F468968

General Info

Members Datasets Scaffolds Average Seq Length
610 271 1220 109

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_11424696|Ga0105238_114246962
Length 130
Sequence LRDANENGYHPQLLTPSRRNTVLARLLLVATFAVGIPTALAAGEPEFTLTLRDHRFTPSEVRVPANVKVKLVVDNQDPSPEEFDSHALNREKVIPGGSKAVIFVGPLAPGRYPFMGEFNAATAQGAVIAQ

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
205 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
206 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.1
Rhizosphere 95.74
Stem 0
Stem Tuber 0
Unclassified 24.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_11424696 3300009551 Unclassified 720
2 Ga0065715_10253318 3300005293 Bacteria 1139
3 Ga0065707_10016787 3300005295 Bacteria 1679
4 Ga0065707_11026564 3300005295 Bacteria 533
5 Ga0070658_10339996 3300005327 Unclassified 1284
6 Ga0070658_10552001 3300005327 Bacteria 997
7 Ga0070676_11177665 3300005328 Bacteria 582
8 Ga0070683_100022189 3300005329 Bacteria 5671
9 Ga0070683_100090829 3300005329 Bacteria 2867
10 Ga0070683_100880099 3300005329 Unclassified 859
11 Ga0070683_100911572 3300005329 Bacteria 843
12 Ga0070683_101350950 3300005329 Bacteria 685
13 Ga0070690_100019367 3300005330 Bacteria 4129
14 Ga0070670_100236584 3300005331 Bacteria 1590
15 Ga0070670_100827831 3300005331 Bacteria 837
16 Ga0070670_101934757 3300005331 Bacteria 543
17 Ga0068869_100145185 3300005334 Unclassified 1835
18 Ga0068869_100180266 3300005334 Unclassified 1656
19 Ga0070666_10008054 3300005335 Bacteria 6522
20 Ga0070666_10895635 3300005335 Bacteria 656
21 Ga0070680_100029926 3300005336 Unclassified 4372
22 Ga0070680_100173897 3300005336 Bacteria 1813
23 Ga0070680_100273312 3300005336 Bacteria 1431
24 Ga0070680_100309153 3300005336 Bacteria 1341
25 Ga0070680_100371232 3300005336 Bacteria 1217
26 Ga0070680_100866676 3300005336 Bacteria 779
27 Ga0070682_100075109 3300005337 Unclassified 2173
28 Ga0070682_100145487 3300005337 Bacteria 1621
29 Ga0068868_100015129 3300005338 Bacteria 5700
30 Ga0068868_100187832 3300005338 Unclassified 1718
31 Ga0070660_100043751 3300005339 Bacteria 3422
32 Ga0070660_100397349 3300005339 Unclassified 1139
33 Ga0070660_100942935 3300005339 Bacteria 728
34 Ga0070660_101608970 3300005339 Bacteria 553
35 Ga0070689_100050698 3300005340 Bacteria 3208
36 Ga0070691_10174056 3300005341 Bacteria 1117
37 Ga0070687_100366153 3300005343 Unclassified 935
38 Ga0070661_100042595 3300005344 Bacteria 3314
39 Ga0070661_100082203 3300005344 Unclassified 2379
40 Ga0070661_100093034 3300005344 Bacteria 2234
41 Ga0070661_100349163 3300005344 Unclassified 1160
42 Ga0070692_10027508 3300005345 Unclassified 2819
43 Ga0070692_10113634 3300005345 Bacteria 1501
44 Ga0070692_10676290 3300005345 Bacteria 692
45 Ga0070671_100047820 3300005355 Bacteria 3556
46 Ga0070671_100939116 3300005355 Bacteria 756
47 Ga0070674_100042230 3300005356 Bacteria 3096
48 Ga0070673_100005115 3300005364 Bacteria 8367
49 Ga0070673_100007079 3300005364 Bacteria 7363
50 Ga0070688_100000557 3300005365 Bacteria 18874
51 Ga0070659_100047794 3300005366 Unclassified 3359
52 Ga0070659_100425799 3300005366 Bacteria 1123
53 Ga0070659_100444917 3300005366 Unclassified 1098
54 Ga0070659_100453547 3300005366 Unclassified 1088
55 Ga0070659_100581174 3300005366 Bacteria 961
56 Ga0070659_100753868 3300005366 Unclassified 844
57 Ga0070667_100041343 3300005367 Bacteria 3868
58 Ga0070667_100131866 3300005367 Unclassified 2182
59 Ga0070667_100784306 3300005367 Bacteria 884
60 Ga0070709_10014276 3300005434 Bacteria 4491
61 Ga0070709_10045038 3300005434 Bacteria 2735
62 Ga0070709_10056819 3300005434 Bacteria 2476
63 Ga0070709_10160510 3300005434 Bacteria 1562
64 Ga0070709_10165974 3300005434 Bacteria 1539
65 Ga0070714_100016452 3300005435 Bacteria 5973
66 Ga0070714_100033161 3300005435 Bacteria 4316
67 Ga0070714_100308520 3300005435 Bacteria 1477
68 Ga0070714_100668989 3300005435 Bacteria 1000
69 Ga0070714_101031038 3300005435 Bacteria 801
70 Ga0070714_101620576 3300005435 Bacteria 632
71 Ga0070714_101719210 3300005435 Unclassified 613
72 Ga0070714_101953263 3300005435 Unclassified 572
73 Ga0070713_100001964 3300005436 Bacteria 13277
74 Ga0070713_100204834 3300005436 Bacteria 1783
75 Ga0070713_100295961 3300005436 Bacteria 1489
76 Ga0070713_100541830 3300005436 Bacteria 1101
77 Ga0070710_10003207 3300005437 Bacteria 7753
78 Ga0070710_10109276 3300005437 Bacteria 1659
79 Ga0070710_10504671 3300005437 Unclassified 829
80 Ga0070710_11005924 3300005437 Bacteria 608
81 Ga0070711_100000685 3300005439 Bacteria 17757
82 Ga0070711_100022151 3300005439 Bacteria 4115
83 Ga0070711_100049857 3300005439 Bacteria 2868
84 Ga0070711_100153663 3300005439 Unclassified 1738
85 Ga0070705_100024105 3300005440 Unclassified 3279
86 Ga0070705_100933280 3300005440 Unclassified 700
87 Ga0070700_100002222 3300005441 Bacteria 9876
88 Ga0070700_101905122 3300005441 Unclassified 514
89 Ga0070694_100003774 3300005444 Bacteria 9035
90 Ga0070694_100570100 3300005444 Bacteria 908
91 Ga0070708_100072142 3300005445 Unclassified 3111
92 Ga0070708_100259148 3300005445 Bacteria 1635
93 Ga0070663_100020093 3300005455 Bacteria 4417
94 Ga0070663_100256436 3300005455 Bacteria 1386
95 Ga0070663_100684971 3300005455 Bacteria 870
96 Ga0070678_100204116 3300005456 Bacteria 1633
97 Ga0070662_100003484 3300005457 Bacteria 9812
98 Ga0070662_100070641 3300005457 Unclassified 2573
99 Ga0070662_100371295 3300005457 Bacteria 1176
100 Ga0070662_100532892 3300005457 Bacteria 982
101 Ga0070681_10000922 3300005458 Bacteria 24859
102 Ga0070681_10542020 3300005458 Bacteria 1077
103 Ga0070681_10577037 3300005458 Bacteria 1038
104 Ga0070681_11172645 3300005458 Unclassified 690
105 Ga0070681_11308147 3300005458 Unclassified 648
106 Ga0068867_100083028 3300005459 Bacteria 2418
107 Ga0068867_100467224 3300005459 Bacteria 1078
108 Ga0068867_102007514 3300005459 Unclassified 547
109 Ga0070706_100063457 3300005467 Unclassified 3414
110 Ga0070707_100010816 3300005468 Bacteria 8496
111 Ga0070698_100791655 3300005471 Unclassified 892
112 Ga0070699_100007430 3300005518 Bacteria 9537
113 Ga0070699_100010689 3300005518 Bacteria 7944
114 Ga0070699_100914447 3300005518 Unclassified 804
115 Ga0070679_100007596 3300005530 Bacteria 10144
116 Ga0070679_100026334 3300005530 Bacteria 5712
117 Ga0070679_100061018 3300005530 Bacteria 3759
118 Ga0070679_100304082 3300005530 Unclassified 1545
119 Ga0070679_100970610 3300005530 Bacteria 793
120 Ga0070684_100039756 3300005535 Bacteria 4047
121 Ga0070684_100230403 3300005535 Bacteria 1691
122 Ga0070697_100172452 3300005536 Bacteria 1831
123 Ga0068853_100017646 3300005539 Bacteria 5891
124 Ga0068853_100026079 3300005539 Bacteria 4906
125 Ga0068853_100333065 3300005539 Bacteria 1409
126 Ga0068853_101473904 3300005539 Bacteria 659
127 Ga0070672_100122390 3300005543 Unclassified 2131
128 Ga0070672_100264526 3300005543 Bacteria 1451
129 Ga0070695_100054542 3300005545 Unclassified 2573
130 Ga0070695_100252021 3300005545 Bacteria 1285
131 Ga0070695_100966281 3300005545 Unclassified 691
132 Ga0070696_100008160 3300005546 Bacteria 7006
133 Ga0070696_100015540 3300005546 Bacteria 5112
134 Ga0070696_100021832 3300005546 Bacteria 4342
135 Ga0070696_100077687 3300005546 Unclassified 2346
136 Ga0070696_100774848 3300005546 Unclassified 788
137 Ga0070696_101738862 3300005546 Unclassified 538
138 Ga0070693_100003938 3300005547 Bacteria 6967
139 Ga0070693_100120345 3300005547 Unclassified 1627
140 Ga0070693_100284446 3300005547 Bacteria 1109
141 Ga0070693_100732795 3300005547 Unclassified 727
142 Ga0070665_100438445 3300005548 Bacteria 1315
143 Ga0070704_100054839 3300005549 Bacteria 2823
144 Ga0070704_100208979 3300005549 Bacteria 1580
145 Ga0068855_100049787 3300005563 Bacteria 4940
146 Ga0068855_100211064 3300005563 Bacteria 2181
147 Ga0068855_100523984 3300005563 Bacteria 1285
148 Ga0070664_100030473 3300005564 Bacteria 4501
149 Ga0070664_100046295 3300005564 Bacteria 3674
150 Ga0070664_100102648 3300005564 Bacteria 2488
151 Ga0070664_100282724 3300005564 Unclassified 1496
152 Ga0070664_100469224 3300005564 Bacteria 1157
153 Ga0070664_100881270 3300005564 Bacteria 839
154 Ga0068857_100022757 3300005577 Bacteria 5514
155 Ga0068857_100061673 3300005577 Bacteria 3332
156 Ga0068857_100123842 3300005577 Bacteria 2329
157 Ga0068857_101303108 3300005577 Bacteria 705
158 Ga0068857_101442641 3300005577 Bacteria 670
159 Ga0068854_100002772 3300005578 Bacteria 10882
160 Ga0068854_100011250 3300005578 Bacteria 5818
161 Ga0068854_100147959 3300005578 Bacteria 1808
162 Ga0068854_100604192 3300005578 Bacteria 937
163 Ga0068856_100010329 3300005614 Bacteria 9069
164 Ga0068856_100056524 3300005614 Bacteria 3872
165 Ga0068856_100189603 3300005614 Bacteria 2070
166 Ga0068856_100390649 3300005614 Bacteria 1411
167 Ga0068856_100482616 3300005614 Bacteria 1260
168 Ga0068856_100650352 3300005614 Bacteria 1075
169 Ga0068856_101100336 3300005614 Bacteria 812
170 Ga0068856_101106920 3300005614 Unclassified 809
171 Ga0068856_101382919 3300005614 Bacteria 718
172 Ga0070702_100090419 3300005615 Bacteria 1855
173 Ga0068852_100079808 3300005616 Unclassified 2899
174 Ga0068852_100951063 3300005616 Bacteria 877
175 Ga0068852_101018671 3300005616 Bacteria 847
176 Ga0068852_101107552 3300005616 Unclassified 812
177 Ga0068852_101182427 3300005616 Bacteria 786
178 Ga0068859_100021303 3300005617 Bacteria 6505
179 Ga0068859_101067027 3300005617 Bacteria 888
180 Ga0068859_101852974 3300005617 Bacteria 666
181 Ga0068864_100029946 3300005618 Bacteria 4613
182 Ga0068864_100371589 3300005618 Unclassified 1353
183 Ga0068866_10003540 3300005718 Bacteria 6398
184 Ga0068861_100971859 3300005719 Bacteria 809
185 Ga0068861_101789834 3300005719 Bacteria 609
186 Ga0068851_10002361 3300005834 Bacteria 8301
187 Ga0068870_10344069 3300005840 Bacteria 955
188 Ga0068863_100008442 3300005841 Bacteria 10060
189 Ga0068863_101555542 3300005841 Bacteria 670
190 Ga0068858_100073489 3300005842 Bacteria 3173
191 Ga0068858_100119393 3300005842 Bacteria 2465
192 Ga0068860_100027148 3300005843 Bacteria 5516
193 Ga0068862_100840604 3300005844 Bacteria 899
194 Ga0081455_10036386 3300005937 Bacteria 4384
195 Ga0081455_10109094 3300005937 Bacteria 2203
196 Ga0081455_10387832 3300005937 Unclassified 973
197 Ga0081539_10182158 3300005985 Bacteria 984
198 Ga0070717_10088364 3300006028 Bacteria 2612
199 Ga0070717_11895697 3300006028 Unclassified 538
200 Ga0075432_10373556 3300006058 Bacteria 609
201 Ga0070715_10019526 3300006163 Bacteria 2601
202 Ga0070715_10317132 3300006163 Bacteria 840
203 Ga0070716_100207823 3300006173 Bacteria 1306
204 Ga0070716_100349671 3300006173 Unclassified 1046
205 Ga0070716_101840020 3300006173 Bacteria 502
206 Ga0070712_100022557 3300006175 Unclassified 4148
207 Ga0070712_100414410 3300006175 Bacteria 1115
208 Ga0070712_100690254 3300006175 Bacteria 870
209 Ga0070712_101060374 3300006175 Bacteria 702
210 Ga0097621_100055376 3300006237 Bacteria 3238
211 Ga0068871_100051124 3300006358 Bacteria 3345
212 Ga0068871_100842627 3300006358 Bacteria 847
213 Ga0075428_100021910 3300006844 Bacteria 7075
214 Ga0075428_100127846 3300006844 Bacteria 2765
215 Ga0075433_11156631 3300006852 Unclassified 672
216 Ga0075434_100008066 3300006871 Bacteria 9766
217 Ga0075434_100980437 3300006871 Bacteria 859
218 Ga0075436_100302201 3300006914 Bacteria 1147
219 Ga0097620_100021303 3300006931 Bacteria 6505
220 Ga0097620_101067292 3300006931 Bacteria 888
221 Ga0097620_101853266 3300006931 Bacteria 666
222 Ga0075435_100024903 3300007076 Bacteria 4652
223 Ga0075435_101102366 3300007076 Unclassified 694
224 Ga0105240_10114645 3300009093 Unclassified 3255
225 Ga0105240_10124211 3300009093 Bacteria 3104
226 Ga0105240_10833089 3300009093 Bacteria 997
227 Ga0111539_10012336 3300009094 Bacteria 10709
228 Ga0105245_10010133 3300009098 Bacteria 8208
229 Ga0105245_10016934 3300009098 Bacteria 6363
230 Ga0105245_10017992 3300009098 Bacteria 6172
231 Ga0114129_10025062 3300009147 Bacteria 8453
232 Ga0105243_11124925 3300009148 Bacteria 795
233 Ga0105243_13129950 3300009148 Bacteria 501
234 Ga0105241_10022568 3300009174 Bacteria 4662
235 Ga0105241_10033477 3300009174 Bacteria 3858
236 Ga0105241_10070320 3300009174 Unclassified 2715
237 Ga0105242_10037555 3300009176 Bacteria 3891
238 Ga0105242_10148744 3300009176 Bacteria 2040
239 Ga0105242_10260741 3300009176 Bacteria 1566
240 Ga0105248_10003363 3300009177 Bacteria 17776
241 Ga0105248_10300304 3300009177 Bacteria 1808
242 Ga0105248_11704613 3300009177 Unclassified 714
243 Ga0105248_13287406 3300009177 Bacteria 514
244 Ga0105237_10132418 3300009545 Unclassified 2487
245 Ga0105237_10167418 3300009545 Bacteria 2197
246 Ga0105237_10196888 3300009545 Bacteria 2015
247 Ga0105237_10273525 3300009545 Bacteria 1692
248 Ga0105237_11674600 3300009545 Unclassified 643
249 Ga0105238_10034470 3300009551 Bacteria 5150
250 Ga0105238_10053675 3300009551 Bacteria 4050
251 Ga0105239_10088197 3300010375 Bacteria 3421
252 Ga0105239_10196570 3300010375 Bacteria 2259
253 Ga0105239_10709731 3300010375 Bacteria 1150
254 Ga0105246_10015419 3300011119 Bacteria 4828
255 Ga0105246_10070546 3300011119 Unclassified 2458
256 Ga0157373_10022821 3300013100 Bacteria 4538
257 Ga0157373_10086342 3300013100 Unclassified 2211
258 Ga0157373_10134445 3300013100 Bacteria 1739
259 Ga0157373_10175683 3300013100 Unclassified 1507
260 Ga0157371_10027736 3300013102 Bacteria 4104
261 Ga0157371_10187302 3300013102 Unclassified 1481
262 Ga0157370_10009629 3300013104 Bacteria 10281
263 Ga0157370_10025810 3300013104 Bacteria 5812
264 Ga0157370_10026914 3300013104 Bacteria 5672
265 Ga0157370_10054073 3300013104 Bacteria 3828
266 Ga0157370_10588641 3300013104 Bacteria 1019
267 Ga0157369_10021014 3300013105 Bacteria 7298
268 Ga0157369_10102226 3300013105 Unclassified 3054
269 Ga0157369_10324992 3300013105 Unclassified 1599
270 Ga0157369_10418979 3300013105 Bacteria 1388
271 Ga0157369_10437897 3300013105 Bacteria 1354
272 Ga0157369_10765766 3300013105 Bacteria 993
273 Ga0157374_10011435 3300013296 Bacteria 7684
274 Ga0157374_10385485 3300013296 Bacteria 1396
275 Ga0157374_10582974 3300013296 Unclassified 1128
276 Ga0157378_10028383 3300013297 Bacteria 4937
277 Ga0157378_10091413 3300013297 Bacteria 2767
278 Ga0157378_11161384 3300013297 Unclassified 811
279 Ga0163162_10011584 3300013306 Bacteria 8599
280 Ga0163162_10014992 3300013306 Bacteria 7571
281 Ga0163162_10064983 3300013306 Bacteria 3694
282 Ga0163162_12153984 3300013306 Unclassified 640
283 Ga0157372_10009556 3300013307 Bacteria 10311
284 Ga0157372_10041123 3300013307 Bacteria 5110
285 Ga0157372_10121364 3300013307 Bacteria 3002
286 Ga0157372_10152556 3300013307 Bacteria 2667
287 Ga0157372_10191688 3300013307 Bacteria 2368
288 Ga0157372_10267195 3300013307 Bacteria 1987
289 Ga0157372_10322422 3300013307 Bacteria 1799
290 Ga0157372_10486034 3300013307 Bacteria 1439
291 Ga0157372_10748959 3300013307 Bacteria 1136
292 Ga0157372_10947410 3300013307 Unclassified 998
293 Ga0157372_10955248 3300013307 Bacteria 993
294 Ga0157372_11645762 3300013307 Unclassified 739
295 Ga0157372_12873900 3300013307 Bacteria 552
296 Ga0157375_10262455 3300013308 Bacteria 1889
297 Ga0157375_10268359 3300013308 Bacteria 1868
298 Ga0157375_13729238 3300013308 Unclassified 506
299 Ga0163163_10141470 3300014325 Bacteria 2448
300 Ga0157380_10019803 3300014326 Bacteria 5020
301 Ga0182008_10177533 3300014497 Bacteria 1077
302 Ga0157377_10022506 3300014745 Bacteria 3328
303 Ga0157377_10227903 3300014745 Bacteria 1196
304 Ga0157377_10275662 3300014745 Bacteria 1100
305 Ga0157379_10001440 3300014968 Bacteria 19527
306 Ga0157379_10781438 3300014968 Bacteria 900
307 Ga0157376_10003933 3300014969 Bacteria 10274
308 Ga0157376_10115369 3300014969 Bacteria 2371
309 Ga0163161_10764172 3300017792 Bacteria 809
310 Ga0206354_10917994 3300020081 Bacteria 627
311 Ga0206353_10760568 3300020082 Bacteria 2330
312 Ga0207656_10077730 3300025321 Bacteria 1486
313 Ga0207656_10355632 3300025321 Bacteria 731
314 Ga0207656_10676307 3300025321 Bacteria 528
315 Ga0207692_10013832 3300025898 Bacteria 3511
316 Ga0207692_10074486 3300025898 Bacteria 1799
317 Ga0207692_10173075 3300025898 Bacteria 1252
318 Ga0207642_10065710 3300025899 Bacteria 1705
319 Ga0207688_10582770 3300025901 Bacteria 704
320 Ga0207680_10069798 3300025903 Bacteria 2172
321 Ga0207680_10144688 3300025903 Bacteria 1579
322 Ga0207680_10260990 3300025903 Bacteria 1199
323 Ga0207680_10860809 3300025903 Bacteria 650
324 Ga0207685_10011537 3300025905 Bacteria 2660
325 Ga0207699_10003806 3300025906 Bacteria 7197
326 Ga0207699_10025276 3300025906 Bacteria 3258
327 Ga0207699_10033272 3300025906 Bacteria 2913
328 Ga0207699_10059639 3300025906 Bacteria 2288
329 Ga0207699_10193308 3300025906 Bacteria 1374
330 Ga0207699_10235965 3300025906 Bacteria 1254
331 Ga0207699_10840883 3300025906 Bacteria 676
332 Ga0207643_10208029 3300025908 Bacteria 1193
333 Ga0207705_10718635 3300025909 Unclassified 776
334 Ga0207705_10726308 3300025909 Bacteria 772
335 Ga0207684_10198511 3300025910 Unclassified 1730
336 Ga0207654_10032627 3300025911 Bacteria 2880
337 Ga0207654_10182585 3300025911 Bacteria 1370
338 Ga0207654_11406569 3300025911 Unclassified 509
339 Ga0207707_10016103 3300025912 Bacteria 6519
340 Ga0207707_10038745 3300025912 Unclassified 4165
341 Ga0207707_10301038 3300025912 Bacteria 1387
342 Ga0207707_10468400 3300025912 Bacteria 1077
343 Ga0207707_11218529 3300025912 Bacteria 608
344 Ga0207695_10103714 3300025913 Bacteria 2835
345 Ga0207695_10401193 3300025913 Bacteria 1256
346 Ga0207695_11396324 3300025913 Bacteria 581
347 Ga0207671_10247845 3300025914 Bacteria 1400
348 Ga0207693_10002039 3300025915 Bacteria 17719
349 Ga0207693_10012883 3300025915 Bacteria 6748
350 Ga0207693_10762808 3300025915 Bacteria 747
351 Ga0207663_10014545 3300025916 Bacteria 4312
352 Ga0207663_10144085 3300025916 Unclassified 1663
353 Ga0207663_10883200 3300025916 Bacteria 714
354 Ga0207660_10016093 3300025917 Bacteria 4945
355 Ga0207660_10082623 3300025917 Bacteria 2364
356 Ga0207660_10179266 3300025917 Bacteria 1645
357 Ga0207660_10690211 3300025917 Bacteria 833
358 Ga0207660_10706303 3300025917 Bacteria 822
359 Ga0207660_10855362 3300025917 Bacteria 742
360 Ga0207662_10148595 3300025918 Bacteria 1489
361 Ga0207657_10000884 3300025919 Bacteria 31683
362 Ga0207657_10001556 3300025919 Bacteria 24611
363 Ga0207657_10004727 3300025919 Bacteria 14376
364 Ga0207649_10166997 3300025920 Bacteria 1529
365 Ga0207649_10202152 3300025920 Unclassified 1404
366 Ga0207649_10777928 3300025920 Bacteria 746
367 Ga0207652_10035989 3300025921 Bacteria 4183
368 Ga0207652_10048304 3300025921 Bacteria 3638
369 Ga0207652_10168077 3300025921 Bacteria 1967
370 Ga0207652_10265552 3300025921 Bacteria 1548
371 Ga0207652_10376489 3300025921 Unclassified 1281
372 Ga0207652_11555553 3300025921 Unclassified 565
373 Ga0207694_10014540 3300025924 Bacteria 5935
374 Ga0207694_11456703 3300025924 Bacteria 578
375 Ga0207650_10158128 3300025925 Bacteria 1793
376 Ga0207650_10173328 3300025925 Bacteria 1715
377 Ga0207687_10001424 3300025927 Bacteria 16351
378 Ga0207687_10087348 3300025927 Bacteria 2266
379 Ga0207687_10291014 3300025927 Unclassified 1313
380 Ga0207700_10010995 3300025928 Bacteria 5749
381 Ga0207700_10101799 3300025928 Bacteria 2292
382 Ga0207700_11170397 3300025928 Bacteria 687
383 Ga0207664_10013768 3300025929 Bacteria 5819
384 Ga0207664_10043396 3300025929 Bacteria 3516
385 Ga0207664_10138326 3300025929 Bacteria 2057
386 Ga0207664_10580734 3300025929 Bacteria 1006
387 Ga0207644_10003706 3300025931 Bacteria 9901
388 Ga0207644_10017620 3300025931 Bacteria 4829
389 Ga0207644_10021030 3300025931 Bacteria 4442
390 Ga0207644_10084912 3300025931 Bacteria 2347
391 Ga0207644_10229626 3300025931 Bacteria 1474
392 Ga0207690_10023615 3300025932 Bacteria 3840
393 Ga0207690_10216428 3300025932 Unclassified 1463
394 Ga0207690_11170043 3300025932 Bacteria 642
395 Ga0207706_10012691 3300025933 Bacteria 7669
396 Ga0207706_10068372 3300025933 Unclassified 3126
397 Ga0207706_10335258 3300025933 Bacteria 1316
398 Ga0207706_10510267 3300025933 Bacteria 1037
399 Ga0207686_10004760 3300025934 Bacteria 7281
400 Ga0207686_10527760 3300025934 Bacteria 920
401 Ga0207670_10255069 3300025936 Bacteria 1357
402 Ga0207669_10020396 3300025937 Bacteria 3476
403 Ga0207704_10118920 3300025938 Bacteria 1803
404 Ga0207665_10009050 3300025939 Bacteria 6537
405 Ga0207665_10027390 3300025939 Bacteria 3766
406 Ga0207665_10249621 3300025939 Bacteria 1311
407 Ga0207665_10286072 3300025939 Bacteria 1228
408 Ga0207691_10126428 3300025940 Unclassified 2262
409 Ga0207691_10636977 3300025940 Bacteria 901
410 Ga0207711_10006326 3300025941 Bacteria 9987
411 Ga0207711_10149488 3300025941 Unclassified 2107
412 Ga0207689_10015464 3300025942 Bacteria 6460
413 Ga0207689_10096513 3300025942 Bacteria 2428
414 Ga0207689_11026737 3300025942 Unclassified 695
415 Ga0207661_10321323 3300025944 Unclassified 1391
416 Ga0207661_10764124 3300025944 Bacteria 890
417 Ga0207679_10079111 3300025945 Bacteria 2506
418 Ga0207679_10101152 3300025945 Unclassified 2254
419 Ga0207679_10123341 3300025945 Bacteria 2066
420 Ga0207679_10384982 3300025945 Unclassified 1230
421 Ga0207667_10018290 3300025949 Bacteria 7864
422 Ga0207667_10024927 3300025949 Bacteria 6556
423 Ga0207667_10035525 3300025949 Bacteria 5345
424 Ga0207667_10140568 3300025949 Bacteria 2486
425 Ga0207667_10171613 3300025949 Bacteria 2229
426 Ga0207667_10334574 3300025949 Bacteria 1546
427 Ga0207667_11481751 3300025949 Unclassified 650
428 Ga0207651_10018714 3300025960 Bacteria 4130
429 Ga0207651_11681473 3300025960 Unclassified 572
430 Ga0207668_10194078 3300025972 Unclassified 1612
431 Ga0207640_10007133 3300025981 Bacteria 6158
432 Ga0207640_10110780 3300025981 Bacteria 1945
433 Ga0207640_10864612 3300025981 Bacteria 788
434 Ga0207640_10901778 3300025981 Bacteria 772
435 Ga0207640_11587328 3300025981 Bacteria 589
436 Ga0207658_10095912 3300025986 Unclassified 2312
437 Ga0207658_10101309 3300025986 Bacteria 2256
438 Ga0207658_10216215 3300025986 Bacteria 1609
439 Ga0207677_10007001 3300026023 Bacteria 6204
440 Ga0207677_10110738 3300026023 Bacteria 2044
441 Ga0207703_10018991 3300026035 Bacteria 5369
442 Ga0207703_10175344 3300026035 Bacteria 1889
443 Ga0207639_10139822 3300026041 Bacteria 2016
444 Ga0207639_10373227 3300026041 Bacteria 1279
445 Ga0207639_11284283 3300026041 Unclassified 687
446 Ga0207678_10116006 3300026067 Bacteria 2285
447 Ga0207678_10159660 3300026067 Bacteria 1925
448 Ga0207678_10169738 3300026067 Unclassified 1863
449 Ga0207678_10386805 3300026067 Bacteria 1210
450 Ga0207708_10007038 3300026075 Bacteria 8311
451 Ga0207702_10006633 3300026078 Bacteria 9954
452 Ga0207702_10051666 3300026078 Bacteria 3475
453 Ga0207702_10146193 3300026078 Unclassified 2145
454 Ga0207702_10179196 3300026078 Unclassified 1950
455 Ga0207702_10490231 3300026078 Bacteria 1197
456 Ga0207702_10601998 3300026078 Bacteria 1078
457 Ga0207702_10657088 3300026078 Bacteria 1031
458 Ga0207702_10840374 3300026078 Bacteria 909
459 Ga0207641_10546276 3300026088 Bacteria 1129
460 Ga0207641_11671772 3300026088 Bacteria 639
461 Ga0207648_10094612 3300026089 Bacteria 2613
462 Ga0207648_10161154 3300026089 Bacteria 1981
463 Ga0207648_11770944 3300026089 Unclassified 579
464 Ga0207676_10003150 3300026095 Bacteria 11780
465 Ga0207674_10051624 3300026116 Unclassified 4196
466 Ga0207674_10382854 3300026116 Bacteria 1360
467 Ga0207674_10643122 3300026116 Bacteria 1024
468 Ga0207675_101008911 3300026118 Bacteria 851
469 Ga0207675_101657999 3300026118 Bacteria 660
470 Ga0207683_10012552 3300026121 Bacteria 7227
471 Ga0207698_10095144 3300026142 Bacteria 2451
472 Ga0207698_10190146 3300026142 Unclassified 1828
473 Ga0207698_10598850 3300026142 Bacteria 1086
474 Ga0207698_10957722 3300026142 Bacteria 865
475 Ga0207428_10009280 3300027907 Bacteria 8830
476 Ga0207428_10500614 3300027907 Bacteria 882
477 Ga0268266_10389175 3300028379 Bacteria 1316
478 Ga0268264_10040297 3300028381 Bacteria 3859
479 Ga0268264_10510913 3300028381 Bacteria 1173
480 Ga0265325_10007060 3300031241 Bacteria 6766
481 Ga0265313_10041087 3300031595 Bacteria 2281
482 Ga0373934_0046379 3300035086 Unclassified 1719
483 Ga0373934_0108610 3300035086 Unclassified 1124
484 Ga0373944_0118871 3300035089 Bacteria 909
485 Ga0373923_0006835 3300035111 Bacteria 3969
486 Ga0373936_0560218 3300035113 Unclassified 535
487 Ga0373945_0068521 3300035116 Unclassified 1338
488 Ga0373953_0036532 3300035117 Bacteria 1935
489 Ga0373953_0143191 3300035117 Bacteria 1023
490 Ga0373954_0040381 3300035118 Bacteria 2173
491 Ga0373956_0082324 3300035119 Unclassified 1478
492 Ga0373956_0225756 3300035119 Unclassified 889
493 Ga0373957_0043624 3300035120 Bacteria 1695
494 Ga0373957_0226873 3300035120 Unclassified 783
495 Ga0373943_0084934 3300035170 Bacteria 1629
496 Ga0373946_0071592 3300035171 Unclassified 1499
497 Ga0373955_0097278 3300035172 Bacteria 1685
498 Ga0373955_0202103 3300035172 Unclassified 1183
499 Ga0373955_0591943 3300035172 Bacteria 679
500 Ga0316574_0076898 3300035398 Unclassified 2115
501 Ga0373931_0685039 3300035691 Unclassified 676
502 Ga0373935_0045120 3300035692 Unclassified 2780
503 Ga0373935_0292555 3300035692 Bacteria 1149
504 Ga0373927_0018035 3300035695 Unclassified 4642
505 Ga0373933_0097212 3300035724 Bacteria 1823
506 Ga0373933_0331207 3300035724 Unclassified 988
507 Ga0373947_0449363 3300035725 Unclassified 873
508 Ga0373937_0098312 3300036401 Bacteria 2714
509 Ga0373937_0158446 3300036401 Unclassified 2122
510 Ga0373937_0178073 3300036401 Bacteria 1996
511 Ga0373937_0383727 3300036401 Bacteria 1332
512 Ga0373937_2109006 3300036401 Bacteria 510
513 Ga0316582_0003354 3300036647 Bacteria 7836
514 Ga0316584_0065266 3300036712 Bacteria 2727
515 Ga0316584_0246580 3300036712 Bacteria 1306
516 Ga0373925_0015345 3300037068 Bacteria 5541
517 Ga0373925_0640856 3300037068 Unclassified 875
518 Ga0395900_1255058 3300037418 Unclassified 655
519 Ga0395900_1290656 3300037418 Bacteria 644
520 Ga0395898_0025146 3300037466 Bacteria 6005
521 Ga0395905_0218847 3300037471 Bacteria 1783
522 Ga0316581_0016553 3300037588 Bacteria 2117
523 Ga0395901_0200122 3300038443 Unclassified 2094
524 Ga0395901_0740233 3300038443 Bacteria 977
525 Ga0451789_0202713 3300041443 Bacteria 559
526 Ga0451804_0341169 3300041463 Bacteria 885
527 Ga0451845_0066334 3300041501 Bacteria 849
528 Ga0451577_0330026 3300042876 Bacteria 1384
529 Ga0466963_0141327 3300044694 Bacteria 1668
530 Ga0466964_0644649 3300044706 Bacteria 585
531 Ga0453684_1731191 3300044712 Bacteria 638
532 Ga0453684_2349583 3300044712 Bacteria 529
533 Ga0451576_0922929 3300045051 Unclassified 916
534 Ga0466958_0051693 3300045836 Bacteria 2489
535 Ga0466967_0911597 3300045976 Bacteria 874
536 Ga0495629_0044448 3300046459 Unclassified 3117
537 Ga0495629_0613020 3300046459 Unclassified 727
538 Ga0495651_0796209 3300046462 Bacteria 583
539 Ga0495582_0022981 3300046473 Bacteria 3410
540 Ga0495582_0583703 3300046473 Unclassified 647
541 Ga0495639_0135905 3300046475 Unclassified 1179
542 Ga0495662_0029461 3300046476 Bacteria 2651
543 Ga0495608_0317579 3300046511 Unclassified 963
544 Ga0495628_0481775 3300046516 Bacteria 898
545 Ga0495630_0243474 3300046517 Unclassified 1374
546 Ga0495637_0084586 3300046520 Bacteria 1260
547 Ga0495666_0152805 3300046526 Bacteria 1073
548 Ga0495665_0030605 3300046531 Unclassified 2881
549 Ga0495665_0289543 3300046531 Bacteria 840
550 Ga0495587_0762540 3300046536 Unclassified 529
551 Ga0495621_0108349 3300046539 Unclassified 1063
552 Ga0495645_0043949 3300046543 Bacteria 3259
553 Ga0495667_0042649 3300046559 Unclassified 3009
554 Ga0495634_0605398 3300046642 Unclassified 636
555 Ga0495635_0162918 3300046663 Unclassified 1517
556 Ga0495659_0073758 3300046664 Unclassified 1283
557 Ga0495588_0074396 3300046674 Unclassified 1769
558 Ga0495623_0562668 3300046679 Unclassified 596
559 Ga0495647_0046526 3300046681 Unclassified 1671
560 Ga0495658_0037046 3300046683 Unclassified 2694
561 Ga0495613_0045607 3300046689 Unclassified 3241
562 Ga0495600_0040842 3300046809 Unclassified 3023
563 Ga0495581_0014843 3300047315 Unclassified 4518
564 Ga0495604_0199317 3300047317 Bacteria 1390
565 Ga0495675_0333264 3300047444 Bacteria 896
566 Ga0495675_0337699 3300047444 Unclassified 888
567 Ga0495684_0005443 3300047471 Bacteria 9907
568 Ga0495684_0930823 3300047471 Bacteria 557
569 Ga0495593_0050742 3300047673 Unclassified 2197
570 Ga0495602_0470152 3300048088 Unclassified 884
571 Ga0496100_0373863 3300048903 Bacteria 1081
572 Ga0496101_0145349 3300048904 Bacteria 1810
573 Ga0496101_1174808 3300048904 Bacteria 602
574 Ga0496102_0114204 3300048905 Unclassified 2520
575 Ga0496104_0101767 3300048907 Bacteria 2751
576 Ga0496105_0018520 3300048908 Bacteria 5601
577 Ga0496106_0120200 3300048909 Bacteria 2053
578 Ga0496107_0083533 3300048910 Bacteria 2329
579 Ga0496107_0358680 3300048910 Bacteria 1085
580 Ga0496108_0819590 3300048911 Bacteria 802
581 Ga0496108_0925883 3300048911 Bacteria 747
582 Ga0496108_0962325 3300048911 Bacteria 730
583 Ga0496109_0021882 3300048912 Bacteria 5660
584 Ga0496109_0623508 3300048912 Bacteria 1015
585 Ga0496109_0952433 3300048912 Bacteria 796
586 Ga0496110_0322260 3300048913 Unclassified 1408
587 Ga0496110_0491854 3300048913 Bacteria 1117
588 Ga0496111_0596668 3300048914 Bacteria 809
589 Ga0496112_0239716 3300048915 Bacteria 1766
590 Ga0496112_0857659 3300048915 Bacteria 831
591 Ga0496113_0781132 3300048916 Unclassified 759
592 Ga0496114_0157392 3300048917 Bacteria 1973
593 Ga0496115_0394987 3300048918 Bacteria 1123
594 Ga0501034_0375571 3300049571 Bacteria 1347
595 Ga0501068_0136179 3300049584 Bacteria 1538
596 Ga0501071_0789425 3300049587 Unclassified 732
597 Ga0501071_0831784 3300049587 Bacteria 712
598 Ga0501044_0446594 3300049823 Bacteria 1200
599 nmdc:mga05p37_216638_c1 3300050507 Bacteria 2312
600 nmdc:mga08y16_33044_c1 3300050511 Bacteria 5436
601 nmdc:mga08y16_517092_c1 3300050511 Bacteria 1211
602 nmdc:mga0n895_16967_c1 3300050512 Bacteria 6699
603 nmdc:mga0n895_55143_c1 3300050512 Bacteria 3911
604 nmdc:mga0rr50_117863_c1 3300050513 Bacteria 2109
605 nmdc:mga0a205_40847_c1 3300050515 Bacteria 4467
606 Ga0495601_0136410 3300053077 Bacteria 1600
607 Ga0495595_0729917 3300053084 Unclassified 508
608 Ga0495619_0045076 3300053085 Unclassified 2896
609 Ga0495619_0896614 3300053085 Unclassified 597
610 Ga0466962_0176506 3300061719 Bacteria 1041
611 Ga0105238_11424696
612 Ga0065715_10253318
613 Ga0065707_10016787
614 Ga0065707_11026564
615 Ga0070658_10339996
616 Ga0070658_10552001
617 Ga0070676_11177665
618 Ga0070683_100022189
619 Ga0070683_100090829
620 Ga0070683_100880099
621 Ga0070683_100911572
622 Ga0070683_101350950
623 Ga0070690_100019367
624 Ga0070670_100236584
625 Ga0070670_100827831
626 Ga0070670_101934757
627 Ga0068869_100145185
628 Ga0068869_100180266
629 Ga0070666_10008054
630 Ga0070666_10895635
631 Ga0070680_100029926
632 Ga0070680_100173897
633 Ga0070680_100273312
634 Ga0070680_100309153
635 Ga0070680_100371232
636 Ga0070680_100866676
637 Ga0070682_100075109
638 Ga0070682_100145487
639 Ga0068868_100015129
640 Ga0068868_100187832
641 Ga0070660_100043751
642 Ga0070660_100397349
643 Ga0070660_100942935
644 Ga0070660_101608970
645 Ga0070689_100050698
646 Ga0070691_10174056
647 Ga0070687_100366153
648 Ga0070661_100042595
649 Ga0070661_100082203
650 Ga0070661_100093034
651 Ga0070661_100349163
652 Ga0070692_10027508
653 Ga0070692_10113634
654 Ga0070692_10676290
655 Ga0070671_100047820
656 Ga0070671_100939116
657 Ga0070674_100042230
658 Ga0070673_100005115
659 Ga0070673_100007079
660 Ga0070688_100000557
661 Ga0070659_100047794
662 Ga0070659_100425799
663 Ga0070659_100444917
664 Ga0070659_100453547
665 Ga0070659_100581174
666 Ga0070659_100753868
667 Ga0070667_100041343
668 Ga0070667_100131866
669 Ga0070667_100784306
670 Ga0070709_10014276
671 Ga0070709_10045038
672 Ga0070709_10056819
673 Ga0070709_10160510
674 Ga0070709_10165974
675 Ga0070714_100016452
676 Ga0070714_100033161
677 Ga0070714_100308520
678 Ga0070714_100668989
679 Ga0070714_101031038
680 Ga0070714_101620576
681 Ga0070714_101719210
682 Ga0070714_101953263
683 Ga0070713_100001964
684 Ga0070713_100204834
685 Ga0070713_100295961
686 Ga0070713_100541830
687 Ga0070710_10003207
688 Ga0070710_10109276
689 Ga0070710_10504671
690 Ga0070710_11005924
691 Ga0070711_100000685
692 Ga0070711_100022151
693 Ga0070711_100049857
694 Ga0070711_100153663
695 Ga0070705_100024105
696 Ga0070705_100933280
697 Ga0070700_100002222
698 Ga0070700_101905122
699 Ga0070694_100003774
700 Ga0070694_100570100
701 Ga0070708_100072142
702 Ga0070708_100259148
703 Ga0070663_100020093
704 Ga0070663_100256436
705 Ga0070663_100684971
706 Ga0070678_100204116
707 Ga0070662_100003484
708 Ga0070662_100070641
709 Ga0070662_100371295
710 Ga0070662_100532892
711 Ga0070681_10000922
712 Ga0070681_10542020
713 Ga0070681_10577037
714 Ga0070681_11172645
715 Ga0070681_11308147
716 Ga0068867_100083028
717 Ga0068867_100467224
718 Ga0068867_102007514
719 Ga0070706_100063457
720 Ga0070707_100010816
721 Ga0070698_100791655
722 Ga0070699_100007430
723 Ga0070699_100010689
724 Ga0070699_100914447
725 Ga0070679_100007596
726 Ga0070679_100026334
727 Ga0070679_100061018
728 Ga0070679_100304082
729 Ga0070679_100970610
730 Ga0070684_100039756
731 Ga0070684_100230403
732 Ga0070697_100172452
733 Ga0068853_100017646
734 Ga0068853_100026079
735 Ga0068853_100333065
736 Ga0068853_101473904
737 Ga0070672_100122390
738 Ga0070672_100264526
739 Ga0070695_100054542
740 Ga0070695_100252021
741 Ga0070695_100966281
742 Ga0070696_100008160
743 Ga0070696_100015540
744 Ga0070696_100021832
745 Ga0070696_100077687
746 Ga0070696_100774848
747 Ga0070696_101738862
748 Ga0070693_100003938
749 Ga0070693_100120345
750 Ga0070693_100284446
751 Ga0070693_100732795
752 Ga0070665_100438445
753 Ga0070704_100054839
754 Ga0070704_100208979
755 Ga0068855_100049787
756 Ga0068855_100211064
757 Ga0068855_100523984
758 Ga0070664_100030473
759 Ga0070664_100046295
760 Ga0070664_100102648
761 Ga0070664_100282724
762 Ga0070664_100469224
763 Ga0070664_100881270
764 Ga0068857_100022757
765 Ga0068857_100061673
766 Ga0068857_100123842
767 Ga0068857_101303108
768 Ga0068857_101442641
769 Ga0068854_100002772
770 Ga0068854_100011250
771 Ga0068854_100147959
772 Ga0068854_100604192
773 Ga0068856_100010329
774 Ga0068856_100056524
775 Ga0068856_100189603
776 Ga0068856_100390649
777 Ga0068856_100482616
778 Ga0068856_100650352
779 Ga0068856_101100336
780 Ga0068856_101106920
781 Ga0068856_101382919
782 Ga0070702_100090419
783 Ga0068852_100079808
784 Ga0068852_100951063
785 Ga0068852_101018671
786 Ga0068852_101107552
787 Ga0068852_101182427
788 Ga0068859_100021303
789 Ga0068859_101067027
790 Ga0068859_101852974
791 Ga0068864_100029946
792 Ga0068864_100371589
793 Ga0068866_10003540
794 Ga0068861_100971859
795 Ga0068861_101789834
796 Ga0068851_10002361
797 Ga0068870_10344069
798 Ga0068863_100008442
799 Ga0068863_101555542
800 Ga0068858_100073489
801 Ga0068858_100119393
802 Ga0068860_100027148
803 Ga0068862_100840604
804 Ga0081455_10036386
805 Ga0081455_10109094
806 Ga0081455_10387832
807 Ga0081539_10182158
808 Ga0070717_10088364
809 Ga0070717_11895697
810 Ga0075432_10373556
811 Ga0070715_10019526
812 Ga0070715_10317132
813 Ga0070716_100207823
814 Ga0070716_100349671
815 Ga0070716_101840020
816 Ga0070712_100022557
817 Ga0070712_100414410
818 Ga0070712_100690254
819 Ga0070712_101060374
820 Ga0097621_100055376
821 Ga0068871_100051124
822 Ga0068871_100842627
823 Ga0075428_100021910
824 Ga0075428_100127846
825 Ga0075433_11156631
826 Ga0075434_100008066
827 Ga0075434_100980437
828 Ga0075436_100302201
829 Ga0097620_100021303
830 Ga0097620_101067292
831 Ga0097620_101853266
832 Ga0075435_100024903
833 Ga0075435_101102366
834 Ga0105240_10114645
835 Ga0105240_10124211
836 Ga0105240_10833089
837 Ga0111539_10012336
838 Ga0105245_10010133
839 Ga0105245_10016934
840 Ga0105245_10017992
841 Ga0114129_10025062
842 Ga0105243_11124925
843 Ga0105243_13129950
844 Ga0105241_10022568
845 Ga0105241_10033477
846 Ga0105241_10070320
847 Ga0105242_10037555
848 Ga0105242_10148744
849 Ga0105242_10260741
850 Ga0105248_10003363
851 Ga0105248_10300304
852 Ga0105248_11704613
853 Ga0105248_13287406
854 Ga0105237_10132418
855 Ga0105237_10167418
856 Ga0105237_10196888
857 Ga0105237_10273525
858 Ga0105237_11674600
859 Ga0105238_10034470
860 Ga0105238_10053675
861 Ga0105239_10088197
862 Ga0105239_10196570
863 Ga0105239_10709731
864 Ga0105246_10015419
865 Ga0105246_10070546
866 Ga0157373_10022821
867 Ga0157373_10086342
868 Ga0157373_10134445
869 Ga0157373_10175683
870 Ga0157371_10027736
871 Ga0157371_10187302
872 Ga0157370_10009629
873 Ga0157370_10025810
874 Ga0157370_10026914
875 Ga0157370_10054073
876 Ga0157370_10588641
877 Ga0157369_10021014
878 Ga0157369_10102226
879 Ga0157369_10324992
880 Ga0157369_10418979
881 Ga0157369_10437897
882 Ga0157369_10765766
883 Ga0157374_10011435
884 Ga0157374_10385485
885 Ga0157374_10582974
886 Ga0157378_10028383
887 Ga0157378_10091413
888 Ga0157378_11161384
889 Ga0163162_10011584
890 Ga0163162_10014992
891 Ga0163162_10064983
892 Ga0163162_12153984
893 Ga0157372_10009556
894 Ga0157372_10041123
895 Ga0157372_10121364
896 Ga0157372_10152556
897 Ga0157372_10191688
898 Ga0157372_10267195
899 Ga0157372_10322422
900 Ga0157372_10486034
901 Ga0157372_10748959
902 Ga0157372_10947410
903 Ga0157372_10955248
904 Ga0157372_11645762
905 Ga0157372_12873900
906 Ga0157375_10262455
907 Ga0157375_10268359
908 Ga0157375_13729238
909 Ga0163163_10141470
910 Ga0157380_10019803
911 Ga0182008_10177533
912 Ga0157377_10022506
913 Ga0157377_10227903
914 Ga0157377_10275662
915 Ga0157379_10001440
916 Ga0157379_10781438
917 Ga0157376_10003933
918 Ga0157376_10115369
919 Ga0163161_10764172
920 Ga0206354_10917994
921 Ga0206353_10760568
922 Ga0207656_10077730
923 Ga0207656_10355632
924 Ga0207656_10676307
925 Ga0207692_10013832
926 Ga0207692_10074486
927 Ga0207692_10173075
928 Ga0207642_10065710
929 Ga0207688_10582770
930 Ga0207680_10069798
931 Ga0207680_10144688
932 Ga0207680_10260990
933 Ga0207680_10860809
934 Ga0207685_10011537
935 Ga0207699_10003806
936 Ga0207699_10025276
937 Ga0207699_10033272
938 Ga0207699_10059639
939 Ga0207699_10193308
940 Ga0207699_10235965
941 Ga0207699_10840883
942 Ga0207643_10208029
943 Ga0207705_10718635
944 Ga0207705_10726308
945 Ga0207684_10198511
946 Ga0207654_10032627
947 Ga0207654_10182585
948 Ga0207654_11406569
949 Ga0207707_10016103
950 Ga0207707_10038745
951 Ga0207707_10301038
952 Ga0207707_10468400
953 Ga0207707_11218529
954 Ga0207695_10103714
955 Ga0207695_10401193
956 Ga0207695_11396324
957 Ga0207671_10247845
958 Ga0207693_10002039
959 Ga0207693_10012883
960 Ga0207693_10762808
961 Ga0207663_10014545
962 Ga0207663_10144085
963 Ga0207663_10883200
964 Ga0207660_10016093
965 Ga0207660_10082623
966 Ga0207660_10179266
967 Ga0207660_10690211
968 Ga0207660_10706303
969 Ga0207660_10855362
970 Ga0207662_10148595
971 Ga0207657_10000884
972 Ga0207657_10001556
973 Ga0207657_10004727
974 Ga0207649_10166997
975 Ga0207649_10202152
976 Ga0207649_10777928
977 Ga0207652_10035989
978 Ga0207652_10048304
979 Ga0207652_10168077
980 Ga0207652_10265552
981 Ga0207652_10376489
982 Ga0207652_11555553
983 Ga0207694_10014540
984 Ga0207694_11456703
985 Ga0207650_10158128
986 Ga0207650_10173328
987 Ga0207687_10001424
988 Ga0207687_10087348
989 Ga0207687_10291014
990 Ga0207700_10010995
991 Ga0207700_10101799
992 Ga0207700_11170397
993 Ga0207664_10013768
994 Ga0207664_10043396
995 Ga0207664_10138326
996 Ga0207664_10580734
997 Ga0207644_10003706
998 Ga0207644_10017620
999 Ga0207644_10021030
1000 Ga0207644_10084912
1001 Ga0207644_10229626
1002 Ga0207690_10023615
1003 Ga0207690_10216428
1004 Ga0207690_11170043
1005 Ga0207706_10012691
1006 Ga0207706_10068372
1007 Ga0207706_10335258
1008 Ga0207706_10510267
1009 Ga0207686_10004760
1010 Ga0207686_10527760
1011 Ga0207670_10255069
1012 Ga0207669_10020396
1013 Ga0207704_10118920
1014 Ga0207665_10009050
1015 Ga0207665_10027390
1016 Ga0207665_10249621
1017 Ga0207665_10286072
1018 Ga0207691_10126428
1019 Ga0207691_10636977
1020 Ga0207711_10006326
1021 Ga0207711_10149488
1022 Ga0207689_10015464
1023 Ga0207689_10096513
1024 Ga0207689_11026737
1025 Ga0207661_10321323
1026 Ga0207661_10764124
1027 Ga0207679_10079111
1028 Ga0207679_10101152
1029 Ga0207679_10123341
1030 Ga0207679_10384982
1031 Ga0207667_10018290
1032 Ga0207667_10024927
1033 Ga0207667_10035525
1034 Ga0207667_10140568
1035 Ga0207667_10171613
1036 Ga0207667_10334574
1037 Ga0207667_11481751
1038 Ga0207651_10018714
1039 Ga0207651_11681473
1040 Ga0207668_10194078
1041 Ga0207640_10007133
1042 Ga0207640_10110780
1043 Ga0207640_10864612
1044 Ga0207640_10901778
1045 Ga0207640_11587328
1046 Ga0207658_10095912
1047 Ga0207658_10101309
1048 Ga0207658_10216215
1049 Ga0207677_10007001
1050 Ga0207677_10110738
1051 Ga0207703_10018991
1052 Ga0207703_10175344
1053 Ga0207639_10139822
1054 Ga0207639_10373227
1055 Ga0207639_11284283
1056 Ga0207678_10116006
1057 Ga0207678_10159660
1058 Ga0207678_10169738
1059 Ga0207678_10386805
1060 Ga0207708_10007038
1061 Ga0207702_10006633
1062 Ga0207702_10051666
1063 Ga0207702_10146193
1064 Ga0207702_10179196
1065 Ga0207702_10490231
1066 Ga0207702_10601998
1067 Ga0207702_10657088
1068 Ga0207702_10840374
1069 Ga0207641_10546276
1070 Ga0207641_11671772
1071 Ga0207648_10094612
1072 Ga0207648_10161154
1073 Ga0207648_11770944
1074 Ga0207676_10003150
1075 Ga0207674_10051624
1076 Ga0207674_10382854
1077 Ga0207674_10643122
1078 Ga0207675_101008911
1079 Ga0207675_101657999
1080 Ga0207683_10012552
1081 Ga0207698_10095144
1082 Ga0207698_10190146
1083 Ga0207698_10598850
1084 Ga0207698_10957722
1085 Ga0207428_10009280
1086 Ga0207428_10500614
1087 Ga0268266_10389175
1088 Ga0268264_10040297
1089 Ga0268264_10510913
1090 Ga0265325_10007060
1091 Ga0265313_10041087
1092 Ga0373934_0046379
1093 Ga0373934_0108610
1094 Ga0373944_0118871
1095 Ga0373923_0006835
1096 Ga0373936_0560218
1097 Ga0373945_0068521
1098 Ga0373953_0036532
1099 Ga0373953_0143191
1100 Ga0373954_0040381
1101 Ga0373956_0082324
1102 Ga0373956_0225756
1103 Ga0373957_0043624
1104 Ga0373957_0226873
1105 Ga0373943_0084934
1106 Ga0373946_0071592
1107 Ga0373955_0097278
1108 Ga0373955_0202103
1109 Ga0373955_0591943
1110 Ga0316574_0076898
1111 Ga0373931_0685039
1112 Ga0373935_0045120
1113 Ga0373935_0292555
1114 Ga0373927_0018035
1115 Ga0373933_0097212
1116 Ga0373933_0331207
1117 Ga0373947_0449363
1118 Ga0373937_0098312
1119 Ga0373937_0158446
1120 Ga0373937_0178073
1121 Ga0373937_0383727
1122 Ga0373937_2109006
1123 Ga0316582_0003354
1124 Ga0316584_0065266
1125 Ga0316584_0246580
1126 Ga0373925_0015345
1127 Ga0373925_0640856
1128 Ga0395900_1255058
1129 Ga0395900_1290656
1130 Ga0395898_0025146
1131 Ga0395905_0218847
1132 Ga0316581_0016553
1133 Ga0395901_0200122
1134 Ga0395901_0740233
1135 Ga0451789_0202713
1136 Ga0451804_0341169
1137 Ga0451845_0066334
1138 Ga0451577_0330026
1139 Ga0466963_0141327
1140 Ga0466964_0644649
1141 Ga0453684_1731191
1142 Ga0453684_2349583
1143 Ga0451576_0922929
1144 Ga0466958_0051693
1145 Ga0466967_0911597
1146 Ga0495629_0044448
1147 Ga0495629_0613020
1148 Ga0495651_0796209
1149 Ga0495582_0022981
1150 Ga0495582_0583703
1151 Ga0495639_0135905
1152 Ga0495662_0029461
1153 Ga0495608_0317579
1154 Ga0495628_0481775
1155 Ga0495630_0243474
1156 Ga0495637_0084586
1157 Ga0495666_0152805
1158 Ga0495665_0030605
1159 Ga0495665_0289543
1160 Ga0495587_0762540
1161 Ga0495621_0108349
1162 Ga0495645_0043949
1163 Ga0495667_0042649
1164 Ga0495634_0605398
1165 Ga0495635_0162918
1166 Ga0495659_0073758
1167 Ga0495588_0074396
1168 Ga0495623_0562668
1169 Ga0495647_0046526
1170 Ga0495658_0037046
1171 Ga0495613_0045607
1172 Ga0495600_0040842
1173 Ga0495581_0014843
1174 Ga0495604_0199317
1175 Ga0495675_0333264
1176 Ga0495675_0337699
1177 Ga0495684_0005443
1178 Ga0495684_0930823
1179 Ga0495593_0050742
1180 Ga0495602_0470152
1181 Ga0496100_0373863
1182 Ga0496101_0145349
1183 Ga0496101_1174808
1184 Ga0496102_0114204
1185 Ga0496104_0101767
1186 Ga0496105_0018520
1187 Ga0496106_0120200
1188 Ga0496107_0083533
1189 Ga0496107_0358680
1190 Ga0496108_0819590
1191 Ga0496108_0925883
1192 Ga0496108_0962325
1193 Ga0496109_0021882
1194 Ga0496109_0623508
1195 Ga0496109_0952433
1196 Ga0496110_0322260
1197 Ga0496110_0491854
1198 Ga0496111_0596668
1199 Ga0496112_0239716
1200 Ga0496112_0857659
1201 Ga0496113_0781132
1202 Ga0496114_0157392
1203 Ga0496115_0394987
1204 Ga0501034_0375571
1205 Ga0501068_0136179
1206 Ga0501071_0789425
1207 Ga0501071_0831784
1208 Ga0501044_0446594
1209 nmdc:mga05p37_216638_c1
1210 nmdc:mga08y16_33044_c1
1211 nmdc:mga08y16_517092_c1
1212 nmdc:mga0n895_16967_c1
1213 nmdc:mga0n895_55143_c1
1214 nmdc:mga0rr50_117863_c1
1215 nmdc:mga0a205_40847_c1
1216 Ga0495601_0136410
1217 Ga0495595_0729917
1218 Ga0495619_0045076
1219 Ga0495619_0896614
1220 Ga0466962_0176506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13473

Cupredoxin_1

Cupredoxin-like domain

24

129

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tk2-assembly3.cif.gz_C crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis 0.9251 21 106
5u7n-assembly7.cif.gz_G crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop 0.9145 22 106
4hcf-assembly2.cif.gz_B crystal structure of uncharacterized cupredoxin-like domain protein cupredoxin_1 with copper bound from bacillus anthracis 0.9043 18 106
4f2f-assembly1.cif.gz_A crystal structure of the metal binding domain (mbd) of the streptococcus pneumoniae d39 cu(i) exporting p-type atpase copa with cu(i) 0.8964 22 106
5tk2-assembly3.cif.gz_C crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis 0.8958 21 106
ID Description Score Start End Superfamily
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9279 21 106 2.60.40.420
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9155 22 106 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9081 21 106 2.60.40.420
4f2fA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8964 22 106 2.60.40.420
4f2eA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.881 22 106 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A7W8D273-F1-model_v4 Heme/copper-type cytochrome/quinol oxidase subunit 2 1.003 21 106
AF-A0A0F3MBZ7-F1-model_v4 Cupredoxin-like domain protein 0.9967 26 106
AF-A0A849TED3-F1-model_v4 Cupredoxin domain-containing protein 0.9966 18 106
AF-K6ZD16-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9965 19 106
AF-A0A2V6Q6R1-F1-model_v4 Cupredoxin domain-containing protein 0.996 19 106

Map