteria 2354
55 Ga0070708_100309260 3300005445 Bacteria 1488
56 Ga0070663_100117771 3300005455 Unclassified 2003
57 Ga0070678_100101550 3300005456 Bacteria 2230
58 Ga0070678_100134231 3300005456 Bacteria 1971
59 Ga0070662_100231848 3300005457 Bacteria 1477
60 Ga0070662_100277279 3300005457 Unclassified 1356
61 Ga0070662_100589786 3300005457 Unclassified 934
62 Ga0070662_101169856 3300005457 Bacteria 661
63 Ga0070681_10051008 3300005458 Bacteria 4127
64 Ga0068867_100509499 3300005459 Bacteria 1036
65 Ga0068867_101976191 3300005459 Unclassified 551
66 Ga0070685_10197419 3300005466 Bacteria 1306
67 Ga0070706_100034593 3300005467 Bacteria 4667
68 Ga0070706_100035396 3300005467 Bacteria 4611
69 Ga0070706_100060030 3300005467 Bacteria 3510
70 Ga0070706_100120094 3300005467 Bacteria 2450
71 Ga0070706_101380602 3300005467 Bacteria 645
72 Ga0070707_100005156 3300005468 Bacteria 12238
73 Ga0070707_100045684 3300005468 Bacteria 4191
74 Ga0070707_100085377 3300005468 Bacteria 3051
75 Ga0070698_100006705 3300005471 Bacteria 12489
76 Ga0070698_100028549 3300005471 Bacteria 5794
77 Ga0070698_100212519 3300005471 Bacteria 1868
78 Ga0070698_100421781 3300005471 Bacteria 1269
79 Ga0070699_100021504 3300005518 Bacteria 5563
80 Ga0070699_100040412 3300005518 Bacteria 4039
81 Ga0070699_100069391 3300005518 Bacteria 3063
82 Ga0070699_100992960 3300005518 Unclassified 770
83 Ga0070679_100039580 3300005530 Bacteria 4685
84 Ga0070679_100151550 3300005530 Bacteria 2295
85 Ga0070679_101466421 3300005530 Bacteria 629
86 Ga0070684_100000684 3300005535 Bacteria 23405
87 Ga0070684_100001986 3300005535 Bacteria 15040
88 Ga0070684_100194098 3300005535 Bacteria 1848
89 Ga0070684_100306683 3300005535 Bacteria 1457
90 Ga0070684_100552451 3300005535 Bacteria 1069
91 Ga0070697_100403307 3300005536 Bacteria 1187
92 Ga0070697_100540083 3300005536 Unclassified 1022
93 Ga0070697_100949815 3300005536 Bacteria 763
94 Ga0070672_100603332 3300005543 Bacteria 956
95 Ga0070686_100054561 3300005544 Bacteria 2557
96 Ga0070695_100024539 3300005545 Bacteria 3716
97 Ga0070695_100259132 3300005545 Bacteria 1269
98 Ga0070695_100521197 3300005545 Bacteria 922
99 Ga0070695_101707091 3300005545 Bacteria 527
100 Ga0070696_100007721 3300005546 Bacteria 7183
101 Ga0070696_100190858 3300005546 Bacteria 1525
102 Ga0070693_100014448 3300005547 Bacteria 4046
103 Ga0070693_100162328 3300005547 Unclassified 1424
104 Ga0070693_100882590 3300005547 Bacteria 669
105 Ga0070704_100027613 3300005549 Bacteria 3767
106 Ga0070704_100067647 3300005549 Bacteria 2580
107 Ga0070704_100094534 3300005549 Unclassified 2236
108 Ga0070704_100118721 3300005549 Bacteria 2027
109 Ga0070704_100293055 3300005549 Bacteria 1353
110 Ga0070704_101008981 3300005549 Bacteria 753
111 Ga0068855_100069410 3300005563 Bacteria 4101
112 Ga0068855_101061149 3300005563 Bacteria 849
113 Ga0070664_100124961 3300005564 Bacteria 2255
114 Ga0070664_100196551 3300005564 Bacteria 1798
115 Ga0068857_100029780 3300005577 Bacteria 4817
116 Ga0068857_100045592 3300005577 Bacteria 3890
117 Ga0068857_100052707 3300005577 Bacteria 3609
118 Ga0068854_100208573 3300005578 Bacteria 1540
119 Ga0068854_100550184 3300005578 Bacteria 979
120 Ga0068856_100438479 3300005614 Bacteria 1327
121 Ga0070702_100036001 3300005615 Bacteria 2738
122 Ga0070702_100543333 3300005615 Bacteria 861
123 Ga0070702_100551141 3300005615 Unclassified 856
124 Ga0068852_100553347 3300005616 Bacteria 1151
125 Ga0068859_100518343 3300005617 Bacteria 1287
126 Ga0068866_10773140 3300005718 Unclassified 665
127 Ga0068861_101677555 3300005719 Unclassified 628
128 Ga0068862_100798271 3300005844 Bacteria 921
129 Ga0081455_10024464 3300005937 Bacteria 5591
130 Ga0081455_10049842 3300005937 Bacteria 3606
131 Ga0081540_1001751 3300005983 Bacteria 18248
132 Ga0081540_1021621 3300005983 Bacteria 3823
133 Ga0070717_10149036 3300006028 Bacteria 2023
134 Ga0075432_10004563 3300006058 Bacteria 4713
135 Ga0070715_10001268 3300006163 Bacteria 7239
136 Ga0070715_10090405 3300006163 Bacteria 1408
137 Ga0070716_100036800 3300006173 Unclassified 2700
138 Ga0070716_100282268 3300006173 Bacteria 1146
139 Ga0070716_101291248 3300006173 Unclassified 590
140 Ga0070716_101760810 3300006173 Bacteria 512
141 Ga0070712_100012877 3300006175 Bacteria 5328
142 Ga0070712_100499368 3300006175 Bacteria 1019
143 Ga0070712_100971970 3300006175 Bacteria 734
144 Ga0070712_101229014 3300006175 Bacteria 652
145 Ga0097621_100367966 3300006237 Unclassified 1282
146 Ga0097621_101392202 3300006237 Bacteria 664
147 Ga0068871_100502608 3300006358 Unclassified 1093
148 Ga0075428_100763441 3300006844 Bacteria 1028
149 Ga0075428_100815626 3300006844 Bacteria 991
150 Ga0075428_100887708 3300006844 Bacteria 946
151 Ga0075430_100162978 3300006846 Bacteria 1856
152 Ga0075431_100003713 3300006847 Bacteria 14835
153 Ga0075431_100048637 3300006847 Bacteria 4374
154 Ga0075433_10024251 3300006852 Bacteria 5117
155 Ga0075433_10147339 3300006852 Bacteria 2093
156 Ga0075434_100028252 3300006871 Bacteria 5509
157 Ga0075434_100050547 3300006871 Bacteria 4130
158 Ga0075429_101228928 3300006880 Bacteria 654
159 Ga0068865_100553053 3300006881 Bacteria 967
160 Ga0075436_100037100 3300006914 Bacteria 3365
161 Ga0075436_100037503 3300006914 Bacteria 3346
162 Ga0075436_101338506 3300006914 Bacteria 542
163 Ga0097620_100518337 3300006931 Bacteria 1287
164 Ga0075435_100002120 3300007076 Bacteria 13067
165 Ga0075435_100036803 3300007076 Bacteria 3892
166 Ga0075435_100225166 3300007076 Bacteria 1593
167 Ga0075435_101067570 3300007076 Bacteria 706
168 Ga0075435_101317782 3300007076 Unclassified 632
169 Ga0105244_10216776 3300009036 Bacteria 899
170 Ga0111539_10040551 3300009094 Bacteria 5603
171 Ga0111539_10659961 3300009094 Bacteria 1218
172 Ga0111539_10690205 3300009094 Bacteria 1188
173 Ga0105245_10007026 3300009098 Bacteria 9879
174 Ga0105245_10079378 3300009098 Bacteria 2996
175 Ga0105245_10513659 3300009098 Bacteria 1216
176 Ga0105245_10523082 3300009098 Bacteria 1205
177 Ga0105245_11199431 3300009098 Bacteria 807
178 Ga0105247_10174948 3300009101 Bacteria 1429
179 Ga0114129_10029118 3300009147 Bacteria 7822
180 Ga0114129_10313930 3300009147 Bacteria 2086
181 Ga0114129_10516853 3300009147 Bacteria 1557
182 Ga0114129_10922961 3300009147 Bacteria 1105
183 Ga0105243_10040489 3300009148 Bacteria 3639
184 Ga0105243_10329093 3300009148 Bacteria 1395
185 Ga0105243_10329369 3300009148 Bacteria 1394
186 Ga0105243_10473144 3300009148 Unclassified 1181
187 Ga0105243_10486406 3300009148 Bacteria 1166
188 Ga0105243_10897156 3300009148 Bacteria 881
189 Ga0105243_11004571 3300009148 Bacteria 837
190 Ga0105241_10011337 3300009174 Bacteria 6535
191 Ga0105241_10094821 3300009174 Bacteria 2361
192 Ga0105242_10226109 3300009176 Bacteria 1675
193 Ga0105242_10250413 3300009176 Bacteria 1596
194 Ga0105242_10251686 3300009176 Bacteria 1592
195 Ga0105242_12439077 3300009176 Bacteria 571
196 Ga0105242_12963912 3300009176 Bacteria 525
197 Ga0105248_11005025 3300009177 Bacteria 942
198 Ga0105249_10140861 3300009553 Bacteria 2313
199 Ga0105249_11055159 3300009553 Bacteria 882
200 Ga0105249_11558459 3300009553 Bacteria 733
201 Ga0105239_10074430 3300010375 Bacteria 3734
202 Ga0105239_10365526 3300010375 Bacteria 1630
203 Ga0105239_12804389 3300010375 Unclassified 569
204 Ga0105246_10277728 3300011119 Bacteria 1342
205 Ga0105246_10882693 3300011119 Bacteria 800
206 Ga0105246_11281462 3300011119 Bacteria 678
207 Ga0157343_1025223 3300012488 Bacteria 566
208 Ga0157371_10383026 3300013102 Bacteria 1027
209 Ga0157371_10597819 3300013102 Bacteria 820
210 Ga0157374_10476100 3300013296 Bacteria 1252
211 Ga0157374_11824319 3300013296 Bacteria 634
212 Ga0157378_10180575 3300013297 Unclassified 1985
213 Ga0157372_10198505 3300013307 Bacteria 2324
214 Ga0157372_11258103 3300013307 Bacteria 854
215 Ga0157375_10147299 3300013308 Bacteria 2486
216 Ga0157375_10510843 3300013308 Bacteria 1365
217 Ga0157375_10550921 3300013308 Unclassified 1315
218 Ga0157375_10951155 3300013308 Bacteria 1001
219 Ga0163163_10004711 3300014325 Bacteria 11685
220 Ga0163163_11082767 3300014325 Bacteria 864
221 Ga0157380_12957371 3300014326 Unclassified 541
222 Ga0157377_10014207 3300014745 Bacteria 4047
223 Ga0157377_10146100 3300014745 Bacteria 1458
224 Ga0157377_10544908 3300014745 Bacteria 818
225 Ga0157379_11885911 3300014968 Bacteria 589
226 Ga0157379_12104821 3300014968 Bacteria 559
227 Ga0157376_10739930 3300014969 Bacteria 992
228 Ga0157376_12521539 3300014969 Bacteria 554
229 Ga0207653_10020252 3300025885 Bacteria 2104
230 Ga0207692_10020707 3300025898 Unclassified 2997
231 Ga0207692_10468679 3300025898 Unclassified 795
232 Ga0207710_10338348 3300025900 Bacteria 765
233 Ga0207688_10009489 3300025901 Bacteria 5296
234 Ga0207688_10117631 3300025901 Bacteria 1548
235 Ga0207647_10505646 3300025904 Bacteria 673
236 Ga0207685_10016626 3300025905 Bacteria 2359
237 Ga0207699_10144590 3300025906 Unclassified 1566
238 Ga0207699_10759238 3300025906 Bacteria 712
239 Ga0207643_10404749 3300025908 Bacteria 863
240 Ga0207684_10024130 3300025910 Bacteria 5188
241 Ga0207684_10026251 3300025910 Bacteria 4966
242 Ga0207684_10808416 3300025910 Unclassified 792
243 Ga0207684_11201826 3300025910 Bacteria 628
244 Ga0207654_10163388 3300025911 Bacteria 1440
245 Ga0207654_10836452 3300025911 Unclassified 666
246 Ga0207707_10087689 3300025912 Bacteria 2718
247 Ga0207693_10001565 3300025915 Bacteria 20201
248 Ga0207693_10002699 3300025915 Bacteria 15380
249 Ga0207693_10013649 3300025915 Bacteria 6547
250 Ga0207663_10278137 3300025916 Unclassified 1242
251 Ga0207660_10069968 3300025917 Bacteria 2550
252 Ga0207662_10371303 3300025918 Bacteria 965
253 Ga0207662_10814641 3300025918 Bacteria 658
254 Ga0207657_10852488 3300025919 Bacteria 703
255 Ga0207649_11123874 3300025920 Bacteria 620
256 Ga0207652_10092372 3300025921 Bacteria 2662
257 Ga0207652_11011560 3300025921 Bacteria 730
258 Ga0207646_10007769 3300025922 Bacteria 10853
259 Ga0207646_10655638 3300025922 Bacteria 940
260 Ga0207646_10994889 3300025922 Bacteria 741
261 Ga0207694_11610107 3300025924 Bacteria 547
262 Ga0207687_10081674 3300025927 Bacteria 2336
263 Ga0207687_10145827 3300025927 Bacteria 1801
264 Ga0207687_10574739 3300025927 Bacteria 948
265 Ga0207700_10376816 3300025928 Bacteria 1240
266 Ga0207664_10090070 3300025929 Bacteria 2513
267 Ga0207664_10600302 3300025929 Bacteria 988
268 Ga0207664_11407707 3300025929 Unclassified 618
269 Ga0207644_10270407 3300025931 Bacteria 1362
270 Ga0207644_10779239 3300025931 Unclassified 799
271 Ga0207690_10324370 3300025932 Bacteria 1211
272 Ga0207690_10541582 3300025932 Bacteria 945
273 Ga0207706_10050317 3300025933 Bacteria 3682
274 Ga0207706_10207854 3300025933 Bacteria 1716
275 Ga0207686_10195342 3300025934 Bacteria 1445
276 Ga0207686_10422972 3300025934 Unclassified 1019
277 Ga0207686_10468945 3300025934 Bacteria 972
278 Ga0207709_10169085 3300025935 Bacteria 1532
279 Ga0207709_10361060 3300025935 Bacteria 1100
280 Ga0207709_10442690 3300025935 Bacteria 1003
281 Ga0207709_11449782 3300025935 Bacteria 569
282 Ga0207709_11614080 3300025935 Unclassified 539
283 Ga0207669_10158629 3300025937 Bacteria 1595
284 Ga0207669_11349242 3300025937 Bacteria 606
285 Ga0207665_10047764 3300025939 Bacteria 2871
286 Ga0207665_10548623 3300025939 Unclassified 898
287 Ga0207691_10922318 3300025940 Bacteria 731
288 Ga0207689_10523453 3300025942 Bacteria 995
289 Ga0207689_11358766 3300025942 Bacteria 596
290 Ga0207661_10006549 3300025944 Bacteria 8233
291 Ga0207661_10015828 3300025944 Bacteria 5556
292 Ga0207661_10103914 3300025944 Bacteria 2391
293 Ga0207661_10221387 3300025944 Bacteria 1673
294 Ga0207679_10061396 3300025945 Bacteria 2798
295 Ga0207679_10280782 3300025945 Bacteria 1428
296 Ga0207679_10584361 3300025945 Bacteria 1005
297 Ga0207679_10912554 3300025945 Bacteria 804
298 Ga0207679_12136671 3300025945 Bacteria 508
299 Ga0207667_10049377 3300025949 Bacteria 4444
300 Ga0207667_10577300 3300025949 Bacteria 1135
301 Ga0207651_10124614 3300025960 Bacteria 1961
302 Ga0207651_10601454 3300025960 Bacteria 961
303 Ga0207651_11215730 3300025960 Bacteria 677
304 Ga0207712_10327072 3300025961 Unclassified 1267
305 Ga0207668_10173608 3300025972 Bacteria 1693
306 Ga0207668_10761168 3300025972 Bacteria 855
307 Ga0207640_10156425 3300025981 Bacteria 1681
308 Ga0207640_10853036 3300025981 Bacteria 793
309 Ga0207677_10047841 3300026023 Bacteria 2875
310 Ga0207677_10215943 3300026023 Bacteria 1535
311 Ga0207703_12028269 3300026035 Bacteria 551
312 Ga0207678_10427615 3300026067 Unclassified 1149
313 Ga0207708_10275868 3300026075 Unclassified 1361
314 Ga0207708_10451602 3300026075 Bacteria 1070
315 Ga0207708_10566649 3300026075 Bacteria 959
316 Ga0207702_10145181 3300026078 Bacteria 2152
317 Ga0207648_10295562 3300026089 Bacteria 1451
318 Ga0207674_10002796 3300026116 Bacteria 21727
319 Ga0207674_10081874 3300026116 Bacteria 3230
320 Ga0207674_11212572 3300026116 Bacteria 724
321 Ga0207675_100072849 3300026118 Bacteria 3213
322 Ga0207675_102401393 3300026118 Unclassified 539
323 Ga0207683_10016453 3300026121 Bacteria 6295
324 Ga0207683_10105867 3300026121 Bacteria 2514
325 Ga0207428_10010030 3300027907 Bacteria 8477
326 Ga0207428_11183346 3300027907 Bacteria 532
327 Ga0268265_11129532 3300028380 Bacteria 779
328 Ga0268265_12265786 3300028380 Bacteria 550
329 Ga0307413_11137711 3300031824 Bacteria 676
330 Ga0307406_10142031 3300031901 Bacteria 1701
331 Ga0307409_100534354 3300031995 Bacteria 1148
332 Ga0307416_100031189 3300032002 Bacteria 4009
333 Ga0307416_102696818 3300032002 Bacteria 594
334 Ga0307414_11047607 3300032004 Bacteria 752
335 Ga0307411_12267612 3300032005 Bacteria 510
336 Ga0373930_0198080 3300034816 Bacteria 522
337 Ga0373948_0089080 3300034817 Bacteria 714
338 Ga0373950_0015098 3300034818 Unclassified 1306
339 Ga0373958_0005932 3300034819 Bacteria 1881
340 Ga0373959_0030215 3300034820 Unclassified 1090
341 Ga0373929_0001735 3300035085 Bacteria 4096
342 Ga0373940_0037519 3300035088 Unclassified 1319
343 Ga0373949_0013730 3300035090 Bacteria 1798
344 Ga0373951_0006919 3300035091 Bacteria 2589
345 Ga0373952_0001418 3300035092 Bacteria 4377
346 Ga0373932_0006013 3300035112 Bacteria 2863
347 Ga0373936_0438575 3300035113 Bacteria 603
348 Ga0373939_0032468 3300035114 Unclassified 1517
349 Ga0373939_0158103 3300035114 Bacteria 830
350 Ga0373941_0000970 3300035115 Bacteria 5935
351 Ga0373945_0019504 3300035116 Bacteria 2316
352 Ga0373960_0001084 3300035121 Bacteria 5883
353 Ga0373960_0023019 3300035121 Bacteria 1674
354 Ga0373943_0000198 3300035170 Bacteria 24537
355 Ga0373943_0202014 3300035170 Bacteria 1100
356 Ga0373946_0123736 3300035171 Bacteria 1183
357 Ga0373946_0436270 3300035171 Bacteria 665
358 Ga0373942_0003402 3300035207 Bacteria 3740
359 Ga0373961_0002138 3300035241 Bacteria 5243
360 Ga0373962_0010520 3300035242 Bacteria 2308
361 Ga0373962_0100541 3300035242 Bacteria 901
362 Ga0373931_0003024 3300035691 Bacteria 7510
363 Ga0373931_0041218 3300035691 Bacteria 2425
364 Ga0373947_0004346 3300035725 Bacteria 8317
365 Ga0373925_0003083 3300037068 Bacteria 13079
366 Ga0395899_0006610 3300037312 Bacteria 8986
367 Ga0395899_0023261 3300037312 Bacteria 4696
368 Ga0395899_0040508 3300037312 Bacteria 3483
369 Ga0395899_0062363 3300037312 Bacteria 2745
370 Ga0395899_0113021 3300037312 Bacteria 1951
371 Ga0395899_0140015 3300037312 Bacteria 1722
372 Ga0395899_0160940 3300037312 Bacteria 1586
373 Ga0395899_0173465 3300037312 Bacteria 1517
374 Ga0395899_0423605 3300037312 Bacteria 877
375 Ga0395899_0733156 3300037312 Bacteria 617
376 Ga0395899_0816737 3300037312 Bacteria 575
377 Ga0395900_0005422 3300037418 Bacteria 13365
378 Ga0395900_0019428 3300037418 Bacteria 6927
379 Ga0395900_0030236 3300037418 Bacteria 5560
380 Ga0395900_0038463 3300037418 Bacteria 4931
381 Ga0395900_0048182 3300037418 Bacteria 4389
382 Ga0395900_0050829 3300037418 Bacteria 4269
383 Ga0395900_0080840 3300037418 Bacteria 3340
384 Ga0395900_0114234 3300037418 Bacteria 2771
385 Ga0395900_0178817 3300037418 Bacteria 2157
386 Ga0395900_0319187 3300037418 Bacteria 1534
387 Ga0395900_0384009 3300037418 Bacteria 1372
388 Ga0395900_0435178 3300037418 Bacteria 1270
389 Ga0395900_0595717 3300037418 Bacteria 1046
390 Ga0395900_0834304 3300037418 Bacteria 848
391 Ga0395900_1349430 3300037418 Unclassified 626
392 Ga0395898_0002345 3300037466 Bacteria 22578
393 Ga0395898_0002841 3300037466 Bacteria 19817
394 Ga0395898_0019085 3300037466 Bacteria 6980
395 Ga0395898_0033820 3300037466 Bacteria 5098
396 Ga0395898_0061801 3300037466 Bacteria 3639
397 Ga0395898_0091201 3300037466 Bacteria 2932
398 Ga0395898_0162572 3300037466 Bacteria 2136
399 Ga0395898_0282480 3300037466 Bacteria 1583
400 Ga0395898_0446268 3300037466 Bacteria 1232
401 Ga0395898_0627074 3300037466 Unclassified 1018
402 Ga0395898_0695722 3300037466 Bacteria 958
403 Ga0395898_0826057 3300037466 Bacteria 866
404 Ga0395898_1440151 3300037466 Bacteria 616
405 Ga0395905_0050765 3300037471 Bacteria 3885
406 Ga0395905_0078064 3300037471 Bacteria 3102
407 Ga0395905_0172102 3300037471 Bacteria 2034
408 Ga0395905_0390126 3300037471 Bacteria 1287
409 Ga0395905_0820858 3300037471 Bacteria 833
410 Ga0395905_0960139 3300037471 Bacteria 758
411 Ga0395905_1472837 3300037471 Bacteria 585
412 Ga0395901_0001749 3300038443 Bacteria 22444
413 Ga0395901_0003365 3300038443 Bacteria 16107
414 Ga0395901_0012793 3300038443 Bacteria 8510
415 Ga0395901_0018530 3300038443 Bacteria 7107
416 Ga0395901_0031972 3300038443 Bacteria 5429
417 Ga0395901_0034995 3300038443 Bacteria 5189
418 Ga0395901_0048014 3300038443 Bacteria 4433
419 Ga0395901_0051234 3300038443 Bacteria 4291
420 Ga0395901_0059438 3300038443 Bacteria 3977
421 Ga0395901_0063270 3300038443 Bacteria 3850
422 Ga0395901_0159131 3300038443 Bacteria 2372
423 Ga0395901_0280987 3300038443 Bacteria 1729
424 Ga0395901_0282761 3300038443 Bacteria 1723
425 Ga0395901_0546432 3300038443 Bacteria 1174
426 Ga0395901_0583353 3300038443 Archaea 1129
427 Ga0395901_0713372 3300038443 Bacteria 999
428 Ga0395901_0729891 3300038443 Bacteria 985
429 Ga0395901_0800475 3300038443 Unclassified 931
430 Ga0395901_0996577 3300038443 Bacteria 814
431 Ga0395901_1528200 3300038443 Bacteria 623
432 Ga0451800_1345916 3300041459 Bacteria 702
433 Ga0451802_0822459 3300041460 Bacteria 756
434 Ga0451802_2128500 3300041460 Bacteria 706
435 Ga0451806_839126 3300041462 Bacteria 529
436 Ga0451839_0719861 3300041496 Bacteria 871
437 Ga0451855_1019197 3300041511 Bacteria 928
438 Ga0451853_0167458 3300041512 Bacteria 2818
439 Ga0451853_1282942 3300041512 Unclassified 667
440 Ga0451853_3569097 3300041512 Bacteria 2229
441 Ga0466964_0004300 3300044706 Bacteria 5252
442 Ga0466960_0041348 3300044901 Bacteria 2184
443 Ga0466967_0440241 3300045976 Unclassified 1273
444 Ga0495603_0000081 3300046455 Bacteria 42501
445 Ga0495603_0053846 3300046455 Bacteria 2387
446 Ga0495603_0244533 3300046455 Bacteria 1033
447 Ga0495641_0003826 3300046461 Bacteria 10997
448 Ga0495641_0057198 3300046461 Bacteria 1767
449 Ga0495580_0101918 3300046472 Bacteria 1996
450 Ga0495582_0018421 3300046473 Bacteria 3818
451 Ga0495582_0071746 3300046473 Bacteria 1916
452 Ga0495582_0080117 3300046473 Bacteria 1813
453 Ga0495639_0065755 3300046475 Bacteria 1668
454 Ga0495639_0281235 3300046475 Bacteria 827
455 Ga0495662_0305656 3300046476 Bacteria 782
456 Ga0495584_0128785 3300046491 Bacteria 1284
457 Ga0495584_0447932 3300046491 Bacteria 657
458 Ga0495585_0052642 3300046492 Bacteria 2254
459 Ga0495594_0000307 3300046499 Bacteria 24065
460 Ga0495596_0076840 3300046500 Bacteria 1297
461 Ga0495607_0181298 3300046501 Bacteria 1056
462 Ga0495630_0284385 3300046517 Bacteria 1263
463 Ga0495630_0417370 3300046517 Bacteria 1028
464 Ga0495630_0871924 3300046517 Bacteria 686
465 Ga0495665_0034868 3300046531 Bacteria 2691
466 Ga0495665_0463554 3300046531 Bacteria 640
467 Ga0495586_0043183 3300046535 Bacteria 2429
468 Ga0495609_0413415 3300046538 Bacteria 539
469 Ga0495597_0154235 3300046542 Bacteria 940
470 Ga0495622_0093340 3300046557 Bacteria 1382
471 Ga0495656_0725920 3300046615 Bacteria 535
472 Ga0495668_0439526 3300046616 Bacteria 718
473 Ga0495611_0387831 3300046648 Bacteria 639
474 Ga0495659_0261873 3300046664 Bacteria 723
475 Ga0495659_0263897 3300046664 Bacteria 720
476 Ga0495659_0404418 3300046664 Bacteria 590
477 Ga0495661_0104843 3300046665 Bacteria 1585
478 Ga0495588_0001033 3300046674 Bacteria 12111
479 Ga0495588_0052936 3300046674 Bacteria 2093
480 Ga0495588_0587418 3300046674 Bacteria 583
481 Ga0495647_0572154 3300046681 Bacteria 529
482 Ga0495658_0117512 3300046683 Bacteria 1605
483 Ga0495658_0693100 3300046683 Bacteria 652
484 Ga0495658_0947296 3300046683 Bacteria 550
485 Ga0495669_0153699 3300046684 Bacteria 1090
486 Ga0495613_0040978 3300046689 Bacteria 3430
487 Ga0495613_0380535 3300046689 Bacteria 965
488 Ga0495589_0027443 3300046794 Bacteria 2879
489 Ga0495589_0189097 3300046794 Bacteria 975
490 Ga0495581_0000487 3300047315 Bacteria 20216
491 Ga0495581_0298666 3300047315 Bacteria 941
492 Ga0495581_0440462 3300047315 Bacteria 759
493 Ga0495636_0613156 3300047318 Bacteria 533
494 Ga0495676_0004078 3300047321 Bacteria 13311
495 Ga0495676_0066957 3300047321 Bacteria 2780
496 Ga0495676_0143676 3300047321 Bacteria 1707
497 Ga0495676_0304427 3300047321 Bacteria 1074
498 Ga0495676_0887803 3300047321 Bacteria 571
499 Ga0495683_0184447 3300047323 Bacteria 951
500 Ga0495615_0069024 3300048090 Bacteria 949
501 Ga0495626_0143873 3300048091 Bacteria 1010
502 Ga0496100_0011917 3300048903 Bacteria 4965
503 Ga0496100_0055123 3300048903 Bacteria 2596
504 Ga0496100_0258824 3300048903 Bacteria 1290
505 Ga0496101_0031327 3300048904 Bacteria 3737
506 Ga0496101_0094013 3300048904 Bacteria 2234
507 Ga0496101_0169586 3300048904 Bacteria 1677
508 Ga0496101_0183203 3300048904 Bacteria 1613
509 Ga0496101_0252396 3300048904 Unclassified 1374
510 Ga0496101_0705671 3300048904 Bacteria 796
511 Ga0496102_0011781 3300048905 Bacteria 7545
512 Ga0496102_0048590 3300048905 Bacteria 3858
513 Ga0496102_1399737 3300048905 Bacteria 618
514 Ga0496103_0008537 3300048906 Bacteria 6088
515 Ga0496103_0153167 3300048906 Bacteria 1477
516 Ga0496104_0000584 3300048907 Bacteria 31102
517 Ga0496104_0005573 3300048907 Bacteria 11024
518 Ga0496104_0519131 3300048907 Bacteria 1102
519 Ga0496104_0845123 3300048907 Bacteria 821
520 Ga0496105_0003054 3300048908 Bacteria 12300
521 Ga0496105_0065588 3300048908 Bacteria 2996
522 Ga0496106_0009933 3300048909 Bacteria 7028
523 Ga0496106_0361098 3300048909 Bacteria 1167
524 Ga0496106_0424810 3300048909 Bacteria 1068
525 Ga0496107_0032156 3300048910 Bacteria 3749
526 Ga0496107_0036533 3300048910 Bacteria 3523
527 Ga0496107_0093935 3300048910 Bacteria 2194
528 Ga0496107_0209986 3300048910 Bacteria 1448
529 Ga0496107_0587084 3300048910 Bacteria 824
530 Ga0496107_0664535 3300048910 Bacteria 768
531 Ga0496108_0008803 3300048911 Bacteria 8181
532 Ga0496108_0043980 3300048911 Bacteria 3730
533 Ga0496109_0003529 3300048912 Bacteria 13051
534 Ga0496109_0005961 3300048912 Bacteria 10233
535 Ga0496109_0023641 3300048912 Bacteria 5455
536 Ga0496109_0035404 3300048912 Bacteria 4503
537 Ga0496109_0037837 3300048912 Bacteria 4360
538 Ga0496109_0152297 3300048912 Bacteria 2165
539 Ga0496109_1769956 3300048912 Bacteria 551
540 Ga0496110_0000277 3300048913 Bacteria 33321
541 Ga0496110_0021750 3300048913 Bacteria 5435
542 Ga0496110_0107751 3300048913 Bacteria 2501
543 Ga0496110_0119041 3300048913 Bacteria 2378
544 Ga0496110_0292673 3300048913 Bacteria 1483
545 Ga0496110_0296895 3300048913 Bacteria 1472
546 Ga0496110_0406743 3300048913 Bacteria 1241
547 Ga0496110_0758124 3300048913 Bacteria 874
548 Ga0496111_0000676 3300048914 Bacteria 17925
549 Ga0496111_0010107 3300048914 Bacteria 6318
550 Ga0496111_0057458 3300048914 Bacteria 2817
551 Ga0496111_0100153 3300048914 Bacteria 2128
552 Ga0496111_0123811 3300048914 Bacteria 1911
553 Ga0496111_0232429 3300048914 Bacteria 1369
554 Ga0496111_0375079 3300048914 Bacteria 1052
555 Ga0496112_0000434 3300048915 Bacteria 27667
556 Ga0496112_0038570 3300048915 Bacteria 4665
557 Ga0496112_0063344 3300048915 Bacteria 3647
558 Ga0496112_0101817 3300048915 Bacteria 2842
559 Ga0496112_0230513 3300048915 Bacteria 1806
560 Ga0496112_0612641 3300048915 Bacteria 1020
561 Ga0496112_1457009 3300048915 Bacteria 599
562 Ga0496112_1565832 3300048915 Bacteria 572
563 Ga0496113_0002971 3300048916 Bacteria 10030
564 Ga0496113_0007414 3300048916 Bacteria 7057
565 Ga0496113_0019937 3300048916 Bacteria 4703
566 Ga0496113_0167364 3300048916 Bacteria 1740
567 Ga0496113_0208616 3300048916 Bacteria 1555
568 Ga0496113_0281216 3300048916 Bacteria 1331
569 Ga0496113_0298926 3300048916 Bacteria 1289
570 Ga0496114_0015083 3300048917 Bacteria 6213
571 Ga0496114_0068309 3300048917 Bacteria 2983
572 Ga0496114_1673413 3300048917 Bacteria 524
573 Ga0496115_0018985 3300048918 Bacteria 5286
574 Ga0496115_0177949 3300048918 Bacteria 1759
575 Ga0501031_0239863 3300049568 Bacteria 1179
576 Ga0501046_0736033 3300049580 Bacteria 693
577 Ga0501067_0015893 3300049583 Bacteria 4163
578 Ga0501068_0726239 3300049584 Bacteria 650
579 Ga0501069_0075767 3300049585 Bacteria 1890
580 Ga0501072_0215088 3300049588 Bacteria 1532
581 Ga0501074_0451300 3300049590 Bacteria 912
582 Ga0501075_1256967 3300049591 Bacteria 561
583 Ga0501076_0277945 3300049592 Bacteria 1372
584 Ga0501079_0344223 3300049741 Bacteria 1168
585 Ga0501081_0209313 3300049743 Bacteria 1416
586 Ga0501081_0652323 3300049743 Bacteria 789
587 nmdc:mga05p37_109008_c1 3300050507 Bacteria 3406
588 nmdc:mga05p37_10940_c1 3300050507 Bacteria 10774
589 nmdc:mga09592_225874_c1 3300050508 Bacteria 1622
590 nmdc:mga0qj67_1044496_c1 3300050509 Bacteria 640
591 nmdc:mga06r32_249116_c1 3300050510 Bacteria 1764
592 nmdc:mga06r32_5856_c1 3300050510 Bacteria 11062
593 nmdc:mga08y16_34908_c1 3300050511 Bacteria 5284
594 nmdc:mga08y16_382388_c1 3300050511 Bacteria 1443
595 nmdc:mga08y16_760509_c1 3300050511 Bacteria 964
596 nmdc:mga0n895_11434_c1 3300050512 Bacteria 7919
597 nmdc:mga0n895_463002_c1 3300050512 Bacteria 1280
598 nmdc:mga0rr50_122656_c1 3300050513 Bacteria 2071
599 nmdc:mga0rr50_1285552_c1 3300050513 Bacteria 621
600 nmdc:mga0rr50_3658_c1 3300050513 Bacteria 8900
601 nmdc:mga0rr50_786934_c1 3300050513 Bacteria 812
602 nmdc:mga08x19_20789_c1 3300050514 Bacteria 4046
603 nmdc:mga08x19_9102_c1 3300050514 Bacteria 5928
604 nmdc:mga0a205_158740_c1 3300050515 Bacteria 2159
605 nmdc:mga0a205_6926_c1 3300050515 Bacteria 10250
606 Ga0495601_0948638 3300053077 Bacteria 542
607 Ga0495655_0069894 3300053083 Bacteria 979
608 Ga0500566_0373875 3300053094 Unclassified 646
609 Ga0501084_0514708 3300054114 Bacteria 1012
610 Ga0501082_0206534 3300060353 Bacteria 1709
611 Ga0495641_0044509
612 JGI25404J52841_10109434
613 Ga0070676_11004889
614 Ga0070683_100013410
615 Ga0070683_100025504
616 Ga0070683_100032147
617 Ga0070683_100143319
618 Ga0070690_100139100
619 Ga0068869_100402729
620 Ga0068869_100741550
621 Ga0068869_101046808
622 Ga0070666_10301245
623 Ga0070680_100056108
624 Ga0070682_100048015
625 Ga0068868_100059277
626 Ga0070660_100101425
627 Ga0070660_100613418
628 Ga0070691_10010845
629 Ga0070661_100502456
630 Ga0070692_10465852
631 Ga0070668_100171050
632 Ga0070668_101014888
633 Ga0070669_100272339
634 Ga0070675_100441396
635 Ga0070671_100494457
636 Ga0070674_100210673
637 Ga0070674_100553442
638 Ga0070674_101643076
639 Ga0070673_100424124
640 Ga0070673_100793034
641 Ga0070688_100080827
642 Ga0070659_100163148
643 Ga0070659_100306579
644 Ga0070703_10041167
645 Ga0070703_10489720
646 Ga0070709_10101035
647 Ga0070714_100102425
648 Ga0070714_100369288
649 Ga0070714_101056740
650 Ga0070710_10116164
651 Ga0070711_100573427
652 Ga0070705_100029009
653 Ga0070705_100042479
654 Ga0070705_100059639
655 Ga0070705_100437145
656 Ga0070705_101772343
657 Ga0070700_100150367
658 Ga0070700_100150973
659 Ga0070700_101500189
660 Ga0070694_100052875
661 Ga0070694_100079948
662 Ga0070694_100253693
663 Ga0070708_100110511
664 Ga0070708_100127447
665 Ga0070708_100309260
666 Ga0070663_100117771
667 Ga0070678_100101550
668 Ga0070678_100134231
669 Ga0070662_100231848
670 Ga0070662_100277279
671 Ga0070662_100589786
672 Ga0070662_101169856
673 Ga0070681_10051008
674 Ga0068867_100509499
675 Ga0068867_101976191
676 Ga0070685_10197419
677 Ga0070706_100034593
678 Ga0070706_100035396
679 Ga0070706_100060030
680 Ga0070706_100120094
681 Ga0070706_101380602
682 Ga0070707_100005156
683 Ga0070707_100045684
684 Ga0070707_100085377
685 Ga0070698_100006705
686 Ga0070698_100028549
687 Ga0070698_100212519
688 Ga0070698_100421781
689 Ga0070699_100021504
690 Ga0070699_100040412
691 Ga0070699_100069391
692 Ga0070699_100992960
693 Ga0070679_100039580
694 Ga0070679_100151550
695 Ga0070679_101466421
696 Ga0070684_100000684
697 Ga0070684_100001986
698 Ga0070684_100194098
699 Ga0070684_100306683
700 Ga0070684_100552451
701 Ga0070697_100403307
702 Ga0070697_100540083
703 Ga0070697_100949815
704 Ga0070672_100603332
705 Ga0070686_100054561
706 Ga0070695_100024539
707 Ga0070695_100259132
708 Ga0070695_100521197
709 Ga0070695_101707091
710 Ga0070696_100007721
711 Ga0070696_100190858
712 Ga0070693_100014448
713 Ga0070693_100162328
714 Ga0070693_100882590
715 Ga0070704_100027613
716 Ga0070704_100067647
717 Ga0070704_100094534
718 Ga0070704_100118721
719 Ga0070704_100293055
720 Ga0070704_101008981
721 Ga0068855_100069410
722 Ga0068855_101061149
723 Ga0070664_100124961
724 Ga0070664_100196551
725 Ga0068857_100029780
726 Ga0068857_100045592
727 Ga0068857_100052707
728 Ga0068854_100208573
729 Ga0068854_100550184
730 Ga0068856_100438479
731 Ga0070702_100036001
732 Ga0070702_100543333
733 Ga0070702_100551141
734 Ga0068852_100553347
735 Ga0068859_100518343
736 Ga0068866_10773140
737 Ga0068861_101677555
738 Ga0068862_100798271
739 Ga0081455_10024464
740 Ga0081455_10049842
741 Ga0081540_1001751
742 Ga0081540_1021621
743 Ga0070717_10149036
744 Ga0075432_10004563
745 Ga0070715_10001268
746 Ga0070715_10090405
747 Ga0070716_100036800
748 Ga0070716_100282268
749 Ga0070716_101291248
750 Ga0070716_101760810
751 Ga0070712_100012877
752 Ga0070712_100499368
753 Ga0070712_100971970
754 Ga0070712_101229014
755 Ga0097621_100367966
756 Ga0097621_101392202
757 Ga0068871_100502608
758 Ga0075428_100763441
759 Ga0075428_100815626
760 Ga0075428_100887708
761 Ga0075430_100162978
762 Ga0075431_100003713
763 Ga0075431_100048637
764 Ga0075433_10024251
765 Ga0075433_10147339
766 Ga0075434_100028252
767 Ga0075434_100050547
768 Ga0075429_101228928
769 Ga0068865_100553053
770 Ga0075436_100037100
771 Ga0075436_100037503
772 Ga0075436_101338506
773 Ga0097620_100518337
774 Ga0075435_100002120
775 Ga0075435_100036803
776 Ga0075435_100225166
777 Ga0075435_101067570
778 Ga0075435_101317782
779 Ga0105244_10216776
780 Ga0111539_10040551
781 Ga0111539_10659961
782 Ga0111539_10690205
783 Ga0105245_10007026
784 Ga0105245_10079378
785 Ga0105245_10513659
786 Ga0105245_10523082
787 Ga0105245_11199431
788 Ga0105247_10174948
789 Ga0114129_10029118
790 Ga0114129_10313930
791 Ga0114129_10516853
792 Ga0114129_10922961
793 Ga0105243_10040489
794 Ga0105243_10329093
795 Ga0105243_10329369
796 Ga0105243_10473144
797 Ga0105243_10486406
798 Ga0105243_10897156
799 Ga0105243_11004571
800 Ga0105241_10011337
801 Ga0105241_10094821
802 Ga0105242_10226109
803 Ga0105242_10250413
804 Ga0105242_10251686
805 Ga0105242_12439077
806 Ga0105242_12963912
807 Ga0105248_11005025
808 Ga0105249_10140861
809 Ga0105249_11055159
810 Ga0105249_11558459
811 Ga0105239_10074430
812 Ga0105239_10365526
813 Ga0105239_12804389
814 Ga0105246_10277728
815 Ga0105246_10882693
816 Ga0105246_11281462
817 Ga0157343_1025223
818 Ga0157371_10383026
819 Ga0157371_10597819
820 Ga0157374_10476100
821 Ga0157374_11824319
822 Ga0157378_10180575
823 Ga0157372_10198505
824 Ga0157372_11258103
825 Ga0157375_10147299
826 Ga0157375_10510843
827 Ga0157375_10550921
828 Ga0157375_10951155
829 Ga0163163_10004711
830 Ga0163163_11082767
831 Ga0157380_12957371
832 Ga0157377_10014207
833 Ga0157377_10146100
834 Ga0157377_10544908
835 Ga0157379_11885911
836 Ga0157379_12104821
837 Ga0157376_10739930
838 Ga0157376_12521539
839 Ga0207653_10020252
840 Ga0207692_10020707
841 Ga0207692_10468679
842 Ga0207710_10338348
843 Ga0207688_10009489
844 Ga0207688_10117631
845 Ga0207647_10505646
846 Ga0207685_10016626
847 Ga0207699_10144590
848 Ga0207699_10759238
849 Ga0207643_10404749
850 Ga0207684_10024130
851 Ga0207684_10026251
852 Ga0207684_10808416
853 Ga0207684_11201826
854 Ga0207654_10163388
855 Ga0207654_10836452
856 Ga0207707_10087689
857 Ga0207693_10001565
858 Ga0207693_10002699
859 Ga0207693_10013649
860 Ga0207663_10278137
861 Ga0207660_10069968
862 Ga0207662_10371303
863 Ga0207662_10814641
864 Ga0207657_10852488
865 Ga0207649_11123874
866 Ga0207652_10092372
867 Ga0207652_11011560
868 Ga0207646_10007769
869 Ga0207646_10655638
870 Ga0207646_10994889
871 Ga0207694_11610107
872 Ga0207687_10081674
873 Ga0207687_10145827
874 Ga0207687_10574739
875 Ga0207700_10376816
876 Ga0207664_10090070
877 Ga0207664_10600302
878 Ga0207664_11407707
879 Ga0207644_10270407
880 Ga0207644_10779239
881 Ga0207690_10324370
882 Ga0207690_10541582
883 Ga0207706_10050317
884 Ga0207706_10207854
885 Ga0207686_10195342
886 Ga0207686_10422972
887 Ga0207686_10468945
888 Ga0207709_10169085
889 Ga0207709_10361060
890 Ga0207709_10442690
891 Ga0207709_11449782
892 Ga0207709_11614080
893 Ga0207669_10158629
894 Ga0207669_11349242
895 Ga0207665_10047764
896 Ga0207665_10548623
897 Ga0207691_10922318
898 Ga0207689_10523453
899 Ga0207689_11358766
900 Ga0207661_10006549
901 Ga0207661_10015828
902 Ga0207661_10103914
903 Ga0207661_10221387
904 Ga0207679_10061396
905 Ga0207679_10280782
906 Ga0207679_10584361
907 Ga0207679_10912554
908 Ga0207679_12136671
909 Ga0207667_10049377
910 Ga0207667_10577300
911 Ga0207651_10124614
912 Ga0207651_10601454
913 Ga0207651_11215730
914 Ga0207712_10327072
915 Ga0207668_10173608
916 Ga0207668_10761168
917 Ga0207640_10156425
918 Ga0207640_10853036
919 Ga0207677_10047841
920 Ga0207677_10215943
921 Ga0207703_12028269
922 Ga0207678_10427615
923 Ga0207708_10275868
924 Ga0207708_10451602
925 Ga0207708_10566649
926 Ga0207702_10145181
927 Ga0207648_10295562
928 Ga0207674_10002796
929 Ga0207674_10081874
930 Ga0207674_11212572
931 Ga0207675_100072849
932 Ga0207675_102401393
933 Ga0207683_10016453
934 Ga0207683_10105867
935 Ga0207428_10010030
936 Ga0207428_11183346
937 Ga0268265_11129532
938 Ga0268265_12265786
939 Ga0307413_11137711
940 Ga0307406_10142031
941 Ga0307409_100534354
942 Ga0307416_100031189
943 Ga0307416_102696818
944 Ga0307414_11047607
945 Ga0307411_12267612
946 Ga0373930_0198080
947 Ga0373948_0089080
948 Ga0373950_0015098
949 Ga0373958_0005932
950 Ga0373959_0030215
951 Ga0373929_0001735
952 Ga0373940_0037519
953 Ga0373949_0013730
954 Ga0373951_0006919
955 Ga0373952_0001418
956 Ga0373932_0006013
957 Ga0373936_0438575
958 Ga0373939_0032468
959 Ga0373939_0158103
960 Ga0373941_0000970
961 Ga0373945_0019504
962 Ga0373960_0001084
963 Ga0373960_0023019
964 Ga0373943_0000198
965 Ga0373943_0202014
966 Ga0373946_0123736
967 Ga0373946_0436270
968 Ga0373942_0003402
969 Ga0373961_0002138
970 Ga0373962_0010520
971 Ga0373962_0100541
972 Ga0373931_0003024
973 Ga0373931_0041218
974 Ga0373947_0004346
975 Ga0373925_0003083
976 Ga0395899_0006610
977 Ga0395899_0023261
978 Ga0395899_0040508
979 Ga0395899_0062363
980 Ga0395899_0113021
981 Ga0395899_0140015
982 Ga0395899_0160940
983 Ga0395899_0173465
984 Ga0395899_0423605
985 Ga0395899_0733156
986 Ga0395899_0816737
987 Ga0395900_0005422
988 Ga0395900_0019428
989 Ga0395900_0030236
990 Ga0395900_0038463
991 Ga0395900_0048182
992 Ga0395900_0050829
993 Ga0395900_0080840
994 Ga0395900_0114234
995 Ga0395900_0178817
996 Ga0395900_0319187
997 Ga0395900_0384009
998 Ga0395900_0435178
999 Ga0395900_0595717
1000 Ga0395900_0834304
1001 Ga0395900_1349430
1002 Ga0395898_0002345
1003 Ga0395898_0002841
1004 Ga0395898_0019085
1005 Ga0395898_0033820
1006 Ga0395898_0061801
1007 Ga0395898_0091201
1008 Ga0395898_0162572
1009 Ga0395898_0282480
1010 Ga0395898_0446268
1011 Ga0395898_0627074
1012 Ga0395898_0695722
1013 Ga0395898_0826057
1014 Ga0395898_1440151
1015 Ga0395905_0050765
1016 Ga0395905_0078064
1017 Ga0395905_0172102
1018 Ga0395905_0390126
1019 Ga0395905_0820858
1020 Ga0395905_0960139
1021 Ga0395905_1472837
1022 Ga0395901_0001749
1023 Ga0395901_0003365
1024 Ga0395901_0012793
1025 Ga0395901_0018530
1026 Ga0395901_0031972
1027 Ga0395901_0034995
1028 Ga0395901_0048014
1029 Ga0395901_0051234
1030 Ga0395901_0059438
1031 Ga0395901_0063270
1032 Ga0395901_0159131
1033 Ga0395901_0280987
1034 Ga0395901_0282761
1035 Ga0395901_0546432
1036 Ga0395901_0583353
1037 Ga0395901_0713372
1038 Ga0395901_0729891
1039 Ga0395901_0800475
1040 Ga0395901_0996577
1041 Ga0395901_1528200
1042 Ga0451800_1345916
1043 Ga0451802_0822459
1044 Ga0451802_2128500
1045 Ga0451806_839126
1046 Ga0451839_0719861
1047 Ga0451855_1019197
1048 Ga0451853_0167458
1049 Ga0451853_1282942
1050 Ga0451853_3569097
1051 Ga0466964_0004300
1052 Ga0466960_0041348
1053 Ga0466967_0440241
1054 Ga0495603_0000081
1055 Ga0495603_0053846
1056 Ga0495603_0244533
1057 Ga0495641_0003826
1058 Ga0495641_0057198
1059 Ga0495580_0101918
1060 Ga0495582_0018421
1061 Ga0495582_0071746
1062 Ga0495582_0080117
1063 Ga0495639_0065755
1064 Ga0495639_0281235
1065 Ga0495662_0305656
1066 Ga0495584_0128785
1067 Ga0495584_0447932
1068 Ga0495585_0052642
1069 Ga0495594_0000307
1070 Ga0495596_0076840
1071 Ga0495607_0181298
1072 Ga0495630_0284385
1073 Ga0495630_0417370
1074 Ga0495630_0871924
1075 Ga0495665_0034868
1076 Ga0495665_0463554
1077 Ga0495586_0043183
1078 Ga0495609_0413415
1079 Ga0495597_0154235
1080 Ga0495622_0093340
1081 Ga0495656_0725920
1082 Ga0495668_0439526
1083 Ga0495611_0387831
1084 Ga0495659_0261873
1085 Ga0495659_0263897
1086 Ga0495659_0404418
1087 Ga0495661_0104843
1088 Ga0495588_0001033
1089 Ga0495588_0052936
1090 Ga0495588_0587418
1091 Ga0495647_0572154
1092 Ga0495658_0117512
1093 Ga0495658_0693100
1094 Ga0495658_0947296
1095 Ga0495669_0153699
1096 Ga0495613_0040978
1097 Ga0495613_0380535
1098 Ga0495589_0027443
1099 Ga0495589_0189097
1100 Ga0495581_0000487
1101 Ga0495581_0298666
1102 Ga0495581_0440462
1103 Ga0495636_0613156
1104 Ga0495676_0004078
1105 Ga0495676_0066957
1106 Ga0495676_0143676
1107 Ga0495676_0304427
1108 Ga0495676_0887803
1109 Ga0495683_0184447
1110 Ga0495615_0069024
1111 Ga0495626_0143873
1112 Ga0496100_0011917
1113 Ga0496100_0055123
1114 Ga0496100_0258824
1115 Ga0496101_0031327
1116 Ga0496101_0094013
1117 Ga0496101_0169586
1118 Ga0496101_0183203
1119 Ga0496101_0252396
1120 Ga0496101_0705671
1121 Ga0496102_0011781
1122 Ga0496102_0048590
1123 Ga0496102_1399737
1124 Ga0496103_0008537
1125 Ga0496103_0153167
1126 Ga0496104_0000584
1127 Ga0496104_0005573
1128 Ga0496104_0519131
1129 Ga0496104_0845123
1130 Ga0496105_0003054
1131 Ga0496105_0065588
1132 Ga0496106_0009933
1133 Ga0496106_0361098
1134 Ga0496106_0424810
1135 Ga0496107_0032156
1136 Ga0496107_0036533
1137 Ga0496107_0093935
1138 Ga0496107_0209986
1139 Ga0496107_0587084
1140 Ga0496107_0664535
1141 Ga0496108_0008803
1142 Ga0496108_0043980
1143 Ga0496109_0003529
1144 Ga0496109_0005961
1145 Ga0496109_0023641
1146 Ga0496109_0035404
1147 Ga0496109_0037837
1148 Ga0496109_0152297
1149 Ga0496109_1769956
1150 Ga0496110_0000277
1151 Ga0496110_0021750
1152 Ga0496110_0107751
1153 Ga0496110_0119041
1154 Ga0496110_0292673
1155 Ga0496110_0296895
1156 Ga0496110_0406743
1157 Ga0496110_0758124
1158 Ga0496111_0000676
1159 Ga0496111_0010107
1160 Ga0496111_0057458
1161 Ga0496111_0100153
1162 Ga0496111_0123811
1163 Ga0496111_0232429
1164 Ga0496111_0375079
1165 Ga0496112_0000434
1166 Ga0496112_0038570
1167 Ga0496112_0063344
1168 Ga0496112_0101817
1169 Ga0496112_0230513
1170 Ga0496112_0612641
1171 Ga0496112_1457009
1172 Ga0496112_1565832
1173 Ga0496113_0002971
1174 Ga0496113_0007414
1175 Ga0496113_0019937
1176 Ga0496113_0167364
1177 Ga0496113_0208616
1178 Ga0496113_0281216
1179 Ga0496113_0298926
1180 Ga0496114_0015083
1181 Ga0496114_0068309
1182 Ga0496114_1673413
1183 Ga0496115_0018985
1184 Ga0496115_0177949
1185 Ga0501031_0239863
1186 Ga0501046_0736033
1187 Ga0501067_0015893
1188 Ga0501068_0726239
1189 Ga0501069_0075767
1190 Ga0501072_0215088
1191 Ga0501074_0451300
1192 Ga0501075_1256967
1193 Ga0501076_0277945
1194 Ga0501079_0344223
1195 Ga0501081_0209313
1196 Ga0501081_0652323
1197 nmdc:mga05p37_109008_c1
1198 nmdc:mga05p37_10940_c1
1199 nmdc:mga09592_225874_c1
1200 nmdc:mga0qj67_1044496_c1
1201 nmdc:mga06r32_249116_c1
1202 nmdc:mga06r32_5856_c1
1203 nmdc:mga08y16_34908_c1
1204 nmdc:mga08y16_382388_c1
1205 nmdc:mga08y16_760509_c1
1206 nmdc:mga0n895_11434_c1
1207 nmdc:mga0n895_463002_c1
1208 nmdc:mga0rr50_122656_c1
1209 nmdc:mga0rr50_1285552_c1
1210 nmdc:mga0rr50_3658_c1
1211 nmdc:mga0rr50_786934_c1
1212 nmdc:mga08x19_20789_c1
1213 nmdc:mga08x19_9102_c1
1214 nmdc:mga0a205_158740_c1
1215 nmdc:mga0a205_6926_c1
1216 Ga0495601_0948638
1217 Ga0495655_0069894
1218 Ga0500566_0373875
1219 Ga0501084_0514708
1220 Ga0501082_0206534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

38

88

0.98

PF01022

HTH_5

Bacterial regulatory protein, arsR family

40

87

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f7p-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes 0.9025 37 96
1j75-assembly1.cif.gz_A-2 crystal structure of the dna-binding domain zalpha of dlm-1 bound to z-dna 0.9006 39 97
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8989 40 97
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.8969 38 97
2heo-assembly1.cif.gz_A general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.896 37 96
ID Description Score Start End Superfamily
af_O53478_1_106_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9369 28 109 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9202 26 109 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9179 38 97 1.10.10.10
af_O53773_1_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9134 33 109 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9131 32 98 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A327HLG0-F1-model_v4 HTH arsR-type domain-containing protein 0.9844 30 96 GO:0003700
AF-A0A2N2PVB9-F1-model_v4 Transcriptional regulator 0.9644 25 108 GO:0003700
AF-A0A846E172-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9517 20 107 GO:0003700
AF-A0A2M7A764-F1-model_v4 Transcriptional regulator 0.9515 21 109 GO:0003700
AF-A0A1I6XAF4-F1-model_v4 Transcriptional regulator, ArsR family 0.9463 23 108 GO:0003700

Map