F468917

General Info

Members Datasets Scaffolds Average Seq Length
609 261 1218 193

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_116512_c1|nmdc:mga0qj67_116512_c1_783_1433
Length 216
Sequence VNGTGSRASVPFVYLDATAEEGLMSFIVLLVVLAVLVFWVIGAYNGLINLKNQVVNAWKQIDVQLKRRHDLIPNLVNTVKGAMQFERETLEAVVAARNQAIKVQQTPGAHVGATAEAEAQLTGALSRLLAVVEAYPDLKATGNVAQLQEELTSTENKIAFARQLYNDTATQYNTKQQQFPTMLVAGMAGASRVELWEITDAAERAVPNVDLSFGKS

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
179 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
180 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
254 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
255 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
256 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 0.99
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_116512_c1 3300050509 Bacteria 2159
2 JGI25153J46596_10000622 3300003215 Bacteria 21691
3 Ga0058862_11933853 3300004803 Bacteria 652
4 Ga0065712_10314536 3300005290 Bacteria 838
5 Ga0065715_10554465 3300005293 Unclassified 738
6 Ga0065707_10091174 3300005295 Bacteria 3992
7 Ga0065707_10378716 3300005295 Bacteria 880
8 Ga0065707_10581984 3300005295 Bacteria 701
9 Ga0070658_10195034 3300005327 Bacteria 1708
10 Ga0070676_10011824 3300005328 Bacteria 4752
11 Ga0070683_100017612 3300005329 Bacteria 6314
12 Ga0070670_100025742 3300005331 Bacteria 5063
13 Ga0070670_100122479 3300005331 Bacteria 2243
14 Ga0070670_100433732 3300005331 Bacteria 1163
15 Ga0070677_10013590 3300005333 Bacteria 2851
16 Ga0070677_10165110 3300005333 Bacteria 1042
17 Ga0068869_100005821 3300005334 Bacteria 7780
18 Ga0070680_100033324 3300005336 Bacteria 4151
19 Ga0068868_100018713 3300005338 Bacteria 5182
20 Ga0068868_100269170 3300005338 Bacteria 1439
21 Ga0070689_100022559 3300005340 Bacteria 4701
22 Ga0070691_10173043 3300005341 Bacteria 1120
23 Ga0070687_100030371 3300005343 Bacteria 2641
24 Ga0070687_100074057 3300005343 Bacteria 1837
25 Ga0070661_100003788 3300005344 Bacteria 10422
26 Ga0070661_100007385 3300005344 Bacteria 7575
27 Ga0070661_100240525 3300005344 Bacteria 1394
28 Ga0070668_100001454 3300005347 Bacteria 17112
29 Ga0070668_100006559 3300005347 Bacteria 8622
30 Ga0070669_100001653 3300005353 Bacteria 16126
31 Ga0070669_100008777 3300005353 Bacteria 7212
32 Ga0070669_100041643 3300005353 Bacteria 3341
33 Ga0070675_100020311 3300005354 Bacteria 5300
34 Ga0070675_100026030 3300005354 Bacteria 4692
35 Ga0070675_100171375 3300005354 Bacteria 1872
36 Ga0070675_101376611 3300005354 Bacteria 650
37 Ga0070671_100190399 3300005355 Bacteria 1738
38 Ga0070674_100220309 3300005356 Bacteria 1475
39 Ga0070673_100232808 3300005364 Bacteria 1599
40 Ga0070688_100009076 3300005365 Bacteria 5423
41 Ga0070659_100069339 3300005366 Bacteria 2798
42 Ga0070667_100031912 3300005367 Bacteria 4391
43 Ga0070703_10125976 3300005406 Unclassified 935
44 Ga0070709_10009509 3300005434 Bacteria 5365
45 Ga0070713_100432951 3300005436 Bacteria 1233
46 Ga0070701_10047936 3300005438 Bacteria 2202
47 Ga0070701_10109650 3300005438 Bacteria 1540
48 Ga0070711_100000374 3300005439 Bacteria 23183
49 Ga0070705_100003362 3300005440 Bacteria 7855
50 Ga0070705_100021206 3300005440 Bacteria 3452
51 Ga0070705_100049471 3300005440 Bacteria 2441
52 Ga0070705_100149533 3300005440 Bacteria 1547
53 Ga0070705_100200398 3300005440 Bacteria 1368
54 Ga0070700_100057645 3300005441 Bacteria 2438
55 Ga0070700_100156932 3300005441 Bacteria 1562
56 Ga0070700_100176292 3300005441 Unclassified 1484
57 Ga0070694_100001241 3300005444 Bacteria 14774
58 Ga0070694_100003690 3300005444 Bacteria 9136
59 Ga0070694_100056008 3300005444 Bacteria 2676
60 Ga0070694_100066375 3300005444 Bacteria 2475
61 Ga0070694_100077089 3300005444 Bacteria 2309
62 Ga0070694_100097459 3300005444 Bacteria 2074
63 Ga0070694_100143933 3300005444 Bacteria 1734
64 Ga0070694_100153889 3300005444 Bacteria 1682
65 Ga0070708_100007642 3300005445 Bacteria 8658
66 Ga0070708_100017743 3300005445 Bacteria 5943
67 Ga0070708_100058497 3300005445 Bacteria 3434
68 Ga0070708_100240006 3300005445 Bacteria 1701
69 Ga0070708_100541667 3300005445 Bacteria 1098
70 Ga0070708_101406363 3300005445 Bacteria 651
71 Ga0070678_100199080 3300005456 Bacteria 1652
72 Ga0070662_100024969 3300005457 Bacteria 4123
73 Ga0070662_100184161 3300005457 Bacteria 1648
74 Ga0070681_10000443 3300005458 Bacteria 33780
75 Ga0070681_10071919 3300005458 Bacteria 3423
76 Ga0068867_100035693 3300005459 Bacteria 3607
77 Ga0068867_100074821 3300005459 Bacteria 2540
78 Ga0068867_100267992 3300005459 Bacteria 1395
79 Ga0068867_100380091 3300005459 Bacteria 1186
80 Ga0070685_10063913 3300005466 Bacteria 2163
81 Ga0070706_100003743 3300005467 Bacteria 14868
82 Ga0070706_100144440 3300005467 Bacteria 2222
83 Ga0070706_101072714 3300005467 Bacteria 742
84 Ga0070707_100003591 3300005468 Bacteria 14631
85 Ga0070707_100039248 3300005468 Bacteria 4525
86 Ga0070707_100082133 3300005468 Bacteria 3112
87 Ga0070707_100082644 3300005468 Bacteria 3102
88 Ga0070707_100372708 3300005468 Bacteria 1387
89 Ga0070707_100492768 3300005468 Bacteria 1187
90 Ga0070698_100017318 3300005471 Bacteria 7593
91 Ga0070698_100072331 3300005471 Bacteria 3456
92 Ga0070699_100012384 3300005518 Bacteria 7360
93 Ga0070699_100047994 3300005518 Bacteria 3695
94 Ga0070699_100378918 3300005518 Bacteria 1277
95 Ga0070699_100860576 3300005518 Bacteria 830
96 Ga0070679_100293048 3300005530 Bacteria 1578
97 Ga0070684_100028114 3300005535 Bacteria 4754
98 Ga0070684_100072651 3300005535 Bacteria 3029
99 Ga0070684_100440905 3300005535 Bacteria 1203
100 Ga0070697_100005894 3300005536 Bacteria 9456
101 Ga0070697_100009242 3300005536 Bacteria 7704
102 Ga0070697_100022556 3300005536 Bacteria 4999
103 Ga0070697_100039846 3300005536 Bacteria 3800
104 Ga0070697_100060426 3300005536 Bacteria 3089
105 Ga0070697_100075045 3300005536 Bacteria 2779
106 Ga0070697_100626453 3300005536 Bacteria 946
107 Ga0068853_100022733 3300005539 Bacteria 5240
108 Ga0068853_100270007 3300005539 Bacteria 1566
109 Ga0070672_100008367 3300005543 Bacteria 7072
110 Ga0070672_100017321 3300005543 Bacteria 5182
111 Ga0070672_100025238 3300005543 Bacteria 4406
112 Ga0070686_100042085 3300005544 Bacteria 2859
113 Ga0070686_100235620 3300005544 Bacteria 1330
114 Ga0070695_100010555 3300005545 Bacteria 5517
115 Ga0070695_100013544 3300005545 Bacteria 4902
116 Ga0070695_100015705 3300005545 Bacteria 4574
117 Ga0070695_100016433 3300005545 Bacteria 4478
118 Ga0070695_100118880 3300005545 Bacteria 1805
119 Ga0070695_100153702 3300005545 Bacteria 1608
120 Ga0070695_100289392 3300005545 Unclassified 1207
121 Ga0070695_100305708 3300005545 Bacteria 1177
122 Ga0070695_100341681 3300005545 Bacteria 1119
123 Ga0070696_100003663 3300005546 Bacteria 10249
124 Ga0070696_100005629 3300005546 Bacteria 8367
125 Ga0070696_100007938 3300005546 Bacteria 7086
126 Ga0070696_100047697 3300005546 Bacteria 2973
127 Ga0070696_100052530 3300005546 Bacteria 2835
128 Ga0070696_100075208 3300005546 Bacteria 2382
129 Ga0070665_100008910 3300005548 Bacteria 10163
130 Ga0070665_100091111 3300005548 Bacteria 3054
131 Ga0070665_100162511 3300005548 Bacteria 2235
132 Ga0070665_100572918 3300005548 Bacteria 1142
133 Ga0070704_100000065 3300005549 Bacteria 34530
134 Ga0070704_100009808 3300005549 Bacteria 5807
135 Ga0070704_100045538 3300005549 Bacteria 3053
136 Ga0070704_100127497 3300005549 Bacteria 1966
137 Ga0070704_100344791 3300005549 Bacteria 1255
138 Ga0070704_100663309 3300005549 Unclassified 922
139 Ga0068855_100065816 3300005563 Bacteria 4225
140 Ga0070664_100021634 3300005564 Bacteria 5303
141 Ga0070664_100048958 3300005564 Bacteria 3573
142 Ga0070664_100124977 3300005564 Bacteria 2255
143 Ga0068857_100006405 3300005577 Bacteria 10091
144 Ga0068857_100021360 3300005577 Bacteria 5698
145 Ga0068857_100128357 3300005577 Bacteria 2285
146 Ga0068854_100204114 3300005578 Bacteria 1555
147 Ga0068854_100263591 3300005578 Bacteria 1380
148 Ga0070702_100007789 3300005615 Bacteria 5150
149 Ga0070702_100030020 3300005615 Bacteria 2961
150 Ga0068852_100184579 3300005616 Bacteria 1964
151 Ga0068852_101271173 3300005616 Bacteria 757
152 Ga0068864_100021083 3300005618 Bacteria 5456
153 Ga0068861_100019795 3300005719 Bacteria 4810
154 Ga0068861_100025575 3300005719 Bacteria 4283
155 Ga0068861_100700550 3300005719 Bacteria 941
156 Ga0068863_100047512 3300005841 Bacteria 4070
157 Ga0068858_100026109 3300005842 Bacteria 5431
158 Ga0068858_100313988 3300005842 Bacteria 1497
159 Ga0068860_100019561 3300005843 Bacteria 6565
160 Ga0068862_100000345 3300005844 Bacteria 50340
161 Ga0068862_100007752 3300005844 Bacteria 8879
162 Ga0068862_100111461 3300005844 Unclassified 2402
163 Ga0070716_100611824 3300006173 Bacteria 821
164 Ga0097621_100400828 3300006237 Bacteria 1228
165 Ga0068871_100870010 3300006358 Bacteria 834
166 Ga0075428_100000185 3300006844 Bacteria 58526
167 Ga0075428_100067859 3300006844 Bacteria 3903
168 Ga0075428_100284842 3300006844 Unclassified 1778
169 Ga0075428_100335344 3300006844 Unclassified 1624
170 Ga0075428_100565066 3300006844 Bacteria 1216
171 Ga0075428_100837892 3300006844 Bacteria 977
172 Ga0075430_100020117 3300006846 Bacteria 5680
173 Ga0075430_100022414 3300006846 Bacteria 5374
174 Ga0075430_100040810 3300006846 Unclassified 3928
175 Ga0075430_100042652 3300006846 Unclassified 3836
176 Ga0075430_100184174 3300006846 Bacteria 1736
177 Ga0075430_100357372 3300006846 Bacteria 1206
178 Ga0075431_100004466 3300006847 Bacteria 13724
179 Ga0075431_100010772 3300006847 Bacteria 9193
180 Ga0075431_100111459 3300006847 Unclassified 2824
181 Ga0075431_100163299 3300006847 Bacteria 2290
182 Ga0075431_100237407 3300006847 Bacteria 1855
183 Ga0075431_100255610 3300006847 Bacteria 1779
184 Ga0075431_100393688 3300006847 Bacteria 1387
185 Ga0075431_100417851 3300006847 Bacteria 1340
186 Ga0075431_100442347 3300006847 Bacteria 1297
187 Ga0075433_10020752 3300006852 Bacteria 5498
188 Ga0075433_10034432 3300006852 Bacteria 4350
189 Ga0075433_10084781 3300006852 Bacteria 2797
190 Ga0075433_10137460 3300006852 Bacteria 2172
191 Ga0075433_10328966 3300006852 Bacteria 1351
192 Ga0075434_100002126 3300006871 Bacteria 17250
193 Ga0075434_100005119 3300006871 Bacteria 11904
194 Ga0075434_100027167 3300006871 Bacteria 5616
195 Ga0075434_100085439 3300006871 Bacteria 3154
196 Ga0075434_100232127 3300006871 Bacteria 1865
197 Ga0075434_100473030 3300006871 Bacteria 1274
198 Ga0075429_100102580 3300006880 Bacteria 2497
199 Ga0075429_100294733 3300006880 Unclassified 1420
200 Ga0075429_100306629 3300006880 Bacteria 1390
201 Ga0075429_100423610 3300006880 Bacteria 1166
202 Ga0075429_100798125 3300006880 Bacteria 827
203 Ga0068865_100037030 3300006881 Bacteria 3292
204 Ga0068865_100099049 3300006881 Bacteria 2131
205 Ga0075436_100001887 3300006914 Bacteria 14398
206 Ga0075436_100012471 3300006914 Bacteria 5824
207 Ga0075436_100027789 3300006914 Bacteria 3894
208 Ga0075436_100063381 3300006914 Bacteria 2555
209 Ga0075436_100142256 3300006914 Bacteria 1686
210 Ga0097620_101628239 3300006931 Bacteria 713
211 Ga0075435_100022677 3300007076 Bacteria 4845
212 Ga0075435_100299176 3300007076 Bacteria 1376
213 Ga0075435_100463463 3300007076 Bacteria 1093
214 Ga0099794_10065587 3300007265 Bacteria 1771
215 Ga0099794_10130835 3300007265 Bacteria 1267
216 Ga0099794_10176700 3300007265 Bacteria 1089
217 Ga0111539_10000160 3300009094 Bacteria 76643
218 Ga0111539_10024181 3300009094 Bacteria 7459
219 Ga0111539_10028805 3300009094 Bacteria 6772
220 Ga0111539_10104119 3300009094 Bacteria 3330
221 Ga0111539_10151074 3300009094 Unclassified 2718
222 Ga0105245_11217560 3300009098 Bacteria 801
223 Ga0114129_10000047 3300009147 Bacteria 104957
224 Ga0114129_10033219 3300009147 Bacteria 7291
225 Ga0114129_10266236 3300009147 Bacteria 2295
226 Ga0114129_10579162 3300009147 Bacteria 1457
227 Ga0114129_10659509 3300009147 Bacteria 1349
228 Ga0114129_11169456 3300009147 Unclassified 960
229 Ga0114129_11262610 3300009147 Bacteria 917
230 Ga0105243_10602948 3300009148 Bacteria 1057
231 Ga0105242_10085079 3300009176 Bacteria 2651
232 Ga0105248_10018762 3300009177 Bacteria 7649
233 Ga0105248_10077953 3300009177 Bacteria 3726
234 Ga0105248_10318346 3300009177 Bacteria 1752
235 Ga0105249_10000276 3300009553 Bacteria 54132
236 Ga0105249_10002288 3300009553 Bacteria 16628
237 Ga0105239_10049797 3300010375 Bacteria 4594
238 Ga0157371_10109844 3300013102 Bacteria 1957
239 Ga0157369_10077337 3300013105 Bacteria 3566
240 Ga0157374_10474486 3300013296 Bacteria 1254
241 Ga0157378_10907350 3300013297 Bacteria 912
242 Ga0163162_10004130 3300013306 Bacteria 13940
243 Ga0163162_10150388 3300013306 Bacteria 2445
244 Ga0163162_10591065 3300013306 Bacteria 1237
245 Ga0163162_11338241 3300013306 Bacteria 814
246 Ga0157372_10153796 3300013307 Bacteria 2656
247 Ga0157375_10039538 3300013308 Bacteria 4541
248 Ga0157375_10071950 3300013308 Bacteria 3473
249 Ga0163163_10000071 3300014325 Bacteria 112778
250 Ga0163163_10379833 3300014325 Bacteria 1470
251 Ga0157380_10013578 3300014326 Bacteria 5945
252 Ga0157377_10005618 3300014745 Bacteria 5910
253 Ga0157379_10007061 3300014968 Bacteria 9709
254 Ga0157379_10424772 3300014968 Bacteria 1224
255 Ga0157379_10932955 3300014968 Bacteria 825
256 Ga0157376_10238233 3300014969 Bacteria 1694
257 Ga0157376_11404412 3300014969 Bacteria 730
258 Ga0182007_10033149 3300015262 Bacteria 1751
259 Ga0163161_10033228 3300017792 Bacteria 3686
260 Ga0207697_10007915 3300025315 Bacteria 4697
261 Ga0207653_10000040 3300025885 Bacteria 97615
262 Ga0207653_10085792 3300025885 Bacteria 1096
263 Ga0207682_10023952 3300025893 Bacteria 2414
264 Ga0207682_10032356 3300025893 Bacteria 2102
265 Ga0207682_10376853 3300025893 Bacteria 670
266 Ga0207642_10128259 3300025899 Bacteria 1319
267 Ga0207688_10018002 3300025901 Bacteria 3845
268 Ga0207680_10034830 3300025903 Bacteria 2884
269 Ga0207647_10083589 3300025904 Bacteria 1911
270 Ga0207699_10002949 3300025906 Bacteria 8093
271 Ga0207699_10096723 3300025906 Bacteria 1865
272 Ga0207645_10000387 3300025907 Bacteria 36355
273 Ga0207643_10335996 3300025908 Bacteria 946
274 Ga0207684_10130287 3300025910 Bacteria 2159
275 Ga0207684_10134626 3300025910 Bacteria 2121
276 Ga0207684_10225489 3300025910 Bacteria 1617
277 Ga0207684_10240919 3300025910 Bacteria 1560
278 Ga0207707_10154220 3300025912 Bacteria 2008
279 Ga0207663_10000034 3300025916 Bacteria 88414
280 Ga0207663_10602617 3300025916 Bacteria 863
281 Ga0207660_10008416 3300025917 Bacteria 6674
282 Ga0207660_10049173 3300025917 Bacteria 2987
283 Ga0207660_10530838 3300025917 Bacteria 956
284 Ga0207660_10733696 3300025917 Bacteria 806
285 Ga0207662_10007398 3300025918 Bacteria 5979
286 Ga0207662_10027757 3300025918 Bacteria 3269
287 Ga0207657_10073955 3300025919 Bacteria 2879
288 Ga0207657_10109338 3300025919 Bacteria 2285
289 Ga0207649_10000809 3300025920 Bacteria 20106
290 Ga0207649_10007866 3300025920 Bacteria 5800
291 Ga0207649_10303810 3300025920 Bacteria 1167
292 Ga0207649_11048499 3300025920 Bacteria 642
293 Ga0207652_10016946 3300025921 Bacteria 5959
294 Ga0207646_10004917 3300025922 Bacteria 14295
295 Ga0207646_10100554 3300025922 Bacteria 2592
296 Ga0207646_10151818 3300025922 Bacteria 2089
297 Ga0207646_10180206 3300025922 Bacteria 1908
298 Ga0207646_10191560 3300025922 Bacteria 1847
299 Ga0207646_10302793 3300025922 Bacteria 1444
300 Ga0207646_10833489 3300025922 Bacteria 820
301 Ga0207681_10000315 3300025923 Bacteria 35258
302 Ga0207681_10010024 3300025923 Bacteria 5799
303 Ga0207650_10035893 3300025925 Bacteria 3603
304 Ga0207650_10042199 3300025925 Bacteria 3346
305 Ga0207659_10006447 3300025926 Bacteria 7188
306 Ga0207659_10140714 3300025926 Bacteria 1873
307 Ga0207659_10871384 3300025926 Bacteria 774
308 Ga0207700_10229142 3300025928 Unclassified 1579
309 Ga0207644_10103450 3300025931 Bacteria 2143
310 Ga0207644_10106478 3300025931 Bacteria 2114
311 Ga0207690_10180932 3300025932 Bacteria 1587
312 Ga0207706_10000329 3300025933 Bacteria 51537
313 Ga0207706_10046637 3300025933 Bacteria 3837
314 Ga0207706_10051913 3300025933 Bacteria 3620
315 Ga0207706_10117681 3300025933 Bacteria 2337
316 Ga0207686_10174112 3300025934 Bacteria 1520
317 Ga0207709_10409330 3300025935 Bacteria 1039
318 Ga0207670_10399665 3300025936 Bacteria 1098
319 Ga0207669_10139655 3300025937 Bacteria 1680
320 Ga0207669_10144353 3300025937 Bacteria 1657
321 Ga0207704_10110154 3300025938 Bacteria 1859
322 Ga0207704_10221977 3300025938 Bacteria 1399
323 Ga0207665_10019395 3300025939 Bacteria 4471
324 Ga0207691_10003643 3300025940 Bacteria 14939
325 Ga0207691_10023602 3300025940 Bacteria 5792
326 Ga0207691_10032337 3300025940 Bacteria 4878
327 Ga0207691_10960027 3300025940 Bacteria 714
328 Ga0207711_10016024 3300025941 Bacteria 6218
329 Ga0207711_10258415 3300025941 Bacteria 1600
330 Ga0207711_10338105 3300025941 Bacteria 1393
331 Ga0207689_10004828 3300025942 Bacteria 12158
332 Ga0207689_10148443 3300025942 Bacteria 1932
333 Ga0207661_10086724 3300025944 Bacteria 2598
334 Ga0207661_10111601 3300025944 Bacteria 2313
335 Ga0207679_10000510 3300025945 Bacteria 26402
336 Ga0207679_10001603 3300025945 Bacteria 14086
337 Ga0207679_10342009 3300025945 Bacteria 1301
338 Ga0207679_10486521 3300025945 Bacteria 1099
339 Ga0207667_10057930 3300025949 Bacteria 4065
340 Ga0207651_10568978 3300025960 Bacteria 987
341 Ga0207712_10000346 3300025961 Bacteria 41710
342 Ga0207712_10004419 3300025961 Bacteria 8885
343 Ga0207668_10004762 3300025972 Bacteria 7987
344 Ga0207668_10089452 3300025972 Bacteria 2257
345 Ga0207658_10014635 3300025986 Bacteria 5375
346 Ga0207658_10595843 3300025986 Bacteria 992
347 Ga0207677_10156373 3300026023 Bacteria 1766
348 Ga0207703_10039909 3300026035 Bacteria 3754
349 Ga0207703_10247157 3300026035 Bacteria 1606
350 Ga0207639_10085777 3300026041 Bacteria 2505
351 Ga0207708_10025225 3300026075 Bacteria 4497
352 Ga0207708_10030219 3300026075 Bacteria 4109
353 Ga0207708_10097266 3300026075 Bacteria 2275
354 Ga0207641_10051332 3300026088 Bacteria 3492
355 Ga0207641_10203230 3300026088 Bacteria 1828
356 Ga0207648_10044803 3300026089 Bacteria 3882
357 Ga0207648_10095493 3300026089 Bacteria 2601
358 Ga0207648_10149189 3300026089 Bacteria 2063
359 Ga0207648_10434711 3300026089 Bacteria 1193
360 Ga0207648_10528668 3300026089 Bacteria 1081
361 Ga0207674_10001029 3300026116 Bacteria 36400
362 Ga0207674_10001945 3300026116 Bacteria 26214
363 Ga0207674_10084749 3300026116 Bacteria 3166
364 Ga0207675_100000074 3300026118 Bacteria 76792
365 Ga0207675_100040094 3300026118 Bacteria 4371
366 Ga0207675_100306425 3300026118 Bacteria 1548
367 Ga0207675_100951661 3300026118 Bacteria 876
368 Ga0207683_10322749 3300026121 Bacteria 1415
369 Ga0207683_10376265 3300026121 Bacteria 1305
370 Ga0207698_10066644 3300026142 Bacteria 2835
371 Ga0207698_10087734 3300026142 Bacteria 2535
372 Ga0209588_1006694 3300027671 Unclassified 3362
373 Ga0209588_1179134 3300027671 Unclassified 665
374 Ga0209974_10034049 3300027876 Bacteria 1691
375 Ga0207428_10000234 3300027907 Bacteria 76592
376 Ga0207428_10008428 3300027907 Bacteria 9308
377 Ga0207428_10097711 3300027907 Bacteria 2272
378 Ga0207428_10491648 3300027907 Unclassified 892
379 Ga0268266_10127935 3300028379 Bacteria 2269
380 Ga0268266_10206252 3300028379 Bacteria 1801
381 Ga0268266_10247298 3300028379 Bacteria 1648
382 Ga0268265_10000331 3300028380 Bacteria 51469
383 Ga0268265_10014923 3300028380 Bacteria 5303
384 Ga0268264_10076539 3300028381 Bacteria 2847
385 Ga0268264_10129121 3300028381 Bacteria 2238
386 Ga0265327_10012683 3300031251 Bacteria 5665
387 Ga0307408_100004972 3300031548 Bacteria 8936
388 Ga0307408_100260000 3300031548 Unclassified 1436
389 Ga0307408_100842161 3300031548 Bacteria 835
390 Ga0307408_100955204 3300031548 Bacteria 787
391 Ga0307405_10008798 3300031731 Bacteria 5140
392 Ga0307405_10044364 3300031731 Bacteria 2719
393 Ga0307410_10060203 3300031852 Unclassified 2595
394 Ga0307410_10064798 3300031852 Bacteria 2512
395 Ga0307406_10005772 3300031901 Bacteria 6781
396 Ga0307406_10049338 3300031901 Bacteria 2663
397 Ga0307407_10313518 3300031903 Bacteria 1098
398 Ga0307407_10558345 3300031903 Bacteria 847
399 Ga0307412_10003480 3300031911 Bacteria 8748
400 Ga0307412_10019612 3300031911 Unclassified 4100
401 Ga0307409_100050058 3300031995 Bacteria 3188
402 Ga0307409_100194441 3300031995 Bacteria 1809
403 Ga0307409_100389744 3300031995 Bacteria 1327
404 Ga0307409_101336303 3300031995 Bacteria 742
405 Ga0307416_100062271 3300032002 Bacteria 3050
406 Ga0307416_100133374 3300032002 Unclassified 2241
407 Ga0307416_100150242 3300032002 Bacteria 2135
408 Ga0307416_100165099 3300032002 Bacteria 2053
409 Ga0307416_100382034 3300032002 Bacteria 1439
410 Ga0307411_10008981 3300032005 Bacteria 5220
411 Ga0307411_10050056 3300032005 Bacteria 2719
412 Ga0307411_10126325 3300032005 Bacteria 1861
413 Ga0307411_10180995 3300032005 Bacteria 1600
414 Ga0307411_10825580 3300032005 Bacteria 818
415 Ga0307411_11086827 3300032005 Bacteria 720
416 Ga0307415_100028827 3300032126 Bacteria 3539
417 Ga0307415_100527967 3300032126 Unclassified 1037
418 Ga0307415_100724848 3300032126 Unclassified 900
419 Ga0373955_0603457 3300035172 Bacteria 672
420 Ga0373942_0153047 3300035207 Bacteria 742
421 Ga0373924_0081984 3300035410 Bacteria 1373
422 Ga0373931_0192949 3300035691 Bacteria 1213
423 Ga0373925_0171755 3300037068 Bacteria 1712
424 Ga0439453_0042124 3300041408 Unclassified 898
425 Ga0439433_0027145 3300041999 Bacteria 1298
426 Ga0439451_007633 3300042009 Bacteria 2200
427 Ga0439435_0021767 3300042436 Unclassified 1667
428 Ga0451577_0011817 3300042876 Bacteria 8237
429 Ga0451577_0018167 3300042876 Bacteria 6481
430 Ga0451577_0039658 3300042876 Bacteria 4232
431 Ga0451577_0293061 3300042876 Bacteria 1475
432 Ga0453683_0001542 3300044673 Bacteria 19542
433 Ga0453683_0392500 3300044673 Bacteria 894
434 Ga0453684_1608164 3300044712 Bacteria 667
435 Ga0466960_0266547 3300044901 Bacteria 956
436 Ga0451576_0003467 3300045051 Bacteria 21622
437 Ga0451576_0009449 3300045051 Bacteria 11303
438 Ga0451576_0044989 3300045051 Bacteria 4651
439 Ga0451576_0045819 3300045051 Bacteria 4604
440 Ga0451576_0070470 3300045051 Bacteria 3639
441 Ga0451576_0101676 3300045051 Bacteria 2989
442 Ga0451576_0250593 3300045051 Bacteria 1850
443 Ga0495592_0199626 3300046454 Bacteria 1351
444 Ga0495629_0061617 3300046459 Bacteria 2622
445 Ga0495651_0029069 3300046462 Bacteria 4311
446 Ga0495653_0026079 3300046463 Bacteria 4690
447 Ga0495653_0109850 3300046463 Bacteria 1984
448 Ga0495662_0114745 3300046476 Bacteria 1321
449 Ga0495618_0064073 3300046514 Bacteria 2335
450 Ga0495628_0037398 3300046516 Bacteria 3892
451 Ga0495628_0398529 3300046516 Bacteria 1006
452 Ga0495630_0085981 3300046517 Bacteria 2374
453 Ga0495630_0419502 3300046517 Bacteria 1025
454 Ga0495643_0160359 3300046522 Bacteria 1107
455 Ga0495652_0054263 3300046529 Bacteria 3413
456 Ga0495640_0066855 3300046533 Bacteria 2423
457 Ga0495587_0095465 3300046536 Bacteria 1716
458 Ga0495598_0010505 3300046537 Bacteria 2219
459 Ga0495645_0211361 3300046543 Bacteria 1310
460 Ga0495667_0056313 3300046559 Bacteria 2585
461 Ga0495634_0046633 3300046642 Bacteria 2924
462 Ga0495635_0049559 3300046663 Bacteria 2894
463 Ga0495658_0087988 3300046683 Bacteria 1835
464 Ga0495624_0041285 3300046690 Bacteria 2952
465 Ga0495600_0335754 3300046809 Bacteria 948
466 Ga0495581_0063553 3300047315 Bacteria 2133
467 Ga0495604_0026349 3300047317 Bacteria 4629
468 Ga0495674_0063804 3300047319 Bacteria 3203
469 Ga0495674_0517696 3300047319 Bacteria 953
470 Ga0495680_0060107 3300047322 Bacteria 2931
471 Ga0495684_0308611 3300047471 Bacteria 1134
472 Ga0495602_0067607 3300048088 Bacteria 3073
473 Ga0496100_0627734 3300048903 Bacteria 836
474 Ga0496102_0005122 3300048905 Bacteria 11111
475 Ga0496104_0625977 3300048907 Bacteria 986
476 Ga0496109_0137000 3300048912 Bacteria 2288
477 Ga0496110_0175506 3300048913 Bacteria 1945
478 Ga0496110_0205465 3300048913 Bacteria 1790
479 Ga0501031_0228093 3300049568 Bacteria 1212
480 Ga0501033_0009251 3300049570 Bacteria 7588
481 Ga0501033_0138710 3300049570 Bacteria 1759
482 Ga0501036_0002621 3300049572 Bacteria 14178
483 Ga0501036_0287832 3300049572 Bacteria 1375
484 Ga0501037_0199349 3300049573 Bacteria 1415
485 Ga0501038_0013139 3300049574 Bacteria 7553
486 Ga0501039_0083649 3300049575 Bacteria 2485
487 Ga0501039_0346749 3300049575 Bacteria 1167
488 Ga0501040_0000223 3300049576 Bacteria 33236
489 Ga0501040_0143437 3300049576 Bacteria 1683
490 Ga0501040_0445474 3300049576 Bacteria 932
491 Ga0501041_0052709 3300049577 Bacteria 2480
492 Ga0501041_0489950 3300049577 Bacteria 782
493 Ga0501041_0521672 3300049577 Bacteria 756
494 Ga0501042_0001934 3300049578 Bacteria 12467
495 Ga0501043_0723640 3300049579 Bacteria 725
496 Ga0501046_0058625 3300049580 Bacteria 3018
497 Ga0501046_0164955 3300049580 Bacteria 1664
498 Ga0501046_0712653 3300049580 Bacteria 706
499 Ga0501048_0065962 3300049582 Bacteria 2559
500 Ga0501048_0544952 3300049582 Bacteria 832
501 Ga0501068_0037527 3300049584 Bacteria 2900
502 Ga0501071_0010108 3300049587 Bacteria 6311
503 Ga0501071_0051729 3300049587 Bacteria 2961
504 Ga0501071_0224270 3300049587 Bacteria 1415
505 Ga0501072_0104928 3300049588 Bacteria 2247
506 Ga0501074_0101542 3300049590 Bacteria 2059
507 Ga0501074_0769183 3300049590 Bacteria 679
508 Ga0501075_0002433 3300049591 Bacteria 12395
509 Ga0501075_0020142 3300049591 Bacteria 4846
510 Ga0501075_0090532 3300049591 Bacteria 2321
511 Ga0501075_0091246 3300049591 Bacteria 2312
512 Ga0501075_0291519 3300049591 Bacteria 1243
513 Ga0501076_0022138 3300049592 Bacteria 4883
514 Ga0501076_0226510 3300049592 Bacteria 1528
515 Ga0501076_0383983 3300049592 Bacteria 1154
516 Ga0501077_0017647 3300049593 Bacteria 4507
517 Ga0501225_0029152 3300049705 Bacteria 1516
518 Ga0501079_0058258 3300049741 Bacteria 2980
519 Ga0501079_0129171 3300049741 Bacteria 1966
520 Ga0501080_0096828 3300049742 Bacteria 2740
521 Ga0501080_0152046 3300049742 Bacteria 2139
522 Ga0501080_0225887 3300049742 Bacteria 1712
523 Ga0501081_0001559 3300049743 Bacteria 14096
524 Ga0501081_0104429 3300049743 Bacteria 2006
525 Ga0501081_0163973 3300049743 Bacteria 1602
526 Ga0501081_0300686 3300049743 Bacteria 1177
527 Ga0501081_0310666 3300049743 Bacteria 1157
528 Ga0501081_0495470 3300049743 Bacteria 910
529 Ga0501081_0934669 3300049743 Bacteria 654
530 Ga0501083_0222701 3300049744 Bacteria 1229
531 Ga0501268_034239 3300049765 Bacteria 932
532 Ga0501035_0082573 3300049822 Bacteria 2836
533 Ga0501045_0001751 3300049824 Bacteria 14632
534 Ga0501045_0035828 3300049824 Bacteria 3603
535 Ga0501045_0095749 3300049824 Bacteria 2196
536 nmdc:mga05p37_161232_c1 3300050507 Bacteria 2739
537 nmdc:mga05p37_186147_c1 3300050507 Bacteria 2524
538 nmdc:mga05p37_368304_c1 3300050507 Bacteria 1687
539 nmdc:mga05p37_447_c1 3300050507 Bacteria 44801
540 nmdc:mga05p37_476569_c1 3300050507 Bacteria 1439
541 nmdc:mga05p37_919626_c1 3300050507 Bacteria 940
542 nmdc:mga09592_267238_c1 3300050508 Bacteria 1483
543 nmdc:mga09592_289551_c1 3300050508 Unclassified 1420
544 nmdc:mga09592_388686_c1 3300050508 Bacteria 1206
545 nmdc:mga09592_541186_c1 3300050508 Bacteria 1000
546 nmdc:mga09592_65260_c1 3300050508 Bacteria 3083
547 nmdc:mga09592_88568_c1 3300050508 Bacteria 2644
548 nmdc:mga0qj67_19944_c1 3300050509 Bacteria 5130
549 nmdc:mga0qj67_4328_c1 3300050509 Bacteria 10284
550 nmdc:mga0qj67_473792_c1 3300050509 Bacteria 1008
551 nmdc:mga0qj67_751287_c1 3300050509 Bacteria 774
552 nmdc:mga0qj67_82904_c1 3300050509 Bacteria 2571
553 nmdc:mga06r32_19376_c1 3300050510 Bacteria 6242
554 nmdc:mga06r32_376920_c1 3300050510 Bacteria 1402
555 nmdc:mga06r32_378230_c1 3300050510 Bacteria 1399
556 nmdc:mga06r32_40114_c1 3300050510 Bacteria 4444
557 nmdc:mga06r32_520264_c1 3300050510 Bacteria 1165
558 nmdc:mga06r32_60020_c1 3300050510 Bacteria 3659
559 nmdc:mga06r32_63927_c1 3300050510 Bacteria 3548
560 nmdc:mga06r32_699581_c1 3300050510 Bacteria 979
561 nmdc:mga06r32_827938_c1 3300050510 Bacteria 885
562 nmdc:mga06r32_904764_c1 3300050510 Bacteria 839
563 nmdc:mga06r32_913890_c1 3300050510 Bacteria 834
564 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
565 nmdc:mga08y16_123871_c1 3300050511 Bacteria 2689
566 nmdc:mga08y16_147407_c1 3300050511 Unclassified 2446
567 nmdc:mga08y16_1617_c1 3300050511 Bacteria 22810
568 nmdc:mga08y16_37136_c1 3300050511 Bacteria 5116
569 nmdc:mga08y16_381018_c1 3300050511 Bacteria 1446
570 nmdc:mga0n895_1064391_c1 3300050512 Bacteria 787
571 nmdc:mga0n895_208713_c1 3300050512 Bacteria 1984
572 nmdc:mga0n895_225036_c1 3300050512 Bacteria 1904
573 nmdc:mga0n895_258693_c1 3300050512 Bacteria 1767
574 nmdc:mga0n895_3196_c1 3300050512 Bacteria 13101
575 nmdc:mga0n895_56472_c1 3300050512 Bacteria 3868
576 nmdc:mga0n895_670408_c1 3300050512 Bacteria 1035
577 nmdc:mga0n895_99520_c1 3300050512 Bacteria 2916
578 nmdc:mga0rr50_110949_c1 3300050513 Bacteria 2170
579 nmdc:mga0rr50_132042_c1 3300050513 Bacteria 2000
580 nmdc:mga0rr50_40621_c1 3300050513 Bacteria 3384
581 nmdc:mga0rr50_61041_c1 3300050513 Bacteria 2839
582 nmdc:mga0rr50_8359_c1 3300050513 Bacteria 6441
583 nmdc:mga08x19_122851_c1 3300050514 Bacteria 1742
584 nmdc:mga08x19_161039_c1 3300050514 Bacteria 1524
585 nmdc:mga08x19_58229_c1 3300050514 Bacteria 2499
586 nmdc:mga08x19_6254_c1 3300050514 Bacteria 7050
587 nmdc:mga08x19_65654_c1 3300050514 Unclassified 2357
588 nmdc:mga0a205_129636_c1 3300050515 Bacteria 2423
589 nmdc:mga0a205_133180_c1 3300050515 Bacteria 2386
590 nmdc:mga0a205_13431_c1 3300050515 Bacteria 7625
591 nmdc:mga0a205_150972_c1 3300050515 Bacteria 2223
592 nmdc:mga0a205_158271_c1 3300050515 Bacteria 2163
593 nmdc:mga0a205_462752_c1 3300050515 Bacteria 1128
594 nmdc:mga0a205_517162_c1 3300050515 Bacteria 1050
595 nmdc:mga0a205_57068_c1 3300050515 Bacteria 3770
596 Ga0500635_0035261 3300053080 Bacteria 1644
597 Ga0500578_0000064 3300053086 Bacteria 117170
598 Ga0500593_000186 3300053117 Bacteria 25186
599 Ga0500619_000028 3300053154 Bacteria 48202
600 Ga0501084_0002040 3300054114 Bacteria 16122
601 Ga0501084_0488522 3300054114 Bacteria 1041
602 Ga0590071_083728 3300059421 Bacteria 795
603 Ga0590077_064282 3300059426 Bacteria 834
604 Ga0501082_0012138 3300060353 Bacteria 7401
605 Ga0501082_0063482 3300060353 Bacteria 3180
606 Ga0501082_0155208 3300060353 Bacteria 1989
607 Ga0501082_0212643 3300060353 Bacteria 1682
608 Ga0530510_0000198 3300061734 Bacteria 37256
609 Ga0530510_0047555 3300061734 Bacteria 3100
610 nmdc:mga0qj67_116512_c1
611 JGI25153J46596_10000622
612 Ga0058862_11933853
613 Ga0065712_10314536
614 Ga0065715_10554465
615 Ga0065707_10091174
616 Ga0065707_10378716
617 Ga0065707_10581984
618 Ga0070658_10195034
619 Ga0070676_10011824
620 Ga0070683_100017612
621 Ga0070670_100025742
622 Ga0070670_100122479
623 Ga0070670_100433732
624 Ga0070677_10013590
625 Ga0070677_10165110
626 Ga0068869_100005821
627 Ga0070680_100033324
628 Ga0068868_100018713
629 Ga0068868_100269170
630 Ga0070689_100022559
631 Ga0070691_10173043
632 Ga0070687_100030371
633 Ga0070687_100074057
634 Ga0070661_100003788
635 Ga0070661_100007385
636 Ga0070661_100240525
637 Ga0070668_100001454
638 Ga0070668_100006559
639 Ga0070669_100001653
640 Ga0070669_100008777
641 Ga0070669_100041643
642 Ga0070675_100020311
643 Ga0070675_100026030
644 Ga0070675_100171375
645 Ga0070675_101376611
646 Ga0070671_100190399
647 Ga0070674_100220309
648 Ga0070673_100232808
649 Ga0070688_100009076
650 Ga0070659_100069339
651 Ga0070667_100031912
652 Ga0070703_10125976
653 Ga0070709_10009509
654 Ga0070713_100432951
655 Ga0070701_10047936
656 Ga0070701_10109650
657 Ga0070711_100000374
658 Ga0070705_100003362
659 Ga0070705_100021206
660 Ga0070705_100049471
661 Ga0070705_100149533
662 Ga0070705_100200398
663 Ga0070700_100057645
664 Ga0070700_100156932
665 Ga0070700_100176292
666 Ga0070694_100001241
667 Ga0070694_100003690
668 Ga0070694_100056008
669 Ga0070694_100066375
670 Ga0070694_100077089
671 Ga0070694_100097459
672 Ga0070694_100143933
673 Ga0070694_100153889
674 Ga0070708_100007642
675 Ga0070708_100017743
676 Ga0070708_100058497
677 Ga0070708_100240006
678 Ga0070708_100541667
679 Ga0070708_101406363
680 Ga0070678_100199080
681 Ga0070662_100024969
682 Ga0070662_100184161
683 Ga0070681_10000443
684 Ga0070681_10071919
685 Ga0068867_100035693
686 Ga0068867_100074821
687 Ga0068867_100267992
688 Ga0068867_100380091
689 Ga0070685_10063913
690 Ga0070706_100003743
691 Ga0070706_100144440
692 Ga0070706_101072714
693 Ga0070707_100003591
694 Ga0070707_100039248
695 Ga0070707_100082133
696 Ga0070707_100082644
697 Ga0070707_100372708
698 Ga0070707_100492768
699 Ga0070698_100017318
700 Ga0070698_100072331
701 Ga0070699_100012384
702 Ga0070699_100047994
703 Ga0070699_100378918
704 Ga0070699_100860576
705 Ga0070679_100293048
706 Ga0070684_100028114
707 Ga0070684_100072651
708 Ga0070684_100440905
709 Ga0070697_100005894
710 Ga0070697_100009242
711 Ga0070697_100022556
712 Ga0070697_100039846
713 Ga0070697_100060426
714 Ga0070697_100075045
715 Ga0070697_100626453
716 Ga0068853_100022733
717 Ga0068853_100270007
718 Ga0070672_100008367
719 Ga0070672_100017321
720 Ga0070672_100025238
721 Ga0070686_100042085
722 Ga0070686_100235620
723 Ga0070695_100010555
724 Ga0070695_100013544
725 Ga0070695_100015705
726 Ga0070695_100016433
727 Ga0070695_100118880
728 Ga0070695_100153702
729 Ga0070695_100289392
730 Ga0070695_100305708
731 Ga0070695_100341681
732 Ga0070696_100003663
733 Ga0070696_100005629
734 Ga0070696_100007938
735 Ga0070696_100047697
736 Ga0070696_100052530
737 Ga0070696_100075208
738 Ga0070665_100008910
739 Ga0070665_100091111
740 Ga0070665_100162511
741 Ga0070665_100572918
742 Ga0070704_100000065
743 Ga0070704_100009808
744 Ga0070704_100045538
745 Ga0070704_100127497
746 Ga0070704_100344791
747 Ga0070704_100663309
748 Ga0068855_100065816
749 Ga0070664_100021634
750 Ga0070664_100048958
751 Ga0070664_100124977
752 Ga0068857_100006405
753 Ga0068857_100021360
754 Ga0068857_100128357
755 Ga0068854_100204114
756 Ga0068854_100263591
757 Ga0070702_100007789
758 Ga0070702_100030020
759 Ga0068852_100184579
760 Ga0068852_101271173
761 Ga0068864_100021083
762 Ga0068861_100019795
763 Ga0068861_100025575
764 Ga0068861_100700550
765 Ga0068863_100047512
766 Ga0068858_100026109
767 Ga0068858_100313988
768 Ga0068860_100019561
769 Ga0068862_100000345
770 Ga0068862_100007752
771 Ga0068862_100111461
772 Ga0070716_100611824
773 Ga0097621_100400828
774 Ga0068871_100870010
775 Ga0075428_100000185
776 Ga0075428_100067859
777 Ga0075428_100284842
778 Ga0075428_100335344
779 Ga0075428_100565066
780 Ga0075428_100837892
781 Ga0075430_100020117
782 Ga0075430_100022414
783 Ga0075430_100040810
784 Ga0075430_100042652
785 Ga0075430_100184174
786 Ga0075430_100357372
787 Ga0075431_100004466
788 Ga0075431_100010772
789 Ga0075431_100111459
790 Ga0075431_100163299
791 Ga0075431_100237407
792 Ga0075431_100255610
793 Ga0075431_100393688
794 Ga0075431_100417851
795 Ga0075431_100442347
796 Ga0075433_10020752
797 Ga0075433_10034432
798 Ga0075433_10084781
799 Ga0075433_10137460
800 Ga0075433_10328966
801 Ga0075434_100002126
802 Ga0075434_100005119
803 Ga0075434_100027167
804 Ga0075434_100085439
805 Ga0075434_100232127
806 Ga0075434_100473030
807 Ga0075429_100102580
808 Ga0075429_100294733
809 Ga0075429_100306629
810 Ga0075429_100423610
811 Ga0075429_100798125
812 Ga0068865_100037030
813 Ga0068865_100099049
814 Ga0075436_100001887
815 Ga0075436_100012471
816 Ga0075436_100027789
817 Ga0075436_100063381
818 Ga0075436_100142256
819 Ga0097620_101628239
820 Ga0075435_100022677
821 Ga0075435_100299176
822 Ga0075435_100463463
823 Ga0099794_10065587
824 Ga0099794_10130835
825 Ga0099794_10176700
826 Ga0111539_10000160
827 Ga0111539_10024181
828 Ga0111539_10028805
829 Ga0111539_10104119
830 Ga0111539_10151074
831 Ga0105245_11217560
832 Ga0114129_10000047
833 Ga0114129_10033219
834 Ga0114129_10266236
835 Ga0114129_10579162
836 Ga0114129_10659509
837 Ga0114129_11169456
838 Ga0114129_11262610
839 Ga0105243_10602948
840 Ga0105242_10085079
841 Ga0105248_10018762
842 Ga0105248_10077953
843 Ga0105248_10318346
844 Ga0105249_10000276
845 Ga0105249_10002288
846 Ga0105239_10049797
847 Ga0157371_10109844
848 Ga0157369_10077337
849 Ga0157374_10474486
850 Ga0157378_10907350
851 Ga0163162_10004130
852 Ga0163162_10150388
853 Ga0163162_10591065
854 Ga0163162_11338241
855 Ga0157372_10153796
856 Ga0157375_10039538
857 Ga0157375_10071950
858 Ga0163163_10000071
859 Ga0163163_10379833
860 Ga0157380_10013578
861 Ga0157377_10005618
862 Ga0157379_10007061
863 Ga0157379_10424772
864 Ga0157379_10932955
865 Ga0157376_10238233
866 Ga0157376_11404412
867 Ga0182007_10033149
868 Ga0163161_10033228
869 Ga0207697_10007915
870 Ga0207653_10000040
871 Ga0207653_10085792
872 Ga0207682_10023952
873 Ga0207682_10032356
874 Ga0207682_10376853
875 Ga0207642_10128259
876 Ga0207688_10018002
877 Ga0207680_10034830
878 Ga0207647_10083589
879 Ga0207699_10002949
880 Ga0207699_10096723
881 Ga0207645_10000387
882 Ga0207643_10335996
883 Ga0207684_10130287
884 Ga0207684_10134626
885 Ga0207684_10225489
886 Ga0207684_10240919
887 Ga0207707_10154220
888 Ga0207663_10000034
889 Ga0207663_10602617
890 Ga0207660_10008416
891 Ga0207660_10049173
892 Ga0207660_10530838
893 Ga0207660_10733696
894 Ga0207662_10007398
895 Ga0207662_10027757
896 Ga0207657_10073955
897 Ga0207657_10109338
898 Ga0207649_10000809
899 Ga0207649_10007866
900 Ga0207649_10303810
901 Ga0207649_11048499
902 Ga0207652_10016946
903 Ga0207646_10004917
904 Ga0207646_10100554
905 Ga0207646_10151818
906 Ga0207646_10180206
907 Ga0207646_10191560
908 Ga0207646_10302793
909 Ga0207646_10833489
910 Ga0207681_10000315
911 Ga0207681_10010024
912 Ga0207650_10035893
913 Ga0207650_10042199
914 Ga0207659_10006447
915 Ga0207659_10140714
916 Ga0207659_10871384
917 Ga0207700_10229142
918 Ga0207644_10103450
919 Ga0207644_10106478
920 Ga0207690_10180932
921 Ga0207706_10000329
922 Ga0207706_10046637
923 Ga0207706_10051913
924 Ga0207706_10117681
925 Ga0207686_10174112
926 Ga0207709_10409330
927 Ga0207670_10399665
928 Ga0207669_10139655
929 Ga0207669_10144353
930 Ga0207704_10110154
931 Ga0207704_10221977
932 Ga0207665_10019395
933 Ga0207691_10003643
934 Ga0207691_10023602
935 Ga0207691_10032337
936 Ga0207691_10960027
937 Ga0207711_10016024
938 Ga0207711_10258415
939 Ga0207711_10338105
940 Ga0207689_10004828
941 Ga0207689_10148443
942 Ga0207661_10086724
943 Ga0207661_10111601
944 Ga0207679_10000510
945 Ga0207679_10001603
946 Ga0207679_10342009
947 Ga0207679_10486521
948 Ga0207667_10057930
949 Ga0207651_10568978
950 Ga0207712_10000346
951 Ga0207712_10004419
952 Ga0207668_10004762
953 Ga0207668_10089452
954 Ga0207658_10014635
955 Ga0207658_10595843
956 Ga0207677_10156373
957 Ga0207703_10039909
958 Ga0207703_10247157
959 Ga0207639_10085777
960 Ga0207708_10025225
961 Ga0207708_10030219
962 Ga0207708_10097266
963 Ga0207641_10051332
964 Ga0207641_10203230
965 Ga0207648_10044803
966 Ga0207648_10095493
967 Ga0207648_10149189
968 Ga0207648_10434711
969 Ga0207648_10528668
970 Ga0207674_10001029
971 Ga0207674_10001945
972 Ga0207674_10084749
973 Ga0207675_100000074
974 Ga0207675_100040094
975 Ga0207675_100306425
976 Ga0207675_100951661
977 Ga0207683_10322749
978 Ga0207683_10376265
979 Ga0207698_10066644
980 Ga0207698_10087734
981 Ga0209588_1006694
982 Ga0209588_1179134
983 Ga0209974_10034049
984 Ga0207428_10000234
985 Ga0207428_10008428
986 Ga0207428_10097711
987 Ga0207428_10491648
988 Ga0268266_10127935
989 Ga0268266_10206252
990 Ga0268266_10247298
991 Ga0268265_10000331
992 Ga0268265_10014923
993 Ga0268264_10076539
994 Ga0268264_10129121
995 Ga0265327_10012683
996 Ga0307408_100004972
997 Ga0307408_100260000
998 Ga0307408_100842161
999 Ga0307408_100955204
1000 Ga0307405_10008798
1001 Ga0307405_10044364
1002 Ga0307410_10060203
1003 Ga0307410_10064798
1004 Ga0307406_10005772
1005 Ga0307406_10049338
1006 Ga0307407_10313518
1007 Ga0307407_10558345
1008 Ga0307412_10003480
1009 Ga0307412_10019612
1010 Ga0307409_100050058
1011 Ga0307409_100194441
1012 Ga0307409_100389744
1013 Ga0307409_101336303
1014 Ga0307416_100062271
1015 Ga0307416_100133374
1016 Ga0307416_100150242
1017 Ga0307416_100165099
1018 Ga0307416_100382034
1019 Ga0307411_10008981
1020 Ga0307411_10050056
1021 Ga0307411_10126325
1022 Ga0307411_10180995
1023 Ga0307411_10825580
1024 Ga0307411_11086827
1025 Ga0307415_100028827
1026 Ga0307415_100527967
1027 Ga0307415_100724848
1028 Ga0373955_0603457
1029 Ga0373942_0153047
1030 Ga0373924_0081984
1031 Ga0373931_0192949
1032 Ga0373925_0171755
1033 Ga0439453_0042124
1034 Ga0439433_0027145
1035 Ga0439451_007633
1036 Ga0439435_0021767
1037 Ga0451577_0011817
1038 Ga0451577_0018167
1039 Ga0451577_0039658
1040 Ga0451577_0293061
1041 Ga0453683_0001542
1042 Ga0453683_0392500
1043 Ga0453684_1608164
1044 Ga0466960_0266547
1045 Ga0451576_0003467
1046 Ga0451576_0009449
1047 Ga0451576_0044989
1048 Ga0451576_0045819
1049 Ga0451576_0070470
1050 Ga0451576_0101676
1051 Ga0451576_0250593
1052 Ga0495592_0199626
1053 Ga0495629_0061617
1054 Ga0495651_0029069
1055 Ga0495653_0026079
1056 Ga0495653_0109850
1057 Ga0495662_0114745
1058 Ga0495618_0064073
1059 Ga0495628_0037398
1060 Ga0495628_0398529
1061 Ga0495630_0085981
1062 Ga0495630_0419502
1063 Ga0495643_0160359
1064 Ga0495652_0054263
1065 Ga0495640_0066855
1066 Ga0495587_0095465
1067 Ga0495598_0010505
1068 Ga0495645_0211361
1069 Ga0495667_0056313
1070 Ga0495634_0046633
1071 Ga0495635_0049559
1072 Ga0495658_0087988
1073 Ga0495624_0041285
1074 Ga0495600_0335754
1075 Ga0495581_0063553
1076 Ga0495604_0026349
1077 Ga0495674_0063804
1078 Ga0495674_0517696
1079 Ga0495680_0060107
1080 Ga0495684_0308611
1081 Ga0495602_0067607
1082 Ga0496100_0627734
1083 Ga0496102_0005122
1084 Ga0496104_0625977
1085 Ga0496109_0137000
1086 Ga0496110_0175506
1087 Ga0496110_0205465
1088 Ga0501031_0228093
1089 Ga0501033_0009251
1090 Ga0501033_0138710
1091 Ga0501036_0002621
1092 Ga0501036_0287832
1093 Ga0501037_0199349
1094 Ga0501038_0013139
1095 Ga0501039_0083649
1096 Ga0501039_0346749
1097 Ga0501040_0000223
1098 Ga0501040_0143437
1099 Ga0501040_0445474
1100 Ga0501041_0052709
1101 Ga0501041_0489950
1102 Ga0501041_0521672
1103 Ga0501042_0001934
1104 Ga0501043_0723640
1105 Ga0501046_0058625
1106 Ga0501046_0164955
1107 Ga0501046_0712653
1108 Ga0501048_0065962
1109 Ga0501048_0544952
1110 Ga0501068_0037527
1111 Ga0501071_0010108
1112 Ga0501071_0051729
1113 Ga0501071_0224270
1114 Ga0501072_0104928
1115 Ga0501074_0101542
1116 Ga0501074_0769183
1117 Ga0501075_0002433
1118 Ga0501075_0020142
1119 Ga0501075_0090532
1120 Ga0501075_0091246
1121 Ga0501075_0291519
1122 Ga0501076_0022138
1123 Ga0501076_0226510
1124 Ga0501076_0383983
1125 Ga0501077_0017647
1126 Ga0501225_0029152
1127 Ga0501079_0058258
1128 Ga0501079_0129171
1129 Ga0501080_0096828
1130 Ga0501080_0152046
1131 Ga0501080_0225887
1132 Ga0501081_0001559
1133 Ga0501081_0104429
1134 Ga0501081_0163973
1135 Ga0501081_0300686
1136 Ga0501081_0310666
1137 Ga0501081_0495470
1138 Ga0501081_0934669
1139 Ga0501083_0222701
1140 Ga0501268_034239
1141 Ga0501035_0082573
1142 Ga0501045_0001751
1143 Ga0501045_0035828
1144 Ga0501045_0095749
1145 nmdc:mga05p37_161232_c1
1146 nmdc:mga05p37_186147_c1
1147 nmdc:mga05p37_368304_c1
1148 nmdc:mga05p37_447_c1
1149 nmdc:mga05p37_476569_c1
1150 nmdc:mga05p37_919626_c1
1151 nmdc:mga09592_267238_c1
1152 nmdc:mga09592_289551_c1
1153 nmdc:mga09592_388686_c1
1154 nmdc:mga09592_541186_c1
1155 nmdc:mga09592_65260_c1
1156 nmdc:mga09592_88568_c1
1157 nmdc:mga0qj67_19944_c1
1158 nmdc:mga0qj67_4328_c1
1159 nmdc:mga0qj67_473792_c1
1160 nmdc:mga0qj67_751287_c1
1161 nmdc:mga0qj67_82904_c1
1162 nmdc:mga06r32_19376_c1
1163 nmdc:mga06r32_376920_c1
1164 nmdc:mga06r32_378230_c1
1165 nmdc:mga06r32_40114_c1
1166 nmdc:mga06r32_520264_c1
1167 nmdc:mga06r32_60020_c1
1168 nmdc:mga06r32_63927_c1
1169 nmdc:mga06r32_699581_c1
1170 nmdc:mga06r32_827938_c1
1171 nmdc:mga06r32_904764_c1
1172 nmdc:mga06r32_913890_c1
1173 nmdc:mga08y16_10_c1
1174 nmdc:mga08y16_123871_c1
1175 nmdc:mga08y16_147407_c1
1176 nmdc:mga08y16_1617_c1
1177 nmdc:mga08y16_37136_c1
1178 nmdc:mga08y16_381018_c1
1179 nmdc:mga0n895_1064391_c1
1180 nmdc:mga0n895_208713_c1
1181 nmdc:mga0n895_225036_c1
1182 nmdc:mga0n895_258693_c1
1183 nmdc:mga0n895_3196_c1
1184 nmdc:mga0n895_56472_c1
1185 nmdc:mga0n895_670408_c1
1186 nmdc:mga0n895_99520_c1
1187 nmdc:mga0rr50_110949_c1
1188 nmdc:mga0rr50_132042_c1
1189 nmdc:mga0rr50_40621_c1
1190 nmdc:mga0rr50_61041_c1
1191 nmdc:mga0rr50_8359_c1
1192 nmdc:mga08x19_122851_c1
1193 nmdc:mga08x19_161039_c1
1194 nmdc:mga08x19_58229_c1
1195 nmdc:mga08x19_6254_c1
1196 nmdc:mga08x19_65654_c1
1197 nmdc:mga0a205_129636_c1
1198 nmdc:mga0a205_133180_c1
1199 nmdc:mga0a205_13431_c1
1200 nmdc:mga0a205_150972_c1
1201 nmdc:mga0a205_158271_c1
1202 nmdc:mga0a205_462752_c1
1203 nmdc:mga0a205_517162_c1
1204 nmdc:mga0a205_57068_c1
1205 Ga0500635_0035261
1206 Ga0500578_0000064
1207 Ga0500593_000186
1208 Ga0500619_000028
1209 Ga0501084_0002040
1210 Ga0501084_0488522
1211 Ga0590071_083728
1212 Ga0590077_064282
1213 Ga0501082_0012138
1214 Ga0501082_0063482
1215 Ga0501082_0155208
1216 Ga0501082_0212643
1217 Ga0530510_0000198
1218 Ga0530510_0047555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04011

LemA

LemA family

57

211

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.8919 25 181
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.857 25 181
2lqg-assembly1.cif.gz_A solution structure of the r4 domain of talin 0.7106 34 153
5vot-assembly1.cif.gz_G structure of ampa receptor-tarp complex 0.6849 34 162
8p3x-assembly1.cif.gz_F homomeric glua2 flip r/g-edited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 1 0.6818 33 152
ID Description Score Start End Superfamily
4iggA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.8818 57 119 1.10.287.160
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8299 17 197 1.20.1440.20
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8209 17 197 1.20.1440.20
4iggA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.77 57 119 1.10.287.160
4onsA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7139 24 124 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A3A1VRR6-F1-model_v4 deleted 0.9893 1 182
AF-A0A3A1VRR6-F1-model_v4 deleted 0.9839 1 182
AF-A0A258PZ28-F1-model_v4 deleted 0.9749 1 164
AF-A0A4R6QRI6-F1-model_v4 LemA protein 0.9725 1 181 GO:0016020
AF-A0A4R6QRI6-F1-model_v4 LemA protein 0.9673 1 181 GO:0016020

Map