F468986

General Info

Members Datasets Scaffolds Average Seq Length
610 226 1220 302

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10258473|Ga0307405_102584732
Length 333
Sequence MRFGVRMVGGVREWRRVPKLGVSRHLRPLGPSVIADLDTLLIALYVELTDRIIPARPGGQRRGPGRPAVVTDAELVCLAVAQVLLRYNDEHHWLRAAPSRVGHLFPRLLSQPAYNRRLRAVADLMDAALRWLADHTPATAELLRLLDGTPVVCGRSRTTARRSNLAGWAGYGRDTSHHCFYWGSRLLLLTTPDGTVTGFGLANPKQLGERQAVVAMLGGVAANRPAPGTLLVGDKGFAGCDFQTALAELELGMVRPARTDEPDVGVFPNWLRQRIEAIIWTLKHQLGLDRHGGRIPAGLWARVVQRLLALNAAIWFNWQIGAPTKRSLVAYDH

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
83 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
84 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
85 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
89 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
99 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
118 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
119 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
120 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
121 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
122 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
123 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
124 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
125 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
126 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.82
Rhizosphere 98.69
Stem 0
Stem Tuber 0
Unclassified 11.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10258473 3300031731 Bacteria 1299
2 JGI25406J46586_10059548 3300003203 Bacteria 1239
3 JGI25406J46586_10062653 3300003203 Bacteria 1194
4 JGI25406J46586_10065953 3300003203 Bacteria 1151
5 JGI25407J50210_10050364 3300003373 Bacteria 1057
6 JGI25405J52794_10022234 3300003911 Bacteria 1285
7 JGI25405J52794_10027372 3300003911 Bacteria 1174
8 Ga0070680_100324602 3300005336 Bacteria 1307
9 Ga0070671_100331980 3300005355 Bacteria 1296
10 Ga0070709_10118485 3300005434 Bacteria 1790
11 Ga0070709_10326575 3300005434 Bacteria 1127
12 Ga0070714_100017292 3300005435 Bacteria 5839
13 Ga0070714_100189822 3300005435 Bacteria 1874
14 Ga0070714_100219462 3300005435 Bacteria 1747
15 Ga0070714_100342651 3300005435 Bacteria 1402
16 Ga0070714_100440957 3300005435 Bacteria 1236
17 Ga0070714_100567643 3300005435 Bacteria 1087
18 Ga0070713_100080386 3300005436 Bacteria 2779
19 Ga0070713_100239065 3300005436 Bacteria 1653
20 Ga0070713_100254300 3300005436 Bacteria 1603
21 Ga0070713_100407706 3300005436 Bacteria 1270
22 Ga0070713_100485863 3300005436 Bacteria 1164
23 Ga0070713_100545347 3300005436 Bacteria 1098
24 Ga0070710_10073798 3300005437 Bacteria 1973
25 Ga0070710_10119902 3300005437 Bacteria 1591
26 Ga0070710_10129953 3300005437 Bacteria 1534
27 Ga0070710_10160239 3300005437 Bacteria 1395
28 Ga0070710_10188512 3300005437 Bacteria 1295
29 Ga0070711_100083869 3300005439 Bacteria 2278
30 Ga0070711_100188942 3300005439 Bacteria 1582
31 Ga0070711_100225650 3300005439 Bacteria 1458
32 Ga0070711_100378177 3300005439 Bacteria 1144
33 Ga0070708_100049552 3300005445 Bacteria 3716
34 Ga0070708_100085158 3300005445 Bacteria 2868
35 Ga0070663_100069938 3300005455 Bacteria 2552
36 Ga0070663_100114484 3300005455 Bacteria 2031
37 Ga0070681_10285868 3300005458 Bacteria 1560
38 Ga0070681_10304286 3300005458 Bacteria 1504
39 Ga0070706_100020001 3300005467 Bacteria 6171
40 Ga0070706_100029370 3300005467 Bacteria 5066
41 Ga0070706_100229920 3300005467 Unclassified 1731
42 Ga0070706_100250461 3300005467 Bacteria 1654
43 Ga0070706_100421329 3300005467 Bacteria 1242
44 Ga0070707_100036503 3300005468 Bacteria 4689
45 Ga0070707_100560427 3300005468 Bacteria 1105
46 Ga0070707_100630632 3300005468 Bacteria 1034
47 Ga0070698_100121145 3300005471 Bacteria 2576
48 Ga0070698_100161812 3300005471 Bacteria 2182
49 Ga0070698_100280494 3300005471 Bacteria 1598
50 Ga0070698_100413164 3300005471 Bacteria 1283
51 Ga0070679_100305786 3300005530 Bacteria 1540
52 Ga0070679_100388764 3300005530 Unclassified 1341
53 Ga0068853_100587386 3300005539 Bacteria 1057
54 Ga0068856_100212165 3300005614 Bacteria 1951
55 Ga0068856_100444095 3300005614 Bacteria 1318
56 Ga0068851_10192159 3300005834 Bacteria 1135
57 Ga0081455_10026220 3300005937 Bacteria 5368
58 Ga0081455_10340969 3300005937 Bacteria 1061
59 Ga0081538_10000424 3300005981 Bacteria 47554
60 Ga0081538_10044806 3300005981 Bacteria 2753
61 Ga0081538_10091002 3300005981 Bacteria 1577
62 Ga0081540_1001587 3300005983 Bacteria 19432
63 Ga0081540_1046554 3300005983 Bacteria 2189
64 Ga0081540_1084672 3300005983 Bacteria 1414
65 Ga0081539_10034488 3300005985 Bacteria 3060
66 Ga0081539_10046634 3300005985 Bacteria 2482
67 Ga0081539_10119335 3300005985 Bacteria 1313
68 Ga0081539_10119599 3300005985 Bacteria 1311
69 Ga0070717_10061126 3300006028 Bacteria 3121
70 Ga0070717_10178406 3300006028 Bacteria 1850
71 Ga0070717_10283615 3300006028 Bacteria 1469
72 Ga0075432_10051337 3300006058 Unclassified 1455
73 Ga0070715_10122460 3300006163 Bacteria 1241
74 Ga0070715_10202396 3300006163 Bacteria 1009
75 Ga0070716_100095903 3300006173 Bacteria 1806
76 Ga0070716_100215720 3300006173 Bacteria 1285
77 Ga0070712_100027832 3300006175 Bacteria 3777
78 Ga0070712_100097237 3300006175 Bacteria 2169
79 Ga0070712_100139101 3300006175 Bacteria 1850
80 Ga0070712_100143002 3300006175 Bacteria 1828
81 Ga0070712_100252099 3300006175 Bacteria 1411
82 Ga0070712_100254270 3300006175 Bacteria 1405
83 Ga0075433_10443412 3300006852 Unclassified 1144
84 Ga0075434_100101177 3300006871 Bacteria 2888
85 Ga0075434_100324591 3300006871 Bacteria 1560
86 Ga0075436_100029517 3300006914 Bacteria 3771
87 Ga0075436_100230866 3300006914 Bacteria 1314
88 Ga0075435_100176089 3300007076 Bacteria 1806
89 Ga0075435_100261875 3300007076 Bacteria 1474
90 Ga0099794_10036991 3300007265 Bacteria 2309
91 Ga0099795_10053952 3300007788 Bacteria 1472
92 Ga0111539_10350508 3300009094 Bacteria 1718
93 Ga0114129_10731114 3300009147 Unclassified 1269
94 Ga0114129_10757433 3300009147 Bacteria 1242
95 Ga0099796_10038390 3300010159 Bacteria 1606
96 Ga0157371_10178579 3300013102 Bacteria 1518
97 Ga0157369_10361308 3300013105 Bacteria 1507
98 Ga0157369_10411649 3300013105 Bacteria 1402
99 Ga0157369_10613364 3300013105 Unclassified 1123
100 Ga0157375_10492312 3300013308 Bacteria 1391
101 Ga0163163_10564766 3300014325 Bacteria 1201
102 Ga0182008_10102537 3300014497 Bacteria 1415
103 Ga0157377_10197247 3300014745 Bacteria 1276
104 Ga0206353_11667238 3300020082 Bacteria 1123
105 Ga0213875_10110002 3300021388 Unclassified 1286
106 Ga0207692_10039961 3300025898 Bacteria 2312
107 Ga0207692_10099954 3300025898 Bacteria 1590
108 Ga0207692_10208860 3300025898 Bacteria 1152
109 Ga0207692_10230651 3300025898 Bacteria 1102
110 Ga0207692_10245265 3300025898 Bacteria 1071
111 Ga0207647_10159220 3300025904 Bacteria 1318
112 Ga0207685_10038881 3300025905 Bacteria 1762
113 Ga0207685_10142977 3300025905 Bacteria 1075
114 Ga0207685_10164925 3300025905 Bacteria 1015
115 Ga0207699_10320705 3300025906 Bacteria 1087
116 Ga0207699_10328707 3300025906 Bacteria 1074
117 Ga0207684_10131843 3300025910 Bacteria 2145
118 Ga0207684_10178656 3300025910 Bacteria 1830
119 Ga0207684_10343053 3300025910 Bacteria 1286
120 Ga0207684_10382920 3300025910 Bacteria 1210
121 Ga0207684_10458436 3300025910 Archaea 1094
122 Ga0207707_10476489 3300025912 Bacteria 1066
123 Ga0207693_10033131 3300025915 Bacteria 4078
124 Ga0207693_10038904 3300025915 Bacteria 3744
125 Ga0207693_10134244 3300025915 Bacteria 1946
126 Ga0207693_10146152 3300025915 Bacteria 1859
127 Ga0207693_10191289 3300025915 Bacteria 1610
128 Ga0207693_10255578 3300025915 Bacteria 1374
129 Ga0207663_10085318 3300025916 Unclassified 2079
130 Ga0207663_10167567 3300025916 Bacteria 1557
131 Ga0207663_10357977 3300025916 Bacteria 1106
132 Ga0207663_10389531 3300025916 Bacteria 1063
133 Ga0207663_10427528 3300025916 Bacteria 1018
134 Ga0207660_10447549 3300025917 Bacteria 1044
135 Ga0207657_10235028 3300025919 Unclassified 1465
136 Ga0207649_10069263 3300025920 Bacteria 2246
137 Ga0207649_10174756 3300025920 Bacteria 1499
138 Ga0207652_10169577 3300025921 Bacteria 1958
139 Ga0207652_10370360 3300025921 Unclassified 1293
140 Ga0207652_10521917 3300025921 Bacteria 1068
141 Ga0207646_10225411 3300025922 Bacteria 1693
142 Ga0207700_10063077 3300025928 Bacteria 2817
143 Ga0207700_10199156 3300025928 Bacteria 1687
144 Ga0207700_10316520 3300025928 Bacteria 1351
145 Ga0207700_10449671 3300025928 Bacteria 1135
146 Ga0207700_10464316 3300025928 Bacteria 1117
147 Ga0207700_10472501 3300025928 Bacteria 1107
148 Ga0207664_10013021 3300025929 Bacteria 5961
149 Ga0207664_10200242 3300025929 Unclassified 1723
150 Ga0207664_10202662 3300025929 Bacteria 1713
151 Ga0207664_10465326 3300025929 Bacteria 1130
152 Ga0207664_10511049 3300025929 Bacteria 1076
153 Ga0207664_10577715 3300025929 Bacteria 1009
154 Ga0207665_10023157 3300025939 Bacteria 4090
155 Ga0207665_10330470 3300025939 Bacteria 1146
156 Ga0207679_10172570 3300025945 Bacteria 1782
157 Ga0207678_10043608 3300026067 Bacteria 3881
158 Ga0207678_10187932 3300026067 Bacteria 1765
159 Ga0207678_10277585 3300026067 Unclassified 1438
160 Ga0207678_10387114 3300026067 Bacteria 1209
161 Ga0209179_1020351 3300027512 Bacteria 1287
162 Ga0209588_1049702 3300027671 Bacteria 1357
163 Ga0207428_10030107 3300027907 Bacteria 4490
164 Ga0307408_100063951 3300031548 Bacteria 2693
165 Ga0307408_100250483 3300031548 Bacteria 1460
166 Ga0307408_100290376 3300031548 Unclassified 1365
167 Ga0307405_10169844 3300031731 Bacteria 1554
168 Ga0307405_10229077 3300031731 Bacteria 1368
169 Ga0307405_10283404 3300031731 Bacteria 1248
170 Ga0307405_10356982 3300031731 Unclassified 1129
171 Ga0307413_10027621 3300031824 Bacteria 3147
172 Ga0307413_10395959 3300031824 Bacteria 1080
173 Ga0307410_10047984 3300031852 Bacteria 2857
174 Ga0307410_10181332 3300031852 Unclassified 1594
175 Ga0307410_10302558 3300031852 Bacteria 1262
176 Ga0307410_10329039 3300031852 Bacteria 1214
177 Ga0307410_10367812 3300031852 Bacteria 1153
178 Ga0307410_10386484 3300031852 Bacteria 1127
179 Ga0307410_10398297 3300031852 Bacteria 1111
180 Ga0307410_10410977 3300031852 Bacteria 1095
181 Ga0307406_10011505 3300031901 Bacteria 5026
182 Ga0307406_10328843 3300031901 Bacteria 1185
183 Ga0307406_10411750 3300031901 Bacteria 1074
184 Ga0307406_10430497 3300031901 Bacteria 1053
185 Ga0307407_10015067 3300031903 Bacteria 3806
186 Ga0307407_10127408 3300031903 Unclassified 1623
187 Ga0307407_10154601 3300031903 Bacteria 1494
188 Ga0307407_10167334 3300031903 Bacteria 1444
189 Ga0307407_10259057 3300031903 Bacteria 1195
190 Ga0307407_10358729 3300031903 Bacteria 1034
191 Ga0307412_10149091 3300031911 Bacteria 1723
192 Ga0307412_10349565 3300031911 Bacteria 1186
193 Ga0307412_10355671 3300031911 Bacteria 1177
194 Ga0307412_10416895 3300031911 Bacteria 1097
195 Ga0307409_100127548 3300031995 Bacteria 2167
196 Ga0307409_100255225 3300031995 Bacteria 1605
197 Ga0307409_100264106 3300031995 Bacteria 1581
198 Ga0307409_100301148 3300031995 Bacteria 1491
199 Ga0307409_100324902 3300031995 Bacteria 1441
200 Ga0307409_100400716 3300031995 Bacteria 1310
201 Ga0307409_100471018 3300031995 Bacteria 1216
202 Ga0307409_100472680 3300031995 Bacteria 1214
203 Ga0307409_100574231 3300031995 Bacteria 1110
204 Ga0307416_100045523 3300032002 Bacteria 3455
205 Ga0307416_100071525 3300032002 Bacteria 2882
206 Ga0307416_100353322 3300032002 Unclassified 1488
207 Ga0307416_100354915 3300032002 Bacteria 1485
208 Ga0307416_100383465 3300032002 Bacteria 1436
209 Ga0307416_100584541 3300032002 Bacteria 1194
210 Ga0307414_10065283 3300032004 Unclassified 2596
211 Ga0307414_10164753 3300032004 Bacteria 1765
212 Ga0307414_10178003 3300032004 Bacteria 1707
213 Ga0307414_10221906 3300032004 Bacteria 1552
214 Ga0307414_10341981 3300032004 Bacteria 1281
215 Ga0307414_10448113 3300032004 Bacteria 1131
216 Ga0307411_10079186 3300032005 Bacteria 2255
217 Ga0307411_10117396 3300032005 Bacteria 1917
218 Ga0307411_10205870 3300032005 Bacteria 1515
219 Ga0307411_10358386 3300032005 Bacteria 1191
220 Ga0307411_10434792 3300032005 Bacteria 1093
221 Ga0307415_100070165 3300032126 Bacteria 2459
222 Ga0307415_100246161 3300032126 Bacteria 1449
223 Ga0307415_100282075 3300032126 Bacteria 1366
224 Ga0307415_100343517 3300032126 Bacteria 1253
225 Ga0307415_100367722 3300032126 Bacteria 1216
226 Ga0307415_100452292 3300032126 Bacteria 1110
227 Ga0307415_100510816 3300032126 Bacteria 1052
228 Ga0373929_0005751 3300035085 Bacteria 2239
229 Ga0373934_0000196 3300035086 Bacteria 22202
230 Ga0373934_0000584 3300035086 Bacteria 12842
231 Ga0373934_0088291 3300035086 Bacteria 1248
232 Ga0373940_0052701 3300035088 Bacteria 1146
233 Ga0373949_0048545 3300035090 Bacteria 1063
234 Ga0373951_0024023 3300035091 Bacteria 1410
235 Ga0373952_0023324 3300035092 Bacteria 1321
236 Ga0373923_0061113 3300035111 Bacteria 1600
237 Ga0373923_0090094 3300035111 Unclassified 1341
238 Ga0373923_0112809 3300035111 Bacteria 1208
239 Ga0373923_0191993 3300035111 Bacteria 941
240 Ga0373936_0013017 3300035113 Bacteria 3172
241 Ga0373936_0031572 3300035113 Bacteria 2092
242 Ga0373936_0070418 3300035113 Unclassified 1440
243 Ga0373936_0105971 3300035113 Bacteria 1190
244 Ga0373936_0123429 3300035113 Unclassified 1108
245 Ga0373939_0061003 3300035114 Bacteria 1200
246 Ga0373941_0039955 3300035115 Bacteria 1444
247 Ga0373945_0016514 3300035116 Bacteria 2491
248 Ga0373945_0026727 3300035116 Bacteria 2011
249 Ga0373945_0103547 3300035116 Bacteria 1116
250 Ga0373953_0000250 3300035117 Bacteria 14579
251 Ga0373953_0065996 3300035117 Bacteria 1486
252 Ga0373953_0115139 3300035117 Bacteria 1139
253 Ga0373953_0138665 3300035117 Unclassified 1039
254 Ga0373954_0000176 3300035118 Bacteria 23015
255 Ga0373954_0002429 3300035118 Bacteria 7805
256 Ga0373956_0000702 3300035119 Bacteria 13802
257 Ga0373956_0001074 3300035119 Bacteria 11239
258 Ga0373956_0006090 3300035119 Bacteria 4827
259 Ga0373956_0127643 3300035119 Bacteria 1189
260 Ga0373956_0138557 3300035119 Bacteria 1141
261 Ga0373957_0001999 3300035120 Bacteria 5695
262 Ga0373957_0015000 3300035120 Unclassified 2658
263 Ga0373957_0026283 3300035120 Bacteria 2104
264 Ga0373957_0069715 3300035120 Bacteria 1373
265 Ga0373957_0079803 3300035120 Bacteria 1290
266 Ga0373957_0100742 3300035120 Bacteria 1156
267 Ga0373957_0113763 3300035120 Bacteria 1091
268 Ga0373943_0064144 3300035170 Bacteria 1844
269 Ga0373943_0089336 3300035170 Bacteria 1593
270 Ga0373943_0194784 3300035170 Bacteria 1119
271 Ga0373946_0041171 3300035171 Bacteria 1894
272 Ga0373946_0109926 3300035171 Bacteria 1246
273 Ga0373955_0000130 3300035172 Bacteria 29820
274 Ga0373955_0161865 3300035172 Bacteria 1321
275 Ga0373955_0194548 3300035172 Bacteria 1206
276 Ga0373955_0230575 3300035172 Bacteria 1107
277 Ga0373961_0041920 3300035241 Bacteria 1325
278 Ga0373962_0014151 3300035242 Bacteria 2030
279 Ga0373924_0000261 3300035410 Bacteria 16176
280 Ga0373924_0003957 3300035410 Bacteria 5142
281 Ga0373924_0004962 3300035410 Bacteria 4684
282 Ga0373924_0123419 3300035410 Bacteria 1124
283 Ga0373924_0138185 3300035410 Bacteria 1062
284 Ga0373931_0058817 3300035691 Bacteria 2065
285 Ga0373935_0022631 3300035692 Bacteria 3856
286 Ga0373935_0047006 3300035692 Bacteria 2727
287 Ga0373935_0083240 3300035692 Unclassified 2082
288 Ga0373935_0084034 3300035692 Bacteria 2073
289 Ga0373935_0469124 3300035692 Bacteria 911
290 Ga0373927_0163575 3300035695 Bacteria 1458
291 Ga0373927_0250011 3300035695 Bacteria 1165
292 Ga0373933_0000012 3300035724 Bacteria 108156
293 Ga0373933_0068637 3300035724 Bacteria 2153
294 Ga0373933_0073923 3300035724 Bacteria 2077
295 Ga0373933_0096121 3300035724 Bacteria 1833
296 Ga0373933_0104746 3300035724 Bacteria 1759
297 Ga0373933_0228894 3300035724 Bacteria 1194
298 Ga0373933_0241965 3300035724 Bacteria 1160
299 Ga0373933_0280164 3300035724 Bacteria 1077
300 Ga0373933_0282540 3300035724 Bacteria 1072
301 Ga0373933_0297985 3300035724 Unclassified 1043
302 Ga0373947_0057481 3300035725 Bacteria 2354
303 Ga0373947_0065472 3300035725 Bacteria 2217
304 Ga0373947_0304086 3300035725 Bacteria 1064
305 Ga0373937_0000040 3300036401 Bacteria 108935
306 Ga0373937_0008801 3300036401 Bacteria 8758
307 Ga0373937_0025906 3300036401 Bacteria 5296
308 Ga0373937_0047400 3300036401 Bacteria 3932
309 Ga0373937_0055294 3300036401 Bacteria 3643
310 Ga0373937_0120448 3300036401 Bacteria 2445
311 Ga0373937_0212744 3300036401 Bacteria 1819
312 Ga0373937_0605933 3300036401 Unclassified 1039
313 Ga0373925_0054268 3300037068 Bacteria 2997
314 Ga0373925_0314903 3300037068 Bacteria 1265
315 Ga0373925_0425349 3300037068 Bacteria 1085
316 Ga0373925_0426278 3300037068 Bacteria 1084
317 Ga0373925_0439385 3300037068 Bacteria 1067
318 Ga0373925_0491115 3300037068 Unclassified 1007
319 Ga0395899_0048865 3300037312 Bacteria 3146
320 Ga0395899_0071373 3300037312 Bacteria 2541
321 Ga0395899_0080537 3300037312 Bacteria 2370
322 Ga0395899_0210419 3300037312 Bacteria 1351
323 Ga0395899_0274657 3300037312 Unclassified 1148
324 Ga0395899_0281779 3300037312 Bacteria 1130
325 Ga0395899_0300344 3300037312 Bacteria 1086
326 Ga0395899_0351711 3300037312 Bacteria 985
327 Ga0395900_0079524 3300037418 Unclassified 3369
328 Ga0395900_0096698 3300037418 Bacteria 3034
329 Ga0395900_0100564 3300037418 Bacteria 2970
330 Ga0395900_0103170 3300037418 Bacteria 2929
331 Ga0395900_0176713 3300037418 Bacteria 2171
332 Ga0395900_0313431 3300037418 Bacteria 1551
333 Ga0395900_0455241 3300037418 Bacteria 1235
334 Ga0395900_0471958 3300037418 Bacteria 1208
335 Ga0395900_0490896 3300037418 Bacteria 1179
336 Ga0395900_0595621 3300037418 Bacteria 1046
337 Ga0395898_0049602 3300037466 Bacteria 4112
338 Ga0395898_0113460 3300037466 Bacteria 2597
339 Ga0395898_0140825 3300037466 Unclassified 2309
340 Ga0395898_0368379 3300037466 Bacteria 1370
341 Ga0395898_0403472 3300037466 Bacteria 1303
342 Ga0395898_0480958 3300037466 Bacteria 1181
343 Ga0395898_0488574 3300037466 Bacteria 1171
344 Ga0395898_0489178 3300037466 Bacteria 1170
345 Ga0395898_0513420 3300037466 Bacteria 1139
346 Ga0395898_0522415 3300037466 Bacteria 1128
347 Ga0395898_0524099 3300037466 Bacteria 1126
348 Ga0395898_0569936 3300037466 Bacteria 1074
349 Ga0395905_0076797 3300037471 Bacteria 3130
350 Ga0395905_0126078 3300037471 Unclassified 2407
351 Ga0395905_0225864 3300037471 Bacteria 1751
352 Ga0395905_0263345 3300037471 Bacteria 1609
353 Ga0395905_0437260 3300037471 Bacteria 1205
354 Ga0395905_0477011 3300037471 Bacteria 1147
355 Ga0395905_0497983 3300037471 Bacteria 1118
356 Ga0395905_0503774 3300037471 Bacteria 1111
357 Ga0436364_1202014 3300037853 Bacteria 3646
358 Ga0395901_0026453 3300038443 Bacteria 5957
359 Ga0395901_0067646 3300038443 Unclassified 3720
360 Ga0395901_0096426 3300038443 Bacteria 3099
361 Ga0395901_0191225 3300038443 Bacteria 2146
362 Ga0395901_0232972 3300038443 Bacteria 1922
363 Ga0395901_0276427 3300038443 Bacteria 1746
364 Ga0395901_0301528 3300038443 Bacteria 1661
365 Ga0395901_0413848 3300038443 Bacteria 1383
366 Ga0395901_0524171 3300038443 Bacteria 1203
367 Ga0395901_0526403 3300038443 Bacteria 1200
368 Ga0395901_0532284 3300038443 Unclassified 1192
369 Ga0395901_0560930 3300038443 Bacteria 1156
370 Ga0395901_0580076 3300038443 Bacteria 1133
371 Ga0395901_0618229 3300038443 Bacteria 1090
372 Ga0395901_0716915 3300038443 Bacteria 996
373 Ga0395901_0734689 3300038443 Unclassified 981
374 Ga0436363_0373886 3300039450 Bacteria 1684
375 Ga0439443_016461 3300042003 Unclassified 1130
376 Ga0439448_0013532 3300042005 Bacteria 2452
377 Ga0439448_0054095 3300042005 Bacteria 1318
378 Ga0439450_044448 3300042008 Bacteria 1040
379 Ga0439454_006938 3300042011 Bacteria 1408
380 Ga0439455_0011969 3300042012 Bacteria 1939
381 Ga0439455_0049878 3300042012 Unclassified 1091
382 Ga0439463_036070 3300042016 Unclassified 1252
383 Ga0450912_000849 3300042116 Bacteria 1692
384 Ga0450900_008697 3300042136 Bacteria 1275
385 Ga0450902_014806 3300042137 Unclassified 1262
386 Ga0439458_0024371 3300042157 Bacteria 1414
387 Ga0439458_0025857 3300042157 Bacteria 1378
388 Ga0439459_0020159 3300042438 Bacteria 1270
389 Ga0439464_0018545 3300042439 Unclassified 1893
390 Ga0439460_0015352 3300042461 Bacteria 2026
391 Ga0439460_0076141 3300042461 Bacteria 1046
392 Ga0439440_0024939 3300042993 Bacteria 1374
393 Ga0466967_0375720 3300045976 Bacteria 1379
394 Ga0466967_0421748 3300045976 Bacteria 1301
395 Ga0495592_0000106 3300046454 Bacteria 74359
396 Ga0495592_0302288 3300046454 Unclassified 1039
397 Ga0495629_0160786 3300046459 Bacteria 1560
398 Ga0495629_0165599 3300046459 Bacteria 1535
399 Ga0495629_0271200 3300046459 Bacteria 1165
400 Ga0495629_0444679 3300046459 Bacteria 878
401 Ga0495641_0037086 3300046461 Bacteria 2287
402 Ga0495641_0105295 3300046461 Bacteria 1258
403 Ga0495641_0119925 3300046461 Bacteria 1173
404 Ga0495651_0000040 3300046462 Bacteria 94890
405 Ga0495651_0147464 3300046462 Bacteria 1699
406 Ga0495651_0308646 3300046462 Bacteria 1059
407 Ga0495651_0317527 3300046462 Unclassified 1039
408 Ga0495653_0001238 3300046463 Bacteria 19776
409 Ga0495653_0012497 3300046463 Bacteria 6932
410 Ga0495653_0015366 3300046463 Bacteria 6238
411 Ga0495580_0322210 3300046472 Bacteria 1050
412 Ga0495582_0093933 3300046473 Bacteria 1674
413 Ga0495639_0135845 3300046475 Bacteria 1180
414 Ga0495662_0018649 3300046476 Bacteria 3358
415 Ga0495664_0012965 3300046477 Bacteria 4725
416 Ga0495664_0062989 3300046477 Bacteria 2209
417 Ga0495664_0156325 3300046477 Unclassified 1383
418 Ga0495664_0160337 3300046477 Bacteria 1364
419 Ga0495664_0249835 3300046477 Bacteria 1072
420 Ga0495584_0063920 3300046491 Bacteria 1850
421 Ga0495584_0194860 3300046491 Bacteria 1030
422 Ga0495585_0126390 3300046492 Bacteria 1349
423 Ga0495594_0238849 3300046499 Bacteria 1036
424 Ga0495607_0150576 3300046501 Unclassified 1191
425 Ga0495608_0000044 3300046511 Bacteria 108171
426 Ga0495608_0007230 3300046511 Bacteria 7852
427 Ga0495608_0274032 3300046511 Bacteria 1048
428 Ga0495608_0278091 3300046511 Unclassified 1039
429 Ga0495616_0103112 3300046513 Bacteria 1336
430 Ga0495618_0006909 3300046514 Bacteria 6880
431 Ga0495618_0165697 3300046514 Bacteria 1407
432 Ga0495618_0243689 3300046514 Bacteria 1129
433 Ga0495628_0000450 3300046516 Bacteria 37523
434 Ga0495628_0339323 3300046516 Bacteria 1106
435 Ga0495628_0376924 3300046516 Unclassified 1039
436 Ga0495630_0310524 3300046517 Bacteria 1205
437 Ga0495663_0053163 3300046525 Unclassified 1259
438 Ga0495663_0081059 3300046525 Unclassified 1045
439 Ga0495663_0082324 3300046525 Bacteria 1038
440 Ga0495666_0118848 3300046526 Bacteria 1239
441 Ga0495642_0055298 3300046528 Bacteria 1638
442 Ga0495642_0073705 3300046528 Bacteria 1431
443 Ga0495642_0112516 3300046528 Unclassified 1165
444 Ga0495652_0001868 3300046529 Bacteria 22396
445 Ga0495652_0186424 3300046529 Bacteria 1587
446 Ga0495652_0360143 3300046529 Unclassified 1039
447 Ga0495665_0081605 3300046531 Bacteria 1700
448 Ga0495665_0136231 3300046531 Bacteria 1284
449 Ga0495640_0009037 3300046533 Bacteria 7775
450 Ga0495640_0230988 3300046533 Bacteria 1163
451 Ga0495586_0110080 3300046535 Bacteria 1532
452 Ga0495586_0141893 3300046535 Bacteria 1348
453 Ga0495587_0000046 3300046536 Bacteria 108171
454 Ga0495587_0005951 3300046536 Bacteria 7952
455 Ga0495587_0093202 3300046536 Bacteria 1739
456 Ga0495587_0165464 3300046536 Bacteria 1257
457 Ga0495587_0231784 3300046536 Unclassified 1040
458 Ga0495645_0036987 3300046543 Bacteria 3557
459 Ga0495645_0169274 3300046543 Bacteria 1504
460 Ga0495645_0264758 3300046543 Unclassified 1136
461 Ga0495645_0305081 3300046543 Bacteria 1038
462 Ga0495667_0000518 3300046559 Bacteria 24595
463 Ga0495667_0148981 3300046559 Bacteria 1507
464 Ga0495667_0244548 3300046559 Bacteria 1142
465 Ga0495667_0289168 3300046559 Unclassified 1039
466 Ga0495656_0092172 3300046615 Bacteria 1387
467 Ga0495634_0070846 3300046642 Bacteria 2297
468 Ga0495634_0206031 3300046642 Bacteria 1219
469 Ga0495634_0210951 3300046642 Bacteria 1202
470 Ga0495634_0264492 3300046642 Bacteria 1048
471 Ga0495634_0295019 3300046642 Unclassified 981
472 Ga0495635_0010480 3300046663 Bacteria 6484
473 Ga0495635_0055343 3300046663 Unclassified 2733
474 Ga0495635_0094381 3300046663 Bacteria 2045
475 Ga0495635_0325562 3300046663 Bacteria 1028
476 Ga0495657_0000547 3300046675 Bacteria 34712
477 Ga0495657_0079387 3300046675 Bacteria 2125
478 Ga0495657_0261500 3300046675 Unclassified 1039
479 Ga0495657_0269251 3300046675 Bacteria 1022
480 Ga0495657_0324052 3300046675 Bacteria 915
481 Ga0495599_0001467 3300046678 Bacteria 13533
482 Ga0495599_0151722 3300046678 Bacteria 1435
483 Ga0495599_0266701 3300046678 Unclassified 1039
484 Ga0495623_0002970 3300046679 Bacteria 11156
485 Ga0495623_0016348 3300046679 Bacteria 4792
486 Ga0495623_0166564 3300046679 Bacteria 1290
487 Ga0495623_0234325 3300046679 Unclassified 1039
488 Ga0495646_0002148 3300046680 Bacteria 11979
489 Ga0495646_0065107 3300046680 Bacteria 2158
490 Ga0495658_0002611 3300046683 Bacteria 9055
491 Ga0495669_0131748 3300046684 Bacteria 1177
492 Ga0495613_0014214 3300046689 Bacteria 5907
493 Ga0495624_0123951 3300046690 Bacteria 1586
494 Ga0495624_0124509 3300046690 Bacteria 1582
495 Ga0495624_0134989 3300046690 Bacteria 1512
496 Ga0495670_0120844 3300046691 Unclassified 1360
497 Ga0495600_0001680 3300046809 Bacteria 12356
498 Ga0495600_0042203 3300046809 Bacteria 2973
499 Ga0495581_0170896 3300047315 Bacteria 1271
500 Ga0495581_0198844 3300047315 Bacteria 1172
501 Ga0495581_0225002 3300047315 Bacteria 1097
502 Ga0495604_0000049 3300047317 Bacteria 108620
503 Ga0495604_0005185 3300047317 Bacteria 10322
504 Ga0495604_0203891 3300047317 Bacteria 1370
505 Ga0495604_0236715 3300047317 Bacteria 1250
506 Ga0495604_0318321 3300047317 Bacteria 1040
507 Ga0495604_0318720 3300047317 Unclassified 1039
508 Ga0495674_0231361 3300047319 Bacteria 1525
509 Ga0495674_0316868 3300047319 Bacteria 1271
510 Ga0495674_0319834 3300047319 Bacteria 1264
511 Ga0495674_0320808 3300047319 Bacteria 1262
512 Ga0495674_0371377 3300047319 Bacteria 1158
513 Ga0495674_0476577 3300047319 Bacteria 1000
514 Ga0495676_0142501 3300047321 Bacteria 1716
515 Ga0495676_0261867 3300047321 Bacteria 1176
516 Ga0495680_0000977 3300047322 Bacteria 31770
517 Ga0495680_0015200 3300047322 Bacteria 6646
518 Ga0495680_0135726 3300047322 Bacteria 1804
519 Ga0495680_0263476 3300047322 Bacteria 1218
520 Ga0495680_0341889 3300047322 Unclassified 1043
521 Ga0495675_0000062 3300047444 Bacteria 75661
522 Ga0495675_0001364 3300047444 Bacteria 14789
523 Ga0495675_0011972 3300047444 Bacteria 5452
524 Ga0495684_0011423 3300047471 Bacteria 6856
525 Ga0495684_0151342 3300047471 Unclassified 1734
526 Ga0495684_0224649 3300047471 Bacteria 1375
527 Ga0495684_0376421 3300047471 Bacteria 1002
528 Ga0495593_0157710 3300047673 Bacteria 1146
529 Ga0495602_0000558 3300048088 Bacteria 34735
530 Ga0495602_0072514 3300048088 Bacteria 2935
531 Ga0495602_0163465 3300048088 Bacteria 1735
532 Ga0495602_0327873 3300048088 Bacteria 1111
533 Ga0495602_0351680 3300048088 Bacteria 1063
534 Ga0495602_0363852 3300048088 Unclassified 1040
535 Ga0496105_0361282 3300048908 Bacteria 1158
536 Ga0496112_0540885 3300048915 Bacteria 1099
537 Ga0496113_0466932 3300048916 Bacteria 1014
538 Ga0496114_0524611 3300048917 Bacteria 1047
539 Ga0496115_0367947 3300048918 Bacteria 1170
540 Ga0501031_0114082 3300049568 Unclassified 1765
541 Ga0501033_0082499 3300049570 Bacteria 2357
542 Ga0501033_0304645 3300049570 Bacteria 1121
543 Ga0501036_0358044 3300049572 Bacteria 1218
544 Ga0501036_0368251 3300049572 Bacteria 1199
545 Ga0501038_0353488 3300049574 Bacteria 1144
546 Ga0501039_0303379 3300049575 Bacteria 1255
547 Ga0501039_0305645 3300049575 Bacteria 1250
548 Ga0501040_0299509 3300049576 Unclassified 1149
549 Ga0501040_0300009 3300049576 Bacteria 1148
550 Ga0501041_0002382 3300049577 Bacteria 10633
551 Ga0501042_0144775 3300049578 Unclassified 1713
552 Ga0501042_0191380 3300049578 Bacteria 1475
553 Ga0501042_0262569 3300049578 Bacteria 1246
554 Ga0501043_0426314 3300049579 Bacteria 999
555 Ga0501046_0159977 3300049580 Bacteria 1694
556 Ga0501046_0174983 3300049580 Bacteria 1608
557 Ga0501048_0190704 3300049582 Unclassified 1452
558 Ga0501068_0327059 3300049584 Bacteria 983
559 Ga0501071_0119899 3300049587 Bacteria 1949
560 Ga0501071_0453660 3300049587 Bacteria 981
561 Ga0501072_0010257 3300049588 Bacteria 7137
562 Ga0501073_0152609 3300049589 Bacteria 1601
563 Ga0501074_0252354 3300049590 Bacteria 1254
564 Ga0501075_0283790 3300049591 Bacteria 1261
565 Ga0501075_0309147 3300049591 Bacteria 1204
566 Ga0501076_0080188 3300049592 Bacteria 2619
567 Ga0501076_0353650 3300049592 Bacteria 1206
568 Ga0501077_0017119 3300049593 Bacteria 4571
569 Ga0501079_0252537 3300049741 Unclassified 1378
570 Ga0501079_0323880 3300049741 Bacteria 1206
571 Ga0501081_0270216 3300049743 Bacteria 1243
572 Ga0501081_0341579 3300049743 Bacteria 1102
573 Ga0501035_0005078 3300049822 Bacteria 12472
574 Ga0501045_0025108 3300049824 Bacteria 4280
575 Ga0501045_0225618 3300049824 Bacteria 1394
576 nmdc:mga05p37_512740_c1 3300050507 Unclassified 1374
577 nmdc:mga05p37_529107_c1 3300050507 Bacteria 1347
578 nmdc:mga05p37_88021_c1 3300050507 Bacteria 3828
579 nmdc:mga09592_93406_c1 3300050508 Bacteria 2573
580 nmdc:mga0qj67_275989_c1 3300050509 Bacteria 1363
581 nmdc:mga06r32_302081_c1 3300050510 Unclassified 1587
582 nmdc:mga08y16_86971_c1 3300050511 Bacteria 3257
583 nmdc:mga0n895_205124_c1 3300050512 Bacteria 2002
584 nmdc:mga0n895_332599_c1 3300050512 Bacteria 1539
585 nmdc:mga0n895_370820_c1 3300050512 Bacteria 1449
586 nmdc:mga0rr50_221708_c1 3300050513 Bacteria 1562
587 nmdc:mga08x19_108071_c1 3300050514 Bacteria 1853
588 nmdc:mga08x19_217055_c1 3300050514 Bacteria 1314
589 nmdc:mga0a205_265269_c1 3300050515 Bacteria 1595
590 Ga0495601_0004008 3300053077 Bacteria 8481
591 Ga0495601_0089762 3300053077 Unclassified 1976
592 Ga0495601_0236905 3300053077 Bacteria 1192
593 Ga0495601_0262415 3300053077 Bacteria 1127
594 Ga0495601_0265244 3300053077 Unclassified 1121
595 Ga0495601_0276806 3300053077 Bacteria 1094
596 Ga0495612_0073171 3300053078 Bacteria 1431
597 Ga0495612_0123601 3300053078 Bacteria 1114
598 Ga0495612_0163150 3300053078 Unclassified 973
599 Ga0495612_0208173 3300053078 Bacteria 864
600 Ga0495595_0011688 3300053084 Bacteria 3674
601 Ga0495595_0021568 3300053084 Bacteria 2815
602 Ga0495595_0027584 3300053084 Bacteria 2531
603 Ga0495619_0090824 3300053085 Bacteria 2067
604 Ga0495619_0302242 3300053085 Bacteria 1108
605 Ga0501084_0383567 3300054114 Bacteria 1187
606 Ga0590075_037928 3300059424 Bacteria 1229
607 Ga0590077_021056 3300059426 Bacteria 1387
608 Ga0501082_0385147 3300060353 Bacteria 1223
609 Ga0530510_0275776 3300061734 Bacteria 1255
610 Ga0530510_0312424 3300061734 Bacteria 1177
611 Ga0307405_10258473
612 JGI25406J46586_10059548
613 JGI25406J46586_10062653
614 JGI25406J46586_10065953
615 JGI25407J50210_10050364
616 JGI25405J52794_10022234
617 JGI25405J52794_10027372
618 Ga0070680_100324602
619 Ga0070671_100331980
620 Ga0070709_10118485
621 Ga0070709_10326575
622 Ga0070714_100017292
623 Ga0070714_100189822
624 Ga0070714_100219462
625 Ga0070714_100342651
626 Ga0070714_100440957
627 Ga0070714_100567643
628 Ga0070713_100080386
629 Ga0070713_100239065
630 Ga0070713_100254300
631 Ga0070713_100407706
632 Ga0070713_100485863
633 Ga0070713_100545347
634 Ga0070710_10073798
635 Ga0070710_10119902
636 Ga0070710_10129953
637 Ga0070710_10160239
638 Ga0070710_10188512
639 Ga0070711_100083869
640 Ga0070711_100188942
641 Ga0070711_100225650
642 Ga0070711_100378177
643 Ga0070708_100049552
644 Ga0070708_100085158
645 Ga0070663_100069938
646 Ga0070663_100114484
647 Ga0070681_10285868
648 Ga0070681_10304286
649 Ga0070706_100020001
650 Ga0070706_100029370
651 Ga0070706_100229920
652 Ga0070706_100250461
653 Ga0070706_100421329
654 Ga0070707_100036503
655 Ga0070707_100560427
656 Ga0070707_100630632
657 Ga0070698_100121145
658 Ga0070698_100161812
659 Ga0070698_100280494
660 Ga0070698_100413164
661 Ga0070679_100305786
662 Ga0070679_100388764
663 Ga0068853_100587386
664 Ga0068856_100212165
665 Ga0068856_100444095
666 Ga0068851_10192159
667 Ga0081455_10026220
668 Ga0081455_10340969
669 Ga0081538_10000424
670 Ga0081538_10044806
671 Ga0081538_10091002
672 Ga0081540_1001587
673 Ga0081540_1046554
674 Ga0081540_1084672
675 Ga0081539_10034488
676 Ga0081539_10046634
677 Ga0081539_10119335
678 Ga0081539_10119599
679 Ga0070717_10061126
680 Ga0070717_10178406
681 Ga0070717_10283615
682 Ga0075432_10051337
683 Ga0070715_10122460
684 Ga0070715_10202396
685 Ga0070716_100095903
686 Ga0070716_100215720
687 Ga0070712_100027832
688 Ga0070712_100097237
689 Ga0070712_100139101
690 Ga0070712_100143002
691 Ga0070712_100252099
692 Ga0070712_100254270
693 Ga0075433_10443412
694 Ga0075434_100101177
695 Ga0075434_100324591
696 Ga0075436_100029517
697 Ga0075436_100230866
698 Ga0075435_100176089
699 Ga0075435_100261875
700 Ga0099794_10036991
701 Ga0099795_10053952
702 Ga0111539_10350508
703 Ga0114129_10731114
704 Ga0114129_10757433
705 Ga0099796_10038390
706 Ga0157371_10178579
707 Ga0157369_10361308
708 Ga0157369_10411649
709 Ga0157369_10613364
710 Ga0157375_10492312
711 Ga0163163_10564766
712 Ga0182008_10102537
713 Ga0157377_10197247
714 Ga0206353_11667238
715 Ga0213875_10110002
716 Ga0207692_10039961
717 Ga0207692_10099954
718 Ga0207692_10208860
719 Ga0207692_10230651
720 Ga0207692_10245265
721 Ga0207647_10159220
722 Ga0207685_10038881
723 Ga0207685_10142977
724 Ga0207685_10164925
725 Ga0207699_10320705
726 Ga0207699_10328707
727 Ga0207684_10131843
728 Ga0207684_10178656
729 Ga0207684_10343053
730 Ga0207684_10382920
731 Ga0207684_10458436
732 Ga0207707_10476489
733 Ga0207693_10033131
734 Ga0207693_10038904
735 Ga0207693_10134244
736 Ga0207693_10146152
737 Ga0207693_10191289
738 Ga0207693_10255578
739 Ga0207663_10085318
740 Ga0207663_10167567
741 Ga0207663_10357977
742 Ga0207663_10389531
743 Ga0207663_10427528
744 Ga0207660_10447549
745 Ga0207657_10235028
746 Ga0207649_10069263
747 Ga0207649_10174756
748 Ga0207652_10169577
749 Ga0207652_10370360
750 Ga0207652_10521917
751 Ga0207646_10225411
752 Ga0207700_10063077
753 Ga0207700_10199156
754 Ga0207700_10316520
755 Ga0207700_10449671
756 Ga0207700_10464316
757 Ga0207700_10472501
758 Ga0207664_10013021
759 Ga0207664_10200242
760 Ga0207664_10202662
761 Ga0207664_10465326
762 Ga0207664_10511049
763 Ga0207664_10577715
764 Ga0207665_10023157
765 Ga0207665_10330470
766 Ga0207679_10172570
767 Ga0207678_10043608
768 Ga0207678_10187932
769 Ga0207678_10277585
770 Ga0207678_10387114
771 Ga0209179_1020351
772 Ga0209588_1049702
773 Ga0207428_10030107
774 Ga0307408_100063951
775 Ga0307408_100250483
776 Ga0307408_100290376
777 Ga0307405_10169844
778 Ga0307405_10229077
779 Ga0307405_10283404
780 Ga0307405_10356982
781 Ga0307413_10027621
782 Ga0307413_10395959
783 Ga0307410_10047984
784 Ga0307410_10181332
785 Ga0307410_10302558
786 Ga0307410_10329039
787 Ga0307410_10367812
788 Ga0307410_10386484
789 Ga0307410_10398297
790 Ga0307410_10410977
791 Ga0307406_10011505
792 Ga0307406_10328843
793 Ga0307406_10411750
794 Ga0307406_10430497
795 Ga0307407_10015067
796 Ga0307407_10127408
797 Ga0307407_10154601
798 Ga0307407_10167334
799 Ga0307407_10259057
800 Ga0307407_10358729
801 Ga0307412_10149091
802 Ga0307412_10349565
803 Ga0307412_10355671
804 Ga0307412_10416895
805 Ga0307409_100127548
806 Ga0307409_100255225
807 Ga0307409_100264106
808 Ga0307409_100301148
809 Ga0307409_100324902
810 Ga0307409_100400716
811 Ga0307409_100471018
812 Ga0307409_100472680
813 Ga0307409_100574231
814 Ga0307416_100045523
815 Ga0307416_100071525
816 Ga0307416_100353322
817 Ga0307416_100354915
818 Ga0307416_100383465
819 Ga0307416_100584541
820 Ga0307414_10065283
821 Ga0307414_10164753
822 Ga0307414_10178003
823 Ga0307414_10221906
824 Ga0307414_10341981
825 Ga0307414_10448113
826 Ga0307411_10079186
827 Ga0307411_10117396
828 Ga0307411_10205870
829 Ga0307411_10358386
830 Ga0307411_10434792
831 Ga0307415_100070165
832 Ga0307415_100246161
833 Ga0307415_100282075
834 Ga0307415_100343517
835 Ga0307415_100367722
836 Ga0307415_100452292
837 Ga0307415_100510816
838 Ga0373929_0005751
839 Ga0373934_0000196
840 Ga0373934_0000584
841 Ga0373934_0088291
842 Ga0373940_0052701
843 Ga0373949_0048545
844 Ga0373951_0024023
845 Ga0373952_0023324
846 Ga0373923_0061113
847 Ga0373923_0090094
848 Ga0373923_0112809
849 Ga0373923_0191993
850 Ga0373936_0013017
851 Ga0373936_0031572
852 Ga0373936_0070418
853 Ga0373936_0105971
854 Ga0373936_0123429
855 Ga0373939_0061003
856 Ga0373941_0039955
857 Ga0373945_0016514
858 Ga0373945_0026727
859 Ga0373945_0103547
860 Ga0373953_0000250
861 Ga0373953_0065996
862 Ga0373953_0115139
863 Ga0373953_0138665
864 Ga0373954_0000176
865 Ga0373954_0002429
866 Ga0373956_0000702
867 Ga0373956_0001074
868 Ga0373956_0006090
869 Ga0373956_0127643
870 Ga0373956_0138557
871 Ga0373957_0001999
872 Ga0373957_0015000
873 Ga0373957_0026283
874 Ga0373957_0069715
875 Ga0373957_0079803
876 Ga0373957_0100742
877 Ga0373957_0113763
878 Ga0373943_0064144
879 Ga0373943_0089336
880 Ga0373943_0194784
881 Ga0373946_0041171
882 Ga0373946_0109926
883 Ga0373955_0000130
884 Ga0373955_0161865
885 Ga0373955_0194548
886 Ga0373955_0230575
887 Ga0373961_0041920
888 Ga0373962_0014151
889 Ga0373924_0000261
890 Ga0373924_0003957
891 Ga0373924_0004962
892 Ga0373924_0123419
893 Ga0373924_0138185
894 Ga0373931_0058817
895 Ga0373935_0022631
896 Ga0373935_0047006
897 Ga0373935_0083240
898 Ga0373935_0084034
899 Ga0373935_0469124
900 Ga0373927_0163575
901 Ga0373927_0250011
902 Ga0373933_0000012
903 Ga0373933_0068637
904 Ga0373933_0073923
905 Ga0373933_0096121
906 Ga0373933_0104746
907 Ga0373933_0228894
908 Ga0373933_0241965
909 Ga0373933_0280164
910 Ga0373933_0282540
911 Ga0373933_0297985
912 Ga0373947_0057481
913 Ga0373947_0065472
914 Ga0373947_0304086
915 Ga0373937_0000040
916 Ga0373937_0008801
917 Ga0373937_0025906
918 Ga0373937_0047400
919 Ga0373937_0055294
920 Ga0373937_0120448
921 Ga0373937_0212744
922 Ga0373937_0605933
923 Ga0373925_0054268
924 Ga0373925_0314903
925 Ga0373925_0425349
926 Ga0373925_0426278
927 Ga0373925_0439385
928 Ga0373925_0491115
929 Ga0395899_0048865
930 Ga0395899_0071373
931 Ga0395899_0080537
932 Ga0395899_0210419
933 Ga0395899_0274657
934 Ga0395899_0281779
935 Ga0395899_0300344
936 Ga0395899_0351711
937 Ga0395900_0079524
938 Ga0395900_0096698
939 Ga0395900_0100564
940 Ga0395900_0103170
941 Ga0395900_0176713
942 Ga0395900_0313431
943 Ga0395900_0455241
944 Ga0395900_0471958
945 Ga0395900_0490896
946 Ga0395900_0595621
947 Ga0395898_0049602
948 Ga0395898_0113460
949 Ga0395898_0140825
950 Ga0395898_0368379
951 Ga0395898_0403472
952 Ga0395898_0480958
953 Ga0395898_0488574
954 Ga0395898_0489178
955 Ga0395898_0513420
956 Ga0395898_0522415
957 Ga0395898_0524099
958 Ga0395898_0569936
959 Ga0395905_0076797
960 Ga0395905_0126078
961 Ga0395905_0225864
962 Ga0395905_0263345
963 Ga0395905_0437260
964 Ga0395905_0477011
965 Ga0395905_0497983
966 Ga0395905_0503774
967 Ga0436364_1202014
968 Ga0395901_0026453
969 Ga0395901_0067646
970 Ga0395901_0096426
971 Ga0395901_0191225
972 Ga0395901_0232972
973 Ga0395901_0276427
974 Ga0395901_0301528
975 Ga0395901_0413848
976 Ga0395901_0524171
977 Ga0395901_0526403
978 Ga0395901_0532284
979 Ga0395901_0560930
980 Ga0395901_0580076
981 Ga0395901_0618229
982 Ga0395901_0716915
983 Ga0395901_0734689
984 Ga0436363_0373886
985 Ga0439443_016461
986 Ga0439448_0013532
987 Ga0439448_0054095
988 Ga0439450_044448
989 Ga0439454_006938
990 Ga0439455_0011969
991 Ga0439455_0049878
992 Ga0439463_036070
993 Ga0450912_000849
994 Ga0450900_008697
995 Ga0450902_014806
996 Ga0439458_0024371
997 Ga0439458_0025857
998 Ga0439459_0020159
999 Ga0439464_0018545
1000 Ga0439460_0015352
1001 Ga0439460_0076141
1002 Ga0439440_0024939
1003 Ga0466967_0375720
1004 Ga0466967_0421748
1005 Ga0495592_0000106
1006 Ga0495592_0302288
1007 Ga0495629_0160786
1008 Ga0495629_0165599
1009 Ga0495629_0271200
1010 Ga0495629_0444679
1011 Ga0495641_0037086
1012 Ga0495641_0105295
1013 Ga0495641_0119925
1014 Ga0495651_0000040
1015 Ga0495651_0147464
1016 Ga0495651_0308646
1017 Ga0495651_0317527
1018 Ga0495653_0001238
1019 Ga0495653_0012497
1020 Ga0495653_0015366
1021 Ga0495580_0322210
1022 Ga0495582_0093933
1023 Ga0495639_0135845
1024 Ga0495662_0018649
1025 Ga0495664_0012965
1026 Ga0495664_0062989
1027 Ga0495664_0156325
1028 Ga0495664_0160337
1029 Ga0495664_0249835
1030 Ga0495584_0063920
1031 Ga0495584_0194860
1032 Ga0495585_0126390
1033 Ga0495594_0238849
1034 Ga0495607_0150576
1035 Ga0495608_0000044
1036 Ga0495608_0007230
1037 Ga0495608_0274032
1038 Ga0495608_0278091
1039 Ga0495616_0103112
1040 Ga0495618_0006909
1041 Ga0495618_0165697
1042 Ga0495618_0243689
1043 Ga0495628_0000450
1044 Ga0495628_0339323
1045 Ga0495628_0376924
1046 Ga0495630_0310524
1047 Ga0495663_0053163
1048 Ga0495663_0081059
1049 Ga0495663_0082324
1050 Ga0495666_0118848
1051 Ga0495642_0055298
1052 Ga0495642_0073705
1053 Ga0495642_0112516
1054 Ga0495652_0001868
1055 Ga0495652_0186424
1056 Ga0495652_0360143
1057 Ga0495665_0081605
1058 Ga0495665_0136231
1059 Ga0495640_0009037
1060 Ga0495640_0230988
1061 Ga0495586_0110080
1062 Ga0495586_0141893
1063 Ga0495587_0000046
1064 Ga0495587_0005951
1065 Ga0495587_0093202
1066 Ga0495587_0165464
1067 Ga0495587_0231784
1068 Ga0495645_0036987
1069 Ga0495645_0169274
1070 Ga0495645_0264758
1071 Ga0495645_0305081
1072 Ga0495667_0000518
1073 Ga0495667_0148981
1074 Ga0495667_0244548
1075 Ga0495667_0289168
1076 Ga0495656_0092172
1077 Ga0495634_0070846
1078 Ga0495634_0206031
1079 Ga0495634_0210951
1080 Ga0495634_0264492
1081 Ga0495634_0295019
1082 Ga0495635_0010480
1083 Ga0495635_0055343
1084 Ga0495635_0094381
1085 Ga0495635_0325562
1086 Ga0495657_0000547
1087 Ga0495657_0079387
1088 Ga0495657_0261500
1089 Ga0495657_0269251
1090 Ga0495657_0324052
1091 Ga0495599_0001467
1092 Ga0495599_0151722
1093 Ga0495599_0266701
1094 Ga0495623_0002970
1095 Ga0495623_0016348
1096 Ga0495623_0166564
1097 Ga0495623_0234325
1098 Ga0495646_0002148
1099 Ga0495646_0065107
1100 Ga0495658_0002611
1101 Ga0495669_0131748
1102 Ga0495613_0014214
1103 Ga0495624_0123951
1104 Ga0495624_0124509
1105 Ga0495624_0134989
1106 Ga0495670_0120844
1107 Ga0495600_0001680
1108 Ga0495600_0042203
1109 Ga0495581_0170896
1110 Ga0495581_0198844
1111 Ga0495581_0225002
1112 Ga0495604_0000049
1113 Ga0495604_0005185
1114 Ga0495604_0203891
1115 Ga0495604_0236715
1116 Ga0495604_0318321
1117 Ga0495604_0318720
1118 Ga0495674_0231361
1119 Ga0495674_0316868
1120 Ga0495674_0319834
1121 Ga0495674_0320808
1122 Ga0495674_0371377
1123 Ga0495674_0476577
1124 Ga0495676_0142501
1125 Ga0495676_0261867
1126 Ga0495680_0000977
1127 Ga0495680_0015200
1128 Ga0495680_0135726
1129 Ga0495680_0263476
1130 Ga0495680_0341889
1131 Ga0495675_0000062
1132 Ga0495675_0001364
1133 Ga0495675_0011972
1134 Ga0495684_0011423
1135 Ga0495684_0151342
1136 Ga0495684_0224649
1137 Ga0495684_0376421
1138 Ga0495593_0157710
1139 Ga0495602_0000558
1140 Ga0495602_0072514
1141 Ga0495602_0163465
1142 Ga0495602_0327873
1143 Ga0495602_0351680
1144 Ga0495602_0363852
1145 Ga0496105_0361282
1146 Ga0496112_0540885
1147 Ga0496113_0466932
1148 Ga0496114_0524611
1149 Ga0496115_0367947
1150 Ga0501031_0114082
1151 Ga0501033_0082499
1152 Ga0501033_0304645
1153 Ga0501036_0358044
1154 Ga0501036_0368251
1155 Ga0501038_0353488
1156 Ga0501039_0303379
1157 Ga0501039_0305645
1158 Ga0501040_0299509
1159 Ga0501040_0300009
1160 Ga0501041_0002382
1161 Ga0501042_0144775
1162 Ga0501042_0191380
1163 Ga0501042_0262569
1164 Ga0501043_0426314
1165 Ga0501046_0159977
1166 Ga0501046_0174983
1167 Ga0501048_0190704
1168 Ga0501068_0327059
1169 Ga0501071_0119899
1170 Ga0501071_0453660
1171 Ga0501072_0010257
1172 Ga0501073_0152609
1173 Ga0501074_0252354
1174 Ga0501075_0283790
1175 Ga0501075_0309147
1176 Ga0501076_0080188
1177 Ga0501076_0353650
1178 Ga0501077_0017119
1179 Ga0501079_0252537
1180 Ga0501079_0323880
1181 Ga0501081_0270216
1182 Ga0501081_0341579
1183 Ga0501035_0005078
1184 Ga0501045_0025108
1185 Ga0501045_0225618
1186 nmdc:mga05p37_512740_c1
1187 nmdc:mga05p37_529107_c1
1188 nmdc:mga05p37_88021_c1
1189 nmdc:mga09592_93406_c1
1190 nmdc:mga0qj67_275989_c1
1191 nmdc:mga06r32_302081_c1
1192 nmdc:mga08y16_86971_c1
1193 nmdc:mga0n895_205124_c1
1194 nmdc:mga0n895_332599_c1
1195 nmdc:mga0n895_370820_c1
1196 nmdc:mga0rr50_221708_c1
1197 nmdc:mga08x19_108071_c1
1198 nmdc:mga08x19_217055_c1
1199 nmdc:mga0a205_265269_c1
1200 Ga0495601_0004008
1201 Ga0495601_0089762
1202 Ga0495601_0236905
1203 Ga0495601_0262415
1204 Ga0495601_0265244
1205 Ga0495601_0276806
1206 Ga0495612_0073171
1207 Ga0495612_0123601
1208 Ga0495612_0163150
1209 Ga0495612_0208173
1210 Ga0495595_0011688
1211 Ga0495595_0021568
1212 Ga0495595_0027584
1213 Ga0495619_0090824
1214 Ga0495619_0302242
1215 Ga0501084_0383567
1216 Ga0590075_037928
1217 Ga0590077_021056
1218 Ga0501082_0385147
1219 Ga0530510_0275776
1220 Ga0530510_0312424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01609

DDE_Tnp_1

Transposase DDE domain

139

312

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kkr-assembly1.cif.gz_A crystal structure of catalytic core domain of biv integrase in crystal form i 0.7313 108 278
8cta-assembly4.cif.gz_M minimal 2:2 ternary complex between bi-224436 bound hiv-1 integrase catalytic core domain dimer and carboxy terminal domains 0.6931 111 276
3ovn-assembly1.cif.gz_A fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase 0.6906 108 276
5cz2-assembly1.cif.gz_A crystal structure of a two-domain fragment of mmtv integrase 0.6898 111 278
8a1q-assembly1.cif.gz_B hiv-1 integrase catalytic core domain and c-terminal domain in complex with allosteric integrase inhibitor stp0404 (pirmitegravir) 0.6884 111 276
ID Description Score Start End Superfamily
af_Q2FW68_1_95_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7972 151 223 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7304 109 259 3.30.420.10
af_Q9FI63_292_491_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7236 198 223 3.80.10.10
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7187 177 223 3.40.50.720
3hpgF02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7021 108 278 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A498QLM4-F1-model_v4 Transposase IS4-like domain-containing protein 0.8969 1 301 GO:0003677
GO:0004803
GO:0006313
AF-A0A498QLM4-F1-model_v4 Transposase IS4-like domain-containing protein 0.8941 1 301 GO:0003677
GO:0004803
GO:0006313
AF-A0A7X6HCB9-F1-model_v4 IS982 family transposase 0.8891 1 301 GO:0003677
GO:0004803
GO:0006313
AF-A0A7X6HCB9-F1-model_v4 IS982 family transposase 0.8864 1 301 GO:0003677
GO:0004803
GO:0006313
AF-A0A538J582-F1-model_v4 IS982 family transposase 0.8859 1 301 GO:0003677
GO:0004803
GO:0006313

Map