F468784

General Info

Members Datasets Scaffolds Average Seq Length
608 282 608 279

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10007998|Ga0157380_100079984
Length 303
Sequence VTNRLVRFEEMTMAEQQQIVYLNGELIPLGEAKVSVLDRGFIYGDGVYELVPVYARQLFRLEHHLRRLQHSLAGIGLATPMSPTQWESTIRALVARQPFDDQGVYLQVTRGVAKRDHAFPAGVAPTVFMMSNPLALPSREQVERGVAVVTADDNRWRRCDLKTTSLLGNVLMRQFAVENDAVETVMFRDGMLTEASASNVLVVIGGVVIAPPKDNLILPGITMDATFEFARDAGLSCEMRPVTKAEALAADEMWLSSSSKEVLAVTRVDGRAFGGGAPGPVFRRMWAEFQARRPRAAVAAGVA

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
211 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
212 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
213 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
216 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
281 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 2.47
Rhizosphere 97.2
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10108281 3300005295 Bacteria 2516
2 Ga0065707_10251239 3300005295 Bacteria 1115
3 Ga0070676_10001948 3300005328 Bacteria 10502
4 Ga0070676_10093948 3300005328 Bacteria 1842
5 Ga0070676_10235796 3300005328 Bacteria 1215
6 Ga0070683_100045484 3300005329 Bacteria 4051
7 Ga0070683_100098767 3300005329 Bacteria 2747
8 Ga0070690_100002869 3300005330 Bacteria 9295
9 Ga0070690_100193293 3300005330 Unclassified 1412
10 Ga0070690_100402209 3300005330 Bacteria 1006
11 Ga0070670_100003760 3300005331 Bacteria 12633
12 Ga0070670_100020212 3300005331 Bacteria 5721
13 Ga0070670_100023997 3300005331 Bacteria 5247
14 Ga0070670_100044539 3300005331 Bacteria 3815
15 Ga0070670_100175821 3300005331 Bacteria 1858
16 Ga0070677_10026492 3300005333 Bacteria 2174
17 Ga0068869_100002327 3300005334 Bacteria 11433
18 Ga0068869_100008953 3300005334 Bacteria 6480
19 Ga0068869_100029310 3300005334 Bacteria 3855
20 Ga0068869_100118177 3300005334 Bacteria 2025
21 Ga0068869_100229020 3300005334 Bacteria 1476
22 Ga0070666_10000816 3300005335 Bacteria 18906
23 Ga0070666_10010730 3300005335 Bacteria 5732
24 Ga0070666_10013432 3300005335 Bacteria 5196
25 Ga0070680_100036078 3300005336 Bacteria 3994
26 Ga0070680_100045898 3300005336 Bacteria 3553
27 Ga0068868_100010780 3300005338 Bacteria 6628
28 Ga0068868_100023100 3300005338 Bacteria 4703
29 Ga0068868_100032040 3300005338 Bacteria 4041
30 Ga0070660_100413139 3300005339 Bacteria 1117
31 Ga0070689_100020757 3300005340 Bacteria 4879
32 Ga0070689_100029842 3300005340 Bacteria 4134
33 Ga0070689_100080660 3300005340 Bacteria 2554
34 Ga0070689_100120950 3300005340 Bacteria 2091
35 Ga0070689_100342332 3300005340 Bacteria 1252
36 Ga0070687_100320358 3300005343 Bacteria 990
37 Ga0070692_10153622 3300005345 Bacteria 1313
38 Ga0070668_100002425 3300005347 Bacteria 13715
39 Ga0070668_100002584 3300005347 Bacteria 13305
40 Ga0070668_100004081 3300005347 Bacteria 10812
41 Ga0070668_100104800 3300005347 Bacteria 2245
42 Ga0070668_100247837 3300005347 Bacteria 1478
43 Ga0070669_100001114 3300005353 Bacteria 19625
44 Ga0070669_100035416 3300005353 Bacteria 3616
45 Ga0070675_100003508 3300005354 Bacteria 11895
46 Ga0070675_100004648 3300005354 Bacteria 10483
47 Ga0070675_100008431 3300005354 Bacteria 7999
48 Ga0070675_100012798 3300005354 Bacteria 6583
49 Ga0070675_100030522 3300005354 Bacteria 4352
50 Ga0070675_100094313 3300005354 Bacteria 2511
51 Ga0070675_100206915 3300005354 Bacteria 1705
52 Ga0070671_100008929 3300005355 Bacteria 8043
53 Ga0070671_100012399 3300005355 Bacteria 6865
54 Ga0070671_100052153 3300005355 Bacteria 3402
55 Ga0070671_100236369 3300005355 Bacteria 1551
56 Ga0070674_100000236 3300005356 Bacteria 27276
57 Ga0070674_100006028 3300005356 Bacteria 7044
58 Ga0070674_100023304 3300005356 Bacteria 4005
59 Ga0070674_100026075 3300005356 Bacteria 3813
60 Ga0070674_100079709 3300005356 Bacteria 2337
61 Ga0070673_100001162 3300005364 Bacteria 15124
62 Ga0070673_100001337 3300005364 Bacteria 14365
63 Ga0070673_100003476 3300005364 Bacteria 9809
64 Ga0070673_100036692 3300005364 Bacteria 3728
65 Ga0070673_100113604 3300005364 Bacteria 2249
66 Ga0070688_100002648 3300005365 Bacteria 9085
67 Ga0070688_100089058 3300005365 Bacteria 2013
68 Ga0070667_100006712 3300005367 Bacteria 9563
69 Ga0070667_100008845 3300005367 Bacteria 8336
70 Ga0070667_100204993 3300005367 Bacteria 1751
71 Ga0070667_100259025 3300005367 Bacteria 1557
72 Ga0070714_100006057 3300005435 Bacteria 9285
73 Ga0070714_100069918 3300005435 Bacteria 3033
74 Ga0070713_100000114 3300005436 Bacteria 52713
75 Ga0070713_100059822 3300005436 Bacteria 3183
76 Ga0070710_10009952 3300005437 Bacteria 4661
77 Ga0070710_10273250 3300005437 Bacteria 1094
78 Ga0070711_100003858 3300005439 Bacteria 8799
79 Ga0070711_100071113 3300005439 Bacteria 2451
80 Ga0070694_100004678 3300005444 Bacteria 8237
81 Ga0070694_100203860 3300005444 Bacteria 1475
82 Ga0070694_100326779 3300005444 Bacteria 1182
83 Ga0070708_100002053 3300005445 Bacteria 15521
84 Ga0070708_100051904 3300005445 Bacteria 3634
85 Ga0070708_100589878 3300005445 Bacteria 1048
86 Ga0070663_100085802 3300005455 Bacteria 2324
87 Ga0070663_100238267 3300005455 Bacteria 1435
88 Ga0070678_100000447 3300005456 Bacteria 19565
89 Ga0070678_100004752 3300005456 Bacteria 7746
90 Ga0070678_100036592 3300005456 Bacteria 3437
91 Ga0070678_100425627 3300005456 Bacteria 1158
92 Ga0070662_100319583 3300005457 Bacteria 1266
93 Ga0070681_10004051 3300005458 Bacteria 13833
94 Ga0070681_10041698 3300005458 Bacteria 4601
95 Ga0068867_100001541 3300005459 Bacteria 16000
96 Ga0068867_100002023 3300005459 Bacteria 14178
97 Ga0068867_100016105 3300005459 Bacteria 5309
98 Ga0070685_10001360 3300005466 Bacteria 12832
99 Ga0070685_10029391 3300005466 Bacteria 3053
100 Ga0070706_100181600 3300005467 Bacteria 1964
101 Ga0070707_100033339 3300005468 Bacteria 4911
102 Ga0070707_100037001 3300005468 Bacteria 4657
103 Ga0070707_100299977 3300005468 Bacteria 1561
104 Ga0070698_100045367 3300005471 Bacteria 4499
105 Ga0070698_100101567 3300005471 Bacteria 2847
106 Ga0070698_100151474 3300005471 Bacteria 2267
107 Ga0070698_100177912 3300005471 Bacteria 2066
108 Ga0070699_100138676 3300005518 Bacteria 2146
109 Ga0070699_100189541 3300005518 Bacteria 1826
110 Ga0070699_100254034 3300005518 Bacteria 1571
111 Ga0070699_100258735 3300005518 Bacteria 1556
112 Ga0070679_100010697 3300005530 Bacteria 8709
113 Ga0070679_100468983 3300005530 Bacteria 1203
114 Ga0070684_100013383 3300005535 Bacteria 6613
115 Ga0070684_100093302 3300005535 Bacteria 2679
116 Ga0070697_100013851 3300005536 Bacteria 6328
117 Ga0070697_100379527 3300005536 Bacteria 1224
118 Ga0068853_100000689 3300005539 Bacteria 23316
119 Ga0068853_100077060 3300005539 Bacteria 2912
120 Ga0070672_100061540 3300005543 Bacteria 2960
121 Ga0070672_100077909 3300005543 Bacteria 2651
122 Ga0070672_100078858 3300005543 Bacteria 2635
123 Ga0070686_100109330 3300005544 Bacteria 1881
124 Ga0070695_100007172 3300005545 Bacteria 6610
125 Ga0070695_100342865 3300005545 Unclassified 1117
126 Ga0070695_100502949 3300005545 Unclassified 938
127 Ga0070696_100071277 3300005546 Bacteria 2445
128 Ga0070696_100081818 3300005546 Bacteria 2288
129 Ga0070696_100388414 3300005546 Bacteria 1089
130 Ga0070693_100006610 3300005547 Bacteria 5628
131 Ga0070693_100010305 3300005547 Bacteria 4679
132 Ga0070693_100107936 3300005547 Bacteria 1707
133 Ga0070665_100002874 3300005548 Bacteria 18606
134 Ga0070665_100007383 3300005548 Bacteria 11183
135 Ga0070665_100010734 3300005548 Bacteria 9267
136 Ga0070704_100001327 3300005549 Bacteria 13101
137 Ga0070704_100019944 3300005549 Bacteria 4314
138 Ga0068855_100028779 3300005563 Bacteria 6647
139 Ga0068857_100149944 3300005577 Bacteria 2112
140 Ga0068854_100102089 3300005578 Unclassified 2151
141 Ga0068854_100132321 3300005578 Bacteria 1906
142 Ga0068854_100330656 3300005578 Bacteria 1241
143 Ga0068856_100004914 3300005614 Bacteria 13229
144 Ga0068856_100076866 3300005614 Bacteria 3307
145 Ga0070702_100031314 3300005615 Bacteria 2908
146 Ga0070702_100075566 3300005615 Bacteria 2003
147 Ga0070702_100101990 3300005615 Bacteria 1762
148 Ga0068852_100007280 3300005616 Bacteria 8069
149 Ga0068852_100026753 3300005616 Bacteria 4694
150 Ga0068852_100240044 3300005616 Bacteria 1731
151 Ga0068859_100001172 3300005617 Bacteria 26797
152 Ga0068859_100007142 3300005617 Bacteria 11338
153 Ga0068859_100037393 3300005617 Bacteria 4871
154 Ga0068859_100077083 3300005617 Bacteria 3374
155 Ga0068859_100268841 3300005617 Bacteria 1797
156 Ga0068859_100409592 3300005617 Bacteria 1452
157 Ga0068864_100002663 3300005618 Bacteria 14746
158 Ga0068864_100006458 3300005618 Bacteria 9605
159 Ga0068864_100011915 3300005618 Bacteria 7182
160 Ga0068864_100017297 3300005618 Bacteria 6009
161 Ga0068864_100048253 3300005618 Bacteria 3660
162 Ga0068864_100053038 3300005618 Bacteria 3497
163 Ga0068864_100082993 3300005618 Bacteria 2813
164 Ga0068864_100188438 3300005618 Bacteria 1890
165 Ga0068866_10001452 3300005718 Bacteria 10132
166 Ga0068866_10055564 3300005718 Bacteria 2034
167 Ga0068866_10129509 3300005718 Bacteria 1433
168 Ga0068861_100073760 3300005719 Bacteria 2652
169 Ga0068851_10001073 3300005834 Bacteria 11839
170 Ga0068851_10008538 3300005834 Bacteria 4740
171 Ga0068851_10222347 3300005834 Bacteria 1061
172 Ga0068870_10001220 3300005840 Bacteria 10345
173 Ga0068870_10196464 3300005840 Unclassified 1220
174 Ga0068863_100002857 3300005841 Bacteria 17111
175 Ga0068863_100009074 3300005841 Bacteria 9712
176 Ga0068863_100044347 3300005841 Bacteria 4221
177 Ga0068863_100056480 3300005841 Bacteria 3716
178 Ga0068863_100084840 3300005841 Bacteria 3001
179 Ga0068863_100086214 3300005841 Bacteria 2975
180 Ga0068863_100194706 3300005841 Bacteria 1949
181 Ga0068863_100337045 3300005841 Bacteria 1467
182 Ga0068858_100003418 3300005842 Bacteria 15791
183 Ga0068858_100032683 3300005842 Bacteria 4831
184 Ga0068858_100081612 3300005842 Bacteria 3005
185 Ga0068858_100105223 3300005842 Bacteria 2633
186 Ga0068858_100122180 3300005842 Bacteria 2436
187 Ga0068858_100149812 3300005842 Bacteria 2193
188 Ga0068860_100016447 3300005843 Bacteria 7212
189 Ga0068860_100025511 3300005843 Bacteria 5702
190 Ga0068860_100028894 3300005843 Bacteria 5335
191 Ga0068860_100029246 3300005843 Bacteria 5299
192 Ga0068860_100134539 3300005843 Bacteria 2374
193 Ga0068862_100015687 3300005844 Bacteria 6296
194 Ga0068862_100031529 3300005844 Bacteria 4475
195 Ga0068862_100041628 3300005844 Bacteria 3909
196 Ga0068862_100085113 3300005844 Bacteria 2748
197 Ga0068862_100185362 3300005844 Bacteria 1870
198 Ga0068862_100569074 3300005844 Bacteria 1084
199 Ga0070715_10003865 3300006163 Bacteria 4839
200 Ga0070716_100018313 3300006173 Bacteria 3646
201 Ga0070712_100051723 3300006175 Bacteria 2862
202 Ga0097621_100005645 3300006237 Bacteria 8826
203 Ga0097621_100009563 3300006237 Bacteria 7046
204 Ga0097621_100094791 3300006237 Bacteria 2503
205 Ga0097621_100100361 3300006237 Bacteria 2435
206 Ga0068871_100000551 3300006358 Bacteria 25532
207 Ga0068871_100003069 3300006358 Bacteria 11453
208 Ga0068871_100050549 3300006358 Bacteria 3363
209 Ga0068871_100086899 3300006358 Bacteria 2599
210 Ga0068871_100163861 3300006358 Bacteria 1902
211 Ga0068871_100259275 3300006358 Bacteria 1516
212 Ga0075428_100080658 3300006844 Bacteria 3551
213 Ga0075428_100108012 3300006844 Bacteria 3033
214 Ga0075430_100000550 3300006846 Bacteria 28484
215 Ga0075430_100007696 3300006846 Bacteria 9098
216 Ga0075431_100005396 3300006847 Bacteria 12626
217 Ga0075431_100242110 3300006847 Bacteria 1835
218 Ga0075433_10030502 3300006852 Bacteria 4601
219 Ga0075433_10068886 3300006852 Bacteria 3107
220 Ga0075434_100021939 3300006871 Bacteria 6214
221 Ga0075429_100000511 3300006880 Bacteria 29379
222 Ga0075429_100039718 3300006880 Bacteria 4095
223 Ga0068865_100003205 3300006881 Bacteria 9800
224 Ga0068865_100055704 3300006881 Bacteria 2752
225 Ga0068865_100074777 3300006881 Bacteria 2414
226 Ga0068865_100261117 3300006881 Bacteria 1371
227 Ga0075436_100035610 3300006914 Bacteria 3433
228 Ga0097620_100001172 3300006931 Bacteria 26797
229 Ga0097620_100007142 3300006931 Bacteria 11338
230 Ga0097620_100037393 3300006931 Bacteria 4871
231 Ga0097620_100077081 3300006931 Bacteria 3374
232 Ga0097620_100268828 3300006931 Bacteria 1797
233 Ga0097620_100409611 3300006931 Bacteria 1452
234 Ga0075435_100008207 3300007076 Bacteria 7481
235 Ga0099794_10015782 3300007265 Bacteria 3340
236 Ga0099794_10154035 3300007265 Bacteria 1167
237 Ga0105240_10007422 3300009093 Bacteria 15928
238 Ga0111539_10013382 3300009094 Bacteria 10256
239 Ga0111539_10070916 3300009094 Bacteria 4112
240 Ga0105245_10055737 3300009098 Bacteria 3551
241 Ga0105245_10129621 3300009098 Bacteria 2365
242 Ga0105247_10010369 3300009101 Bacteria 5637
243 Ga0114129_10068810 3300009147 Bacteria 4935
244 Ga0105241_10227580 3300009174 Bacteria 1571
245 Ga0105242_10001782 3300009176 Bacteria 16996
246 Ga0105242_10041480 3300009176 Bacteria 3713
247 Ga0105242_10222964 3300009176 Bacteria 1686
248 Ga0105248_10002637 3300009177 Bacteria 19937
249 Ga0105248_10198693 3300009177 Bacteria 2259
250 Ga0105248_10414506 3300009177 Bacteria 1517
251 Ga0105248_10688705 3300009177 Bacteria 1153
252 Ga0105237_10147303 3300009545 Bacteria 2349
253 Ga0105249_10049577 3300009553 Bacteria 3829
254 Ga0105249_10057803 3300009553 Bacteria 3554
255 Ga0105239_10301624 3300010375 Bacteria 1804
256 Ga0105239_10604944 3300010375 Unclassified 1250
257 Ga0105246_10304059 3300011119 Unclassified 1289
258 Ga0157370_10007918 3300013104 Bacteria 11509
259 Ga0157370_10025283 3300013104 Bacteria 5878
260 Ga0157369_10045838 3300013105 Bacteria 4753
261 Ga0157374_10000596 3300013296 Bacteria 32001
262 Ga0157374_10003531 3300013296 Bacteria 13155
263 Ga0157374_10582507 3300013296 Bacteria 1128
264 Ga0157378_10043444 3300013297 Bacteria 3990
265 Ga0157378_10117962 3300013297 Bacteria 2442
266 Ga0163162_10000806 3300013306 Bacteria 29097
267 Ga0163162_10109941 3300013306 Bacteria 2853
268 Ga0163162_10121295 3300013306 Bacteria 2719
269 Ga0157372_10002331 3300013307 Bacteria 20579
270 Ga0157372_10027510 3300013307 Bacteria 6195
271 Ga0157372_10071265 3300013307 Bacteria 3913
272 Ga0157372_10160040 3300013307 Bacteria 2602
273 Ga0157375_10003811 3300013308 Bacteria 13072
274 Ga0157375_10014883 3300013308 Bacteria 6953
275 Ga0157375_10094115 3300013308 Bacteria 3064
276 Ga0157375_10359397 3300013308 Bacteria 1622
277 Ga0163163_10004542 3300014325 Bacteria 11854
278 Ga0163163_10011269 3300014325 Bacteria 8102
279 Ga0163163_10013670 3300014325 Bacteria 7436
280 Ga0157380_10007998 3300014326 Bacteria 7532
281 Ga0157380_10025621 3300014326 Bacteria 4473
282 Ga0157380_10069279 3300014326 Bacteria 2846
283 Ga0157380_10216133 3300014326 Unclassified 1712
284 Ga0157377_10268125 3300014745 Bacteria 1114
285 Ga0157379_10003325 3300014968 Bacteria 13621
286 Ga0157379_10009604 3300014968 Bacteria 8424
287 Ga0157376_10019433 3300014969 Bacteria 5236
288 Ga0157376_10042432 3300014969 Bacteria 3728
289 Ga0157376_10061004 3300014969 Bacteria 3169
290 Ga0207697_10003081 3300025315 Bacteria 8353
291 Ga0207656_10001807 3300025321 Bacteria 7116
292 Ga0207656_10063164 3300025321 Bacteria 1629
293 Ga0207653_10065008 3300025885 Bacteria 1238
294 Ga0207682_10000242 3300025893 Bacteria 24724
295 Ga0207682_10002765 3300025893 Bacteria 7773
296 Ga0207682_10048977 3300025893 Bacteria 1743
297 Ga0207692_10012700 3300025898 Bacteria 3625
298 Ga0207642_10022010 3300025899 Bacteria 2520
299 Ga0207642_10090296 3300025899 Unclassified 1511
300 Ga0207710_10028460 3300025900 Bacteria 2426
301 Ga0207680_10002437 3300025903 Bacteria 8677
302 Ga0207680_10008730 3300025903 Bacteria 4991
303 Ga0207680_10015307 3300025903 Bacteria 4000
304 Ga0207685_10005534 3300025905 Bacteria 3345
305 Ga0207699_10056467 3300025906 Bacteria 2340
306 Ga0207645_10001123 3300025907 Bacteria 22130
307 Ga0207645_10002011 3300025907 Bacteria 16329
308 Ga0207645_10031886 3300025907 Bacteria 3388
309 Ga0207645_10049460 3300025907 Bacteria 2684
310 Ga0207643_10005469 3300025908 Bacteria 6792
311 Ga0207643_10073500 3300025908 Bacteria 1971
312 Ga0207643_10117297 3300025908 Unclassified 1573
313 Ga0207705_10156517 3300025909 Bacteria 1710
314 Ga0207684_10013573 3300025910 Bacteria 7042
315 Ga0207684_10116171 3300025910 Bacteria 2292
316 Ga0207654_10050973 3300025911 Bacteria 2381
317 Ga0207707_10015357 3300025912 Bacteria 6668
318 Ga0207695_10373661 3300025913 Bacteria 1312
319 Ga0207693_10000104 3300025915 Bacteria 76023
320 Ga0207693_10006353 3300025915 Bacteria 9793
321 Ga0207660_10013758 3300025917 Bacteria 5310
322 Ga0207662_10005874 3300025918 Bacteria 6582
323 Ga0207662_10113794 3300025918 Bacteria 1690
324 Ga0207662_10247088 3300025918 Bacteria 1170
325 Ga0207657_10004654 3300025919 Bacteria 14496
326 Ga0207657_10040315 3300025919 Bacteria 4139
327 Ga0207652_10033282 3300025921 Bacteria 4339
328 Ga0207652_10195804 3300025921 Bacteria 1818
329 Ga0207646_10007938 3300025922 Bacteria 10710
330 Ga0207646_10182159 3300025922 Bacteria 1897
331 Ga0207681_10005369 3300025923 Bacteria 7872
332 Ga0207681_10118862 3300025923 Bacteria 1935
333 Ga0207650_10012311 3300025925 Bacteria 5903
334 Ga0207650_10013289 3300025925 Bacteria 5698
335 Ga0207650_10015751 3300025925 Bacteria 5271
336 Ga0207650_10016853 3300025925 Bacteria 5110
337 Ga0207650_10016873 3300025925 Bacteria 5107
338 Ga0207650_10050645 3300025925 Bacteria 3072
339 Ga0207650_10061370 3300025925 Bacteria 2807
340 Ga0207650_10404466 3300025925 Bacteria 1130
341 Ga0207659_10001235 3300025926 Bacteria 15308
342 Ga0207659_10006236 3300025926 Bacteria 7294
343 Ga0207659_10056912 3300025926 Bacteria 2801
344 Ga0207659_10068777 3300025926 Bacteria 2577
345 Ga0207687_10008617 3300025927 Bacteria 6670
346 Ga0207687_10011741 3300025927 Bacteria 5731
347 Ga0207687_10040880 3300025927 Bacteria 3181
348 Ga0207700_10000018 3300025928 Bacteria 191007
349 Ga0207664_10010626 3300025929 Bacteria 6506
350 Ga0207664_10030822 3300025929 Bacteria 4099
351 Ga0207644_10041489 3300025931 Bacteria 3255
352 Ga0207644_10162009 3300025931 Bacteria 1739
353 Ga0207644_10241578 3300025931 Bacteria 1438
354 Ga0207690_10249038 3300025932 Bacteria 1372
355 Ga0207706_10068189 3300025933 Bacteria 3130
356 Ga0207686_10020882 3300025934 Bacteria 3749
357 Ga0207686_10072370 3300025934 Bacteria 2221
358 Ga0207709_10128144 3300025935 Bacteria 1725
359 Ga0207670_10073666 3300025936 Bacteria 2368
360 Ga0207670_10099090 3300025936 Bacteria 2078
361 Ga0207670_10102691 3300025936 Bacteria 2045
362 Ga0207670_10127750 3300025936 Bacteria 1857
363 Ga0207669_10014976 3300025937 Bacteria 3900
364 Ga0207669_10057677 3300025937 Bacteria 2365
365 Ga0207669_10540084 3300025937 Bacteria 939
366 Ga0207704_10006554 3300025938 Bacteria 5440
367 Ga0207704_10006774 3300025938 Bacteria 5368
368 Ga0207704_10097240 3300025938 Bacteria 1952
369 Ga0207665_10033312 3300025939 Bacteria 3414
370 Ga0207665_10082520 3300025939 Bacteria 2215
371 Ga0207691_10000216 3300025940 Bacteria 55947
372 Ga0207691_10000454 3300025940 Bacteria 40505
373 Ga0207691_10001401 3300025940 Bacteria 24112
374 Ga0207691_10023315 3300025940 Bacteria 5826
375 Ga0207691_10023778 3300025940 Bacteria 5767
376 Ga0207691_10078162 3300025940 Bacteria 2979
377 Ga0207691_10190935 3300025940 Bacteria 1786
378 Ga0207711_10000572 3300025941 Bacteria 37502
379 Ga0207711_10003092 3300025941 Bacteria 14511
380 Ga0207689_10000963 3300025942 Bacteria 27633
381 Ga0207689_10006312 3300025942 Bacteria 10501
382 Ga0207689_10055133 3300025942 Bacteria 3272
383 Ga0207689_10259174 3300025942 Bacteria 1438
384 Ga0207661_10125959 3300025944 Bacteria 2188
385 Ga0207661_10634138 3300025944 Unclassified 982
386 Ga0207679_10044939 3300025945 Bacteria 3191
387 Ga0207679_10242841 3300025945 Bacteria 1527
388 Ga0207667_10281976 3300025949 Bacteria 1698
389 Ga0207651_10000642 3300025960 Bacteria 14819
390 Ga0207651_10002919 3300025960 Bacteria 8260
391 Ga0207651_10005325 3300025960 Bacteria 6594
392 Ga0207651_10237981 3300025960 Unclassified 1482
393 Ga0207712_10036789 3300025961 Bacteria 3336
394 Ga0207668_10000894 3300025972 Bacteria 18003
395 Ga0207668_10025686 3300025972 Bacteria 3814
396 Ga0207668_10027692 3300025972 Bacteria 3695
397 Ga0207668_10056834 3300025972 Bacteria 2727
398 Ga0207640_10104584 3300025981 Bacteria 1993
399 Ga0207640_10129810 3300025981 Bacteria 1820
400 Ga0207658_10032283 3300025986 Bacteria 3725
401 Ga0207658_10059694 3300025986 Bacteria 2842
402 Ga0207658_10101393 3300025986 Bacteria 2256
403 Ga0207658_10121416 3300025986 Bacteria 2084
404 Ga0207658_10151167 3300025986 Bacteria 1892
405 Ga0207658_10242326 3300025986 Bacteria 1528
406 Ga0207677_10000469 3300026023 Bacteria 26525
407 Ga0207677_10001861 3300026023 Bacteria 11157
408 Ga0207677_10120424 3300026023 Bacteria 1973
409 Ga0207677_10253544 3300026023 Bacteria 1430
410 Ga0207703_10002876 3300026035 Bacteria 14649
411 Ga0207703_10009883 3300026035 Bacteria 7485
412 Ga0207703_10093198 3300026035 Bacteria 2536
413 Ga0207703_10105239 3300026035 Bacteria 2398
414 Ga0207703_10126170 3300026035 Bacteria 2204
415 Ga0207639_10009864 3300026041 Bacteria 6596
416 Ga0207678_10031271 3300026067 Bacteria 4644
417 Ga0207678_10272642 3300026067 Bacteria 1451
418 Ga0207708_10053128 3300026075 Bacteria 3086
419 Ga0207702_10035970 3300026078 Bacteria 4141
420 Ga0207702_10093771 3300026078 Bacteria 2634
421 Ga0207702_10287987 3300026078 Bacteria 1555
422 Ga0207641_10008544 3300026088 Bacteria 8457
423 Ga0207641_10012275 3300026088 Bacteria 7029
424 Ga0207641_10063674 3300026088 Bacteria 3150
425 Ga0207641_10117374 3300026088 Bacteria 2369
426 Ga0207641_10446741 3300026088 Bacteria 1249
427 Ga0207648_10000763 3300026089 Bacteria 36138
428 Ga0207648_10000829 3300026089 Bacteria 34794
429 Ga0207648_10020296 3300026089 Bacteria 5986
430 Ga0207648_10030919 3300026089 Bacteria 4737
431 Ga0207676_10002530 3300026095 Bacteria 13039
432 Ga0207676_10002692 3300026095 Bacteria 12633
433 Ga0207676_10023341 3300026095 Bacteria 4562
434 Ga0207674_10105497 3300026116 Bacteria 2796
435 Ga0207674_10118474 3300026116 Bacteria 2618
436 Ga0207675_100024243 3300026118 Bacteria 5642
437 Ga0207675_100086145 3300026118 Bacteria 2950
438 Ga0207675_100127694 3300026118 Bacteria 2409
439 Ga0207675_100144068 3300026118 Bacteria 2265
440 Ga0207675_100147753 3300026118 Bacteria 2236
441 Ga0207675_100725849 3300026118 Bacteria 1004
442 Ga0207683_10000401 3300026121 Bacteria 39796
443 Ga0207683_10000705 3300026121 Bacteria 30486
444 Ga0207683_10001133 3300026121 Bacteria 24266
445 Ga0207683_10013560 3300026121 Bacteria 6953
446 Ga0207698_10203015 3300026142 Unclassified 1777
447 Ga0207698_10484738 3300026142 Bacteria 1200
448 Ga0209969_1001086 3300027360 Bacteria 3731
449 Ga0209981_1001444 3300027378 Bacteria 3001
450 Ga0209996_1012158 3300027395 Bacteria 1155
451 Ga0210000_1001892 3300027462 Bacteria 2958
452 Ga0209995_1001597 3300027471 Bacteria 3511
453 Ga0209968_1002375 3300027526 Bacteria 2843
454 Ga0209983_1025328 3300027665 Bacteria 1251
455 Ga0209971_1040499 3300027682 Bacteria 1121
456 Ga0209966_1005660 3300027695 Bacteria 2148
457 Ga0207428_10070921 3300027907 Bacteria 2737
458 Ga0268266_10005748 3300028379 Bacteria 11481
459 Ga0268266_10017606 3300028379 Bacteria 6093
460 Ga0268265_10075945 3300028380 Bacteria 2634
461 Ga0268264_10007810 3300028381 Bacteria 8902
462 Ga0268264_10010411 3300028381 Bacteria 7688
463 Ga0268264_10014615 3300028381 Bacteria 6450
464 Ga0268264_10060412 3300028381 Bacteria 3177
465 Ga0268264_10101663 3300028381 Bacteria 2499
466 Ga0268264_10154146 3300028381 Bacteria 2063
467 Ga0307408_100003640 3300031548 Bacteria 10503
468 Ga0307405_10003582 3300031731 Bacteria 7170
469 Ga0307413_10012513 3300031824 Bacteria 4226
470 Ga0307410_10000615 3300031852 Bacteria 14669
471 Ga0307406_10002939 3300031901 Bacteria 9279
472 Ga0307407_10000267 3300031903 Bacteria 15354
473 Ga0307412_10007003 3300031911 Bacteria 6400
474 Ga0307412_10472663 3300031911 Unclassified 1038
475 Ga0307409_100005162 3300031995 Bacteria 7465
476 Ga0307416_100008868 3300032002 Bacteria 6529
477 Ga0307414_10195151 3300032004 Bacteria 1642
478 Ga0307411_10022388 3300032005 Bacteria 3719
479 Ga0307415_100000721 3300032126 Bacteria 14812
480 Ga0373938_0018515 3300034957 Bacteria 1382
481 Ga0373934_0038382 3300035086 Bacteria 1886
482 Ga0373923_0000205 3300035111 Bacteria 12151
483 Ga0373953_0001394 3300035117 Bacteria 6962
484 Ga0373953_0012794 3300035117 Bacteria 2980
485 Ga0373954_0000002 3300035118 Bacteria 147478
486 Ga0373954_0002022 3300035118 Bacteria 8424
487 Ga0373957_0008010 3300035120 Bacteria 3406
488 Ga0373946_0032003 3300035171 Bacteria 2110
489 Ga0373955_0005365 3300035172 Bacteria 5755
490 Ga0373955_0119781 3300035172 Bacteria 1529
491 Ga0373924_0126983 3300035410 Unclassified 1108
492 Ga0373931_0016875 3300035691 Bacteria 3601
493 Ga0373931_0066765 3300035691 Bacteria 1953
494 Ga0373935_0039146 3300035692 Bacteria 2971
495 Ga0373935_0086357 3300035692 Bacteria 2047
496 Ga0373935_0098112 3300035692 Bacteria 1928
497 Ga0373927_0103290 3300035695 Bacteria 1854
498 Ga0373933_0000657 3300035724 Bacteria 21450
499 Ga0373933_0017492 3300035724 Bacteria 4021
500 Ga0373947_0030883 3300035725 Bacteria 3150
501 Ga0373947_0055504 3300035725 Bacteria 2392
502 Ga0373937_0000358 3300036401 Bacteria 42468
503 Ga0373937_0014725 3300036401 Bacteria 6904
504 Ga0373937_0021545 3300036401 Bacteria 5784
505 Ga0373937_0025596 3300036401 Bacteria 5329
506 Ga0373937_0302335 3300036401 Bacteria 1512
507 Ga0373925_0009867 3300037068 Bacteria 6937
508 Ga0373925_0278958 3300037068 Unclassified 1345
509 Ga0373925_0285317 3300037068 Bacteria 1330
510 Ga0436365_0686227 3300039437 Bacteria 3590
511 Ga0439461_0002213 3300041410 Bacteria 3086
512 Ga0451807_1806802 3300041486 Bacteria 3040
513 Ga0439431_0034581 3300041997 Bacteria 1267
514 Ga0439441_000163 3300042001 Bacteria 5870
515 Ga0439441_003222 3300042001 Bacteria 2384
516 Ga0439446_0000176 3300042156 Bacteria 11244
517 Ga0439434_0001633 3300042435 Bacteria 6483
518 Ga0439435_0000026 3300042436 Bacteria 16073
519 Ga0439435_0013765 3300042436 Bacteria 1986
520 Ga0451577_0452460 3300042876 Bacteria 1166
521 Ga0451576_0034631 3300045051 Bacteria 5362
522 Ga0451576_0406890 3300045051 Bacteria 1427
523 Ga0466967_0057018 3300045976 Bacteria 3447
524 Ga0495592_0003821 3300046454 Bacteria 10887
525 Ga0495592_0309309 3300046454 Bacteria 1025
526 Ga0495603_0077020 3300046455 Bacteria 1957
527 Ga0495653_0222837 3300046463 Bacteria 1267
528 Ga0495580_0055990 3300046472 Bacteria 2777
529 Ga0495580_0150064 3300046472 Bacteria 1615
530 Ga0495580_0187079 3300046472 Bacteria 1429
531 Ga0495582_0003693 3300046473 Bacteria 8618
532 Ga0495662_0008976 3300046476 Bacteria 4910
533 Ga0495662_0025122 3300046476 Bacteria 2876
534 Ga0495662_0027173 3300046476 Bacteria 2765
535 Ga0495594_0050679 3300046499 Bacteria 2284
536 Ga0495608_0002044 3300046511 Bacteria 14501
537 Ga0495618_0022560 3300046514 Bacteria 3888
538 Ga0495628_0016487 3300046516 Bacteria 6161
539 Ga0495630_0001185 3300046517 Bacteria 17975
540 Ga0495630_0039270 3300046517 Bacteria 3540
541 Ga0495652_0033401 3300046529 Bacteria 4491
542 Ga0495665_0029121 3300046531 Bacteria 2959
543 Ga0495640_0000808 3300046533 Bacteria 23777
544 Ga0495640_0004665 3300046533 Bacteria 10928
545 Ga0495586_0000440 3300046535 Bacteria 24985
546 Ga0495621_0003552 3300046539 Bacteria 4302
547 Ga0495645_0025778 3300046543 Bacteria 4268
548 Ga0495667_0001153 3300046559 Bacteria 17225
549 Ga0495634_0002587 3300046642 Bacteria 14917
550 Ga0495634_0059578 3300046642 Bacteria 2543
551 Ga0495635_0082244 3300046663 Bacteria 2203
552 Ga0495659_0047479 3300046664 Unclassified 1553
553 Ga0495623_0052380 3300046679 Bacteria 2579
554 Ga0495658_0026403 3300046683 Bacteria 3112
555 Ga0495613_0025295 3300046689 Bacteria 4423
556 Ga0495613_0093433 3300046689 Bacteria 2177
557 Ga0495624_0034028 3300046690 Bacteria 3299
558 Ga0495600_0006681 3300046809 Bacteria 7029
559 Ga0495604_0103336 3300047317 Bacteria 2090
560 Ga0495674_0123030 3300047319 Bacteria 2191
561 Ga0495674_0218376 3300047319 Bacteria 1577
562 Ga0495680_0001572 3300047322 Bacteria 24459
563 Ga0495680_0044568 3300047322 Bacteria 3507
564 Ga0495684_0018458 3300047471 Bacteria 5374
565 Ga0495593_0057647 3300047673 Bacteria 2039
566 Ga0495602_0097632 3300048088 Bacteria 2420
567 Ga0495614_0078529 3300048089 Bacteria 1428
568 Ga0496101_0136489 3300048904 Bacteria 1867
569 Ga0496103_0042137 3300048906 Bacteria 2808
570 Ga0496104_0416490 3300048907 Bacteria 1256
571 Ga0496105_0459561 3300048908 Bacteria 1004
572 Ga0496106_0084317 3300048909 Bacteria 2445
573 Ga0496108_0008141 3300048911 Bacteria 8503
574 Ga0496108_0017069 3300048911 Bacteria 5935
575 Ga0496109_0027634 3300048912 Bacteria 5069
576 Ga0496109_0040364 3300048912 Bacteria 4227
577 Ga0496109_0239075 3300048912 Bacteria 1709
578 Ga0496112_0189653 3300048915 Bacteria 2018
579 Ga0496114_0187853 3300048917 Bacteria 1807
580 Ga0496114_0222221 3300048917 Bacteria 1658
581 Ga0496115_0116217 3300048918 Bacteria 2200
582 Ga0501040_0018725 3300049576 Bacteria 4599
583 Ga0501040_0072432 3300049576 Bacteria 2380
584 Ga0501048_0252032 3300049582 Bacteria 1253
585 Ga0501068_0212842 3300049584 Bacteria 1228
586 Ga0501074_0299992 3300049590 Bacteria 1141
587 Ga0501079_0028118 3300049741 Bacteria 4314
588 nmdc:mga05p37_209_c1 3300050507 Bacteria 59030
589 nmdc:mga05p37_99504_c1 3300050507 Bacteria 3581
590 nmdc:mga09592_150_c1 3300050508 Bacteria 47613
591 nmdc:mga0qj67_20035_c1 3300050509 Bacteria 5118
592 nmdc:mga0qj67_623_c1 3300050509 Bacteria 24285
593 nmdc:mga06r32_113730_c1 3300050510 Bacteria 2664
594 nmdc:mga06r32_187461_c1 3300050510 Bacteria 2056
595 nmdc:mga08y16_30907_c1 3300050511 Bacteria 5631
596 nmdc:mga0n895_14216_c1 3300050512 Bacteria 7219
597 nmdc:mga0rr50_6927_c1 3300050513 Bacteria 6949
598 nmdc:mga08x19_223567_c1 3300050514 Bacteria 1294
599 nmdc:mga08x19_50596_c1 3300050514 Bacteria 2666
600 nmdc:mga0a205_43040_c1 3300050515 Bacteria 4354
601 Ga0495601_0005497 3300053077 Bacteria 7389
602 Ga0495601_0083732 3300053077 Bacteria 2049
603 Ga0495595_0045109 3300053084 Bacteria 2027
604 Ga0495595_0073078 3300053084 Bacteria 1624
605 Ga0495619_0009966 3300053085 Bacteria 5984
606 Ga0500566_0122685 3300053094 Bacteria 1399
607 Ga0590077_004080 3300059426 Bacteria 3007
608 Ga0530510_0284777 3300061734 Bacteria 1235

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031911 Ga0307412_10472663 Ga0307412_104726631 252
2 3300005330 Ga0070690_100002869 Ga0070690_1000028695 257
3 3300005334 Ga0068869_100118177 Ga0068869_1001181771 257
4 3300005335 Ga0070666_10010730 Ga0070666_100107305 257
5 3300005338 Ga0068868_100023100 Ga0068868_1000231003 257
6 3300005340 Ga0070689_100020757 Ga0070689_1000207573 257
7 3300005355 Ga0070671_100012399 Ga0070671_1000123995 257
8 3300005356 Ga0070674_100023304 Ga0070674_1000233043 257
9 3300005364 Ga0070673_100001337 Ga0070673_1000013375 257
10 3300005365 Ga0070688_100002648 Ga0070688_1000026487 257
11 3300005437 Ga0070710_10009952 Ga0070710_100099524 257
12 3300005439 Ga0070711_100003858 Ga0070711_1000038588 257
13 3300005456 Ga0070678_100004752 Ga0070678_1000047523 257
14 3300005466 Ga0070685_10001360 Ga0070685_1000136012 257
15 3300005543 Ga0070672_100061540 Ga0070672_1000615403 257
16 3300005545 Ga0070695_100342865 Ga0070695_1003428651 257
17 3300005547 Ga0070693_100010305 Ga0070693_1000103053 257
18 3300005548 Ga0070665_100010734 Ga0070665_1000107345 257
19 3300005578 Ga0068854_100102089 Ga0068854_1001020893 257
20 3300005614 Ga0068856_100076866 Ga0068856_1000768664 257
21 3300005615 Ga0070702_100031314 Ga0070702_1000313143 257
22 3300005616 Ga0068852_100026753 Ga0068852_1000267536 257
23 3300005617 Ga0068859_100007142 Ga0068859_1000071427 257
24 3300005618 Ga0068864_100002663 Ga0068864_10000266313 257
25 3300005718 Ga0068866_10001452 Ga0068866_100014524 257
26 3300005841 Ga0068863_100086214 Ga0068863_1000862143 257
27 3300005842 Ga0068858_100003418 Ga0068858_1000034182 257
28 3300006163 Ga0070715_10003865 Ga0070715_100038654 257
29 3300006173 Ga0070716_100018313 Ga0070716_1000183133 257
30 3300006175 Ga0070712_100051723 Ga0070712_1000517232 257
31 3300006358 Ga0068871_100163861 Ga0068871_1001638612 257
32 3300006881 Ga0068865_100074777 Ga0068865_1000747772 257
33 3300006931 Ga0097620_100007142 Ga0097620_1000071427 257
34 3300009101 Ga0105247_10010369 Ga0105247_100103696 257
35 3300009176 Ga0105242_10041480 Ga0105242_100414803 257
36 3300010375 Ga0105239_10604944 Ga0105239_106049442 257
37 3300011119 Ga0105246_10304059 Ga0105246_103040592 257
38 3300013296 Ga0157374_10000596 Ga0157374_1000059610 257
39 3300013297 Ga0157378_10043444 Ga0157378_100434443 257
40 3300013308 Ga0157375_10014883 Ga0157375_100148837 257
41 3300014325 Ga0163163_10004542 Ga0163163_100045428 257
42 3300014968 Ga0157379_10009604 Ga0157379_100096048 257
43 3300025898 Ga0207692_10012700 Ga0207692_100127002 257
44 3300025899 Ga0207642_10022010 Ga0207642_100220102 257
45 3300025900 Ga0207710_10028460 Ga0207710_100284602 257
46 3300025903 Ga0207680_10008730 Ga0207680_100087303 257
47 3300025905 Ga0207685_10005534 Ga0207685_100055342 257
48 3300025908 Ga0207643_10117297 Ga0207643_101172972 257
49 3300025915 Ga0207693_10000104 Ga0207693_1000010448 257
50 3300025918 Ga0207662_10005874 Ga0207662_100058747 257
51 3300025925 Ga0207650_10016873 Ga0207650_100168733 257
52 3300025927 Ga0207687_10008617 Ga0207687_100086175 257
53 3300025935 Ga0207709_10128144 Ga0207709_101281442 257
54 3300025936 Ga0207670_10073666 Ga0207670_100736662 257
55 3300025937 Ga0207669_10014976 Ga0207669_100149763 257
56 3300025940 Ga0207691_10023778 Ga0207691_100237785 257
57 3300025941 Ga0207711_10000572 Ga0207711_100005725 257
58 3300025944 Ga0207661_10634138 Ga0207661_106341381 257
59 3300025960 Ga0207651_10002919 Ga0207651_100029195 257
60 3300025986 Ga0207658_10059694 Ga0207658_100596942 257
61 3300026023 Ga0207677_10000469 Ga0207677_100004693 257
62 3300026035 Ga0207703_10002876 Ga0207703_100028769 257
63 3300026078 Ga0207702_10093771 Ga0207702_100937712 257
64 3300026088 Ga0207641_10008544 Ga0207641_100085443 257
65 3300026095 Ga0207676_10002530 Ga0207676_100025309 257
66 3300026121 Ga0207683_10001133 Ga0207683_1000113312 257
67 3300026142 Ga0207698_10203015 Ga0207698_102030152 257
68 3300035086 Ga0373934_0038382 Ga0373934_0038382_1007_1843 257
69 3300035111 Ga0373923_0000205 Ga0373923_0000205_7806_8642 257
70 3300035117 Ga0373953_0001394 Ga0373953_0001394_1077_1913 257
71 3300035118 Ga0373954_0002022 Ga0373954_0002022_1718_2554 257
72 3300035120 Ga0373957_0008010 Ga0373957_0008010_2003_2839 257
73 3300035172 Ga0373955_0005365 Ga0373955_0005365_3798_4634 257
74 3300035410 Ga0373924_0126983 Ga0373924_0126983_79_915 257
75 3300035724 Ga0373933_0017492 Ga0373933_0017492_69_905 257
76 3300037068 Ga0373925_0278958 Ga0373925_0278958_11_847 257
77 3300046454 Ga0495592_0309309 Ga0495592_0309309_55_891 257
78 3300046539 Ga0495621_0003552 Ga0495621_0003552_1700_2536 257
79 3300046664 Ga0495659_0047479 Ga0495659_0047479_154_990 257
80 3300046679 Ga0495623_0052380 Ga0495623_0052380_1536_2372 257
81 3300048904 Ga0496101_0136489 Ga0496101_0136489_789_1625 257
82 3300048911 Ga0496108_0008141 Ga0496108_0008141_6572_7408 257
83 3300048912 Ga0496109_0040364 Ga0496109_0040364_521_1357 257
84 3300048918 Ga0496115_0116217 Ga0496115_0116217_158_994 257
85 3300005329 Ga0070683_100098767 Ga0070683_1000987671 261
86 3300005336 Ga0070680_100045898 Ga0070680_1000458981 261
87 3300005338 Ga0068868_100032040 Ga0068868_1000320403 261
88 3300005435 Ga0070714_100069918 Ga0070714_1000699183 261
89 3300005436 Ga0070713_100059822 Ga0070713_1000598222 261
90 3300005437 Ga0070710_10273250 Ga0070710_102732501 261
91 3300005445 Ga0070708_100589878 Ga0070708_1005898781 261
92 3300005457 Ga0070662_100319583 Ga0070662_1003195831 261
93 3300005468 Ga0070707_100299977 Ga0070707_1002999772 261
94 3300005471 Ga0070698_100151474 Ga0070698_1001514741 261
95 3300005518 Ga0070699_100189541 Ga0070699_1001895413 261
96 3300005530 Ga0070679_100468983 Ga0070679_1004689831 261
97 3300005535 Ga0070684_100093302 Ga0070684_1000933023 261
98 3300005546 Ga0070696_100081818 Ga0070696_1000818182 261
99 3300005547 Ga0070693_100006610 Ga0070693_1000066101 261
100 3300005578 Ga0068854_100330656 Ga0068854_1003306562 261
101 3300005834 Ga0068851_10008538 Ga0068851_100085384 261
102 3300009098 Ga0105245_10129621 Ga0105245_101296211 261
103 3300009174 Ga0105241_10227580 Ga0105241_102275802 261
104 3300010375 Ga0105239_10301624 Ga0105239_103016242 261
105 3300013104 Ga0157370_10025283 Ga0157370_100252834 261
106 3300013105 Ga0157369_10045838 Ga0157369_100458386 261
107 3300025321 Ga0207656_10063164 Ga0207656_100631641 261
108 3300025906 Ga0207699_10056467 Ga0207699_100564672 261
109 3300025911 Ga0207654_10050973 Ga0207654_100509733 261
110 3300025913 Ga0207695_10373661 Ga0207695_103736612 261
111 3300025915 Ga0207693_10006353 Ga0207693_100063537 261
112 3300025919 Ga0207657_10004654 Ga0207657_100046541 261
113 3300025921 Ga0207652_10195804 Ga0207652_101958042 261
114 3300025922 Ga0207646_10182159 Ga0207646_101821592 261
115 3300025927 Ga0207687_10040880 Ga0207687_100408803 261
116 3300025929 Ga0207664_10010626 Ga0207664_100106263 261
117 3300025933 Ga0207706_10068189 Ga0207706_100681892 261
118 3300025939 Ga0207665_10033312 Ga0207665_100333122 261
119 3300025944 Ga0207661_10125959 Ga0207661_101259593 261
120 3300026023 Ga0207677_10253544 Ga0207677_102535441 261
121 3300026142 Ga0207698_10484738 Ga0207698_104847381 261
122 3300035171 Ga0373946_0032003 Ga0373946_0032003_118_975 261
123 3300035692 Ga0373935_0098112 Ga0373935_0098112_826_1683 261
124 3300035725 Ga0373947_0030883 Ga0373947_0030883_169_1026 261
125 3300037068 Ga0373925_0285317 Ga0373925_0285317_271_1128 261
126 3300048906 Ga0496103_0042137 Ga0496103_0042137_1885_2721 261
127 3300048909 Ga0496106_0084317 Ga0496106_0084317_34_870 261
128 3300048915 Ga0496112_0189653 Ga0496112_0189653_57_893 261
129 3300050514 nmdc:mga08x19_223567_c1 nmdc:mga08x19_223567_c1_403_1239 261
130 3300005329 Ga0070683_100045484 Ga0070683_1000454844 263
131 3300005535 Ga0070684_100013383 Ga0070684_1000133838 263
132 3300005547 Ga0070693_100107936 Ga0070693_1001079362 263
133 3300006237 Ga0097621_100009563 Ga0097621_1000095634 263
134 3300006358 Ga0068871_100003069 Ga0068871_1000030696 263
135 3300009177 Ga0105248_10414506 Ga0105248_104145062 263
136 3300014969 Ga0157376_10042432 Ga0157376_100424324 263
137 3300034957 Ga0373938_0018515 Ga0373938_0018515_251_1129 263
138 3300035691 Ga0373931_0016875 Ga0373931_0016875_80_958 263
139 3300009094 Ga0111539_10070916 Ga0111539_100709166 265
140 3300025937 Ga0207669_10540084 Ga0207669_105400841 265
141 3300005546 Ga0070696_100388414 Ga0070696_1003884142 268
142 3300046472 Ga0495580_0187079 Ga0495580_0187079_75_941 268
143 3300035692 Ga0373935_0039146 Ga0373935_0039146_830_1666 271
144 3300035695 Ga0373927_0103290 Ga0373927_0103290_786_1622 271
145 3300035725 Ga0373947_0055504 Ga0373947_0055504_474_1310 271
146 3300036401 Ga0373937_0021545 Ga0373937_0021545_1212_2048 271
147 3300046455 Ga0495603_0077020 Ga0495603_0077020_926_1762 271
148 3300046463 Ga0495653_0222837 Ga0495653_0222837_383_1219 271
149 3300046472 Ga0495580_0055990 Ga0495580_0055990_1330_2166 271
150 3300046473 Ga0495582_0003693 Ga0495582_0003693_6453_7289 271
151 3300046476 Ga0495662_0025122 Ga0495662_0025122_709_1545 271
152 3300046499 Ga0495594_0050679 Ga0495594_0050679_266_1102 271
153 3300046531 Ga0495665_0029121 Ga0495665_0029121_1811_2647 271
154 3300046543 Ga0495645_0025778 Ga0495645_0025778_1025_1861 271
155 3300046642 Ga0495634_0059578 Ga0495634_0059578_652_1488 271
156 3300046663 Ga0495635_0082244 Ga0495635_0082244_907_1743 271
157 3300046683 Ga0495658_0026403 Ga0495658_0026403_2070_2906 271
158 3300046689 Ga0495613_0093433 Ga0495613_0093433_832_1668 271
159 3300046809 Ga0495600_0006681 Ga0495600_0006681_4716_5552 271
160 3300047319 Ga0495674_0218376 Ga0495674_0218376_675_1511 271
161 3300047322 Ga0495680_0044568 Ga0495680_0044568_1715_2551 271
162 3300047673 Ga0495593_0057647 Ga0495593_0057647_53_889 271
163 3300048089 Ga0495614_0078529 Ga0495614_0078529_531_1367 271
164 3300053085 Ga0495619_0009966 Ga0495619_0009966_1413_2249 271
165 3300048917 Ga0496114_0187853 Ga0496114_0187853_610_1503 272
166 3300005458 Ga0070681_10041698 Ga0070681_100416982 275
167 3300013104 Ga0157370_10007918 Ga0157370_100079187 275
168 3300005336 Ga0070680_100036078 Ga0070680_1000360783 276
169 3300005355 Ga0070671_100236369 Ga0070671_1002363692 276
170 3300005435 Ga0070714_100006057 Ga0070714_1000060575 276
171 3300005458 Ga0070681_10004051 Ga0070681_1000405111 276
172 3300005530 Ga0070679_100010697 Ga0070679_1000106975 276
173 3300005563 Ga0068855_100028779 Ga0068855_1000287794 276
174 3300005614 Ga0068856_100004914 Ga0068856_1000049143 276
175 3300013307 Ga0157372_10002331 Ga0157372_1000233124 276
176 3300013307 Ga0157372_10160040 Ga0157372_101600402 276
177 3300025912 Ga0207707_10015357 Ga0207707_100153575 276
178 3300025917 Ga0207660_10013758 Ga0207660_100137584 276
179 3300025921 Ga0207652_10033282 Ga0207652_100332825 276
180 3300025929 Ga0207664_10030822 Ga0207664_100308222 276
181 3300025945 Ga0207679_10044939 Ga0207679_100449393 276
182 3300025981 Ga0207640_10104584 Ga0207640_101045842 276
183 3300026078 Ga0207702_10035970 Ga0207702_100359703 276
184 3300026078 Ga0207702_10287987 Ga0207702_102879872 276
185 3300026116 Ga0207674_10105497 Ga0207674_101054973 276
186 3300045976 Ga0466967_0057018 Ga0466967_0057018_1424_2272 276
187 3300005330 Ga0070690_100193293 Ga0070690_1001932931 277
188 3300005331 Ga0070670_100003760 Ga0070670_1000037607 277
189 3300005331 Ga0070670_100020212 Ga0070670_1000202123 277
190 3300005333 Ga0070677_10026492 Ga0070677_100264921 277
191 3300005334 Ga0068869_100008953 Ga0068869_1000089533 277
192 3300005339 Ga0070660_100413139 Ga0070660_1004131391 277
193 3300005340 Ga0070689_100029842 Ga0070689_1000298424 277
194 3300005354 Ga0070675_100012798 Ga0070675_1000127983 277
195 3300005354 Ga0070675_100030522 Ga0070675_1000305224 277
196 3300005356 Ga0070674_100026075 Ga0070674_1000260752 277
197 3300005364 Ga0070673_100036692 Ga0070673_1000366922 277
198 3300005364 Ga0070673_100113604 Ga0070673_1001136042 277
199 3300005367 Ga0070667_100204993 Ga0070667_1002049932 277
200 3300005456 Ga0070678_100425627 Ga0070678_1004256271 277
201 3300005459 Ga0068867_100016105 Ga0068867_1000161051 277
202 3300005536 Ga0070697_100379527 Ga0070697_1003795272 277
203 3300005543 Ga0070672_100077909 Ga0070672_1000779093 277
204 3300005544 Ga0070686_100109330 Ga0070686_1001093302 277
205 3300005545 Ga0070695_100502949 Ga0070695_1005029491 277
206 3300005615 Ga0070702_100075566 Ga0070702_1000755662 277
207 3300005616 Ga0068852_100240044 Ga0068852_1002400442 277
208 3300005617 Ga0068859_100077083 Ga0068859_1000770832 277
209 3300005617 Ga0068859_100268841 Ga0068859_1002688412 277
210 3300005618 Ga0068864_100006458 Ga0068864_1000064586 277
211 3300005618 Ga0068864_100017297 Ga0068864_1000172974 277
212 3300005618 Ga0068864_100053038 Ga0068864_1000530383 277
213 3300005618 Ga0068864_100188438 Ga0068864_1001884382 277
214 3300005718 Ga0068866_10055564 Ga0068866_100555641 277
215 3300005834 Ga0068851_10222347 Ga0068851_102223471 277
216 3300005840 Ga0068870_10196464 Ga0068870_101964642 277
217 3300005841 Ga0068863_100002857 Ga0068863_1000028578 277
218 3300005841 Ga0068863_100056480 Ga0068863_1000564802 277
219 3300005841 Ga0068863_100194706 Ga0068863_1001947063 277
220 3300005842 Ga0068858_100149812 Ga0068858_1001498123 277
221 3300005843 Ga0068860_100134539 Ga0068860_1001345393 277
222 3300005844 Ga0068862_100041628 Ga0068862_1000416283 277
223 3300005844 Ga0068862_100085113 Ga0068862_1000851133 277
224 3300005844 Ga0068862_100185362 Ga0068862_1001853623 277
225 3300006237 Ga0097621_100094791 Ga0097621_1000947913 277
226 3300006358 Ga0068871_100086899 Ga0068871_1000868993 277
227 3300006881 Ga0068865_100055704 Ga0068865_1000557042 277
228 3300006931 Ga0097620_100077081 Ga0097620_1000770812 277
229 3300006931 Ga0097620_100268828 Ga0097620_1002688282 277
230 3300009176 Ga0105242_10222964 Ga0105242_102229642 277
231 3300009177 Ga0105248_10198693 Ga0105248_101986933 277
232 3300009177 Ga0105248_10688705 Ga0105248_106887051 277
233 3300009553 Ga0105249_10057803 Ga0105249_100578034 277
234 3300013296 Ga0157374_10582507 Ga0157374_105825072 277
235 3300013297 Ga0157378_10117962 Ga0157378_101179622 277
236 3300013306 Ga0163162_10121295 Ga0163162_101212953 277
237 3300013307 Ga0157372_10027510 Ga0157372_100275106 277
238 3300013308 Ga0157375_10094115 Ga0157375_100941152 277
239 3300014325 Ga0163163_10011269 Ga0163163_100112694 277
240 3300014325 Ga0163163_10013670 Ga0163163_100136703 277
241 3300014326 Ga0157380_10069279 Ga0157380_100692793 277
242 3300014326 Ga0157380_10216133 Ga0157380_102161332 277
243 3300014969 Ga0157376_10061004 Ga0157376_100610043 277
244 3300025893 Ga0207682_10002765 Ga0207682_100027658 277
245 3300025899 Ga0207642_10090296 Ga0207642_100902961 277
246 3300025907 Ga0207645_10031886 Ga0207645_100318862 277
247 3300025908 Ga0207643_10005469 Ga0207643_100054694 277
248 3300025918 Ga0207662_10113794 Ga0207662_101137942 277
249 3300025919 Ga0207657_10040315 Ga0207657_100403153 277
250 3300025925 Ga0207650_10013289 Ga0207650_100132894 277
251 3300025925 Ga0207650_10050645 Ga0207650_100506452 277
252 3300025926 Ga0207659_10068777 Ga0207659_100687773 277
253 3300025931 Ga0207644_10241578 Ga0207644_102415781 277
254 3300025932 Ga0207690_10249038 Ga0207690_102490381 277
255 3300025934 Ga0207686_10072370 Ga0207686_100723702 277
256 3300025936 Ga0207670_10099090 Ga0207670_100990902 277
257 3300025940 Ga0207691_10001401 Ga0207691_1000140120 277
258 3300025940 Ga0207691_10190935 Ga0207691_101909352 277
259 3300025942 Ga0207689_10006312 Ga0207689_100063128 277
260 3300025945 Ga0207679_10242841 Ga0207679_102428412 277
261 3300025949 Ga0207667_10281976 Ga0207667_102819762 277
262 3300025960 Ga0207651_10237981 Ga0207651_102379811 277
263 3300025986 Ga0207658_10151167 Ga0207658_101511672 277
264 3300026075 Ga0207708_10053128 Ga0207708_100531283 277
265 3300026088 Ga0207641_10063674 Ga0207641_100636743 277
266 3300026088 Ga0207641_10446741 Ga0207641_104467412 277
267 3300026089 Ga0207648_10020296 Ga0207648_100202965 277
268 3300026095 Ga0207676_10023341 Ga0207676_100233415 277
269 3300026118 Ga0207675_100147753 Ga0207675_1001477532 277
270 3300026121 Ga0207683_10013560 Ga0207683_100135605 277
271 3300028381 Ga0268264_10060412 Ga0268264_100604122 277
272 3300028381 Ga0268264_10154146 Ga0268264_101541463 277
273 3300035172 Ga0373955_0119781 Ga0373955_0119781_580_1416 277
274 3300036401 Ga0373937_0014725 Ga0373937_0014725_5417_6253 277
275 3300036401 Ga0373937_0025596 Ga0373937_0025596_3562_4398 277
276 3300039437 Ga0436365_0686227 Ga0436365_0686227_23_859 277
277 3300048088 Ga0495602_0097632 Ga0495602_0097632_1041_1877 277
278 3300048912 Ga0496109_0239075 Ga0496109_0239075_328_1164 277
279 3300005328 Ga0070676_10235796 Ga0070676_102357961 278
280 3300005331 Ga0070670_100023997 Ga0070670_1000239972 278
281 3300005347 Ga0070668_100104800 Ga0070668_1001048001 278
282 3300005471 Ga0070698_100045367 Ga0070698_1000453673 278
283 3300005518 Ga0070699_100138676 Ga0070699_1001386762 278
284 3300009093 Ga0105240_10007422 Ga0105240_1000742215 278
285 3300009545 Ga0105237_10147303 Ga0105237_101473034 278
286 3300025907 Ga0207645_10049460 Ga0207645_100494602 278
287 3300025925 Ga0207650_10015751 Ga0207650_100157517 278
288 3300025972 Ga0207668_10027692 Ga0207668_100276923 278
289 3300026089 Ga0207648_10030919 Ga0207648_100309195 278
290 3300050514 nmdc:mga08x19_50596_c1 nmdc:mga08x19_50596_c1_853_1722 278
291 3300005328 Ga0070676_10001948 Ga0070676_100019483 279
292 3300005331 Ga0070670_100044539 Ga0070670_1000445394 279
293 3300005334 Ga0068869_100002327 Ga0068869_1000023278 279
294 3300005334 Ga0068869_100029310 Ga0068869_1000293103 279
295 3300005335 Ga0070666_10000816 Ga0070666_100008168 279
296 3300005335 Ga0070666_10013432 Ga0070666_100134322 279
297 3300005338 Ga0068868_100010780 Ga0068868_1000107805 279
298 3300005340 Ga0070689_100080660 Ga0070689_1000806602 279
299 3300005347 Ga0070668_100002584 Ga0070668_1000025846 279
300 3300005347 Ga0070668_100004081 Ga0070668_1000040817 279
301 3300005353 Ga0070669_100001114 Ga0070669_10000111412 279
302 3300005354 Ga0070675_100003508 Ga0070675_1000035085 279
303 3300005354 Ga0070675_100004648 Ga0070675_1000046488 279
304 3300005355 Ga0070671_100008929 Ga0070671_1000089292 279
305 3300005355 Ga0070671_100052153 Ga0070671_1000521534 279
306 3300005356 Ga0070674_100000236 Ga0070674_10000023630 279
307 3300005356 Ga0070674_100079709 Ga0070674_1000797092 279
308 3300005364 Ga0070673_100001162 Ga0070673_1000011623 279
309 3300005364 Ga0070673_100003476 Ga0070673_10000347610 279
310 3300005367 Ga0070667_100006712 Ga0070667_1000067124 279
311 3300005367 Ga0070667_100008845 Ga0070667_1000088453 279
312 3300005436 Ga0070713_100000114 Ga0070713_1000001147 279
313 3300005439 Ga0070711_100071113 Ga0070711_1000711132 279
314 3300005445 Ga0070708_100002053 Ga0070708_1000020537 279
315 3300005455 Ga0070663_100085802 Ga0070663_1000858022 279
316 3300005455 Ga0070663_100238267 Ga0070663_1002382672 279
317 3300005456 Ga0070678_100000447 Ga0070678_1000004478 279
318 3300005456 Ga0070678_100036592 Ga0070678_1000365923 279
319 3300005459 Ga0068867_100001541 Ga0068867_1000015418 279
320 3300005459 Ga0068867_100002023 Ga0068867_1000020231 279
321 3300005466 Ga0070685_10029391 Ga0070685_100293913 279
322 3300005539 Ga0068853_100000689 Ga0068853_1000006896 279
323 3300005539 Ga0068853_100077060 Ga0068853_1000770602 279
324 3300005548 Ga0070665_100002874 Ga0070665_1000028748 279
325 3300005548 Ga0070665_100007383 Ga0070665_1000073832 279
326 3300005578 Ga0068854_100132321 Ga0068854_1001323212 279
327 3300005615 Ga0070702_100101990 Ga0070702_1001019902 279
328 3300005616 Ga0068852_100007280 Ga0068852_1000072805 279
329 3300005617 Ga0068859_100001172 Ga0068859_10000117215 279
330 3300005618 Ga0068864_100011915 Ga0068864_1000119156 279
331 3300005618 Ga0068864_100048253 Ga0068864_1000482535 279
332 3300005718 Ga0068866_10129509 Ga0068866_101295092 279
333 3300005719 Ga0068861_100073760 Ga0068861_1000737603 279
334 3300005834 Ga0068851_10001073 Ga0068851_100010732 279
335 3300005840 Ga0068870_10001220 Ga0068870_1000122010 279
336 3300005841 Ga0068863_100009074 Ga0068863_10000907412 279
337 3300005841 Ga0068863_100084840 Ga0068863_1000848401 279
338 3300005842 Ga0068858_100032683 Ga0068858_1000326835 279
339 3300005842 Ga0068858_100105223 Ga0068858_1001052233 279
340 3300005843 Ga0068860_100025511 Ga0068860_1000255114 279
341 3300005843 Ga0068860_100028894 Ga0068860_1000288945 279
342 3300005844 Ga0068862_100031529 Ga0068862_1000315293 279
343 3300006237 Ga0097621_100005645 Ga0097621_10000564511 279
344 3300006237 Ga0097621_100100361 Ga0097621_1001003612 279
345 3300006358 Ga0068871_100000551 Ga0068871_10000055116 279
346 3300006358 Ga0068871_100050549 Ga0068871_1000505493 279
347 3300006881 Ga0068865_100003205 Ga0068865_1000032055 279
348 3300006881 Ga0068865_100261117 Ga0068865_1002611172 279
349 3300006931 Ga0097620_100001172 Ga0097620_10000117215 279
350 3300009177 Ga0105248_10002637 Ga0105248_100026378 279
351 3300009553 Ga0105249_10049577 Ga0105249_100495775 279
352 3300013296 Ga0157374_10003531 Ga0157374_1000353114 279
353 3300013306 Ga0163162_10000806 Ga0163162_1000080615 279
354 3300013306 Ga0163162_10109941 Ga0163162_101099412 279
355 3300013308 Ga0157375_10003811 Ga0157375_100038113 279
356 3300014326 Ga0157380_10025621 Ga0157380_100256214 279
357 3300014745 Ga0157377_10268125 Ga0157377_102681251 279
358 3300014968 Ga0157379_10003325 Ga0157379_100033252 279
359 3300014969 Ga0157376_10019433 Ga0157376_100194334 279
360 3300025315 Ga0207697_10003081 Ga0207697_100030814 279
361 3300025321 Ga0207656_10001807 Ga0207656_100018076 279
362 3300025893 Ga0207682_10000242 Ga0207682_1000024210 279
363 3300025893 Ga0207682_10048977 Ga0207682_100489772 279
364 3300025903 Ga0207680_10002437 Ga0207680_100024375 279
365 3300025903 Ga0207680_10015307 Ga0207680_100153073 279
366 3300025907 Ga0207645_10001123 Ga0207645_1000112313 279
367 3300025907 Ga0207645_10002011 Ga0207645_1000201110 279
368 3300025908 Ga0207643_10073500 Ga0207643_100735002 279
369 3300025909 Ga0207705_10156517 Ga0207705_101565172 279
370 3300025923 Ga0207681_10005369 Ga0207681_100053699 279
371 3300025925 Ga0207650_10012311 Ga0207650_100123113 279
372 3300025925 Ga0207650_10061370 Ga0207650_100613702 279
373 3300025926 Ga0207659_10001235 Ga0207659_100012356 279
374 3300025928 Ga0207700_10000018 Ga0207700_10000018138 279
375 3300025931 Ga0207644_10041489 Ga0207644_100414894 279
376 3300025931 Ga0207644_10162009 Ga0207644_101620091 279
377 3300025937 Ga0207669_10057677 Ga0207669_100576772 279
378 3300025938 Ga0207704_10006554 Ga0207704_100065543 279
379 3300025938 Ga0207704_10097240 Ga0207704_100972402 279
380 3300025940 Ga0207691_10000216 Ga0207691_1000021614 279
381 3300025940 Ga0207691_10000454 Ga0207691_1000045418 279
382 3300025941 Ga0207711_10003092 Ga0207711_100030924 279
383 3300025942 Ga0207689_10000963 Ga0207689_100009634 279
384 3300025942 Ga0207689_10055133 Ga0207689_100551334 279
385 3300025960 Ga0207651_10000642 Ga0207651_100006422 279
386 3300025960 Ga0207651_10005325 Ga0207651_100053253 279
387 3300025961 Ga0207712_10036789 Ga0207712_100367894 279
388 3300025972 Ga0207668_10025686 Ga0207668_100256863 279
389 3300025981 Ga0207640_10129810 Ga0207640_101298102 279
390 3300025986 Ga0207658_10032283 Ga0207658_100322833 279
391 3300025986 Ga0207658_10242326 Ga0207658_102423263 279
392 3300026023 Ga0207677_10001861 Ga0207677_100018612 279
393 3300026023 Ga0207677_10120424 Ga0207677_101204241 279
394 3300026035 Ga0207703_10009883 Ga0207703_100098839 279
395 3300026035 Ga0207703_10126170 Ga0207703_101261702 279
396 3300026041 Ga0207639_10009864 Ga0207639_100098645 279
397 3300026067 Ga0207678_10031271 Ga0207678_100312717 279
398 3300026067 Ga0207678_10272642 Ga0207678_102726422 279
399 3300026088 Ga0207641_10012275 Ga0207641_100122758 279
400 3300026088 Ga0207641_10117374 Ga0207641_101173742 279
401 3300026089 Ga0207648_10000763 Ga0207648_1000076322 279
402 3300026089 Ga0207648_10000829 Ga0207648_100008293 279
403 3300026095 Ga0207676_10002692 Ga0207676_1000269216 279
404 3300026118 Ga0207675_100024243 Ga0207675_1000242433 279
405 3300026118 Ga0207675_100086145 Ga0207675_1000861452 279
406 3300026121 Ga0207683_10000401 Ga0207683_1000040121 279
407 3300026121 Ga0207683_10000705 Ga0207683_1000070520 279
408 3300028379 Ga0268266_10005748 Ga0268266_100057486 279
409 3300028379 Ga0268266_10017606 Ga0268266_100176062 279
410 3300028380 Ga0268265_10075945 Ga0268265_100759452 279
411 3300028381 Ga0268264_10007810 Ga0268264_100078105 279
412 3300028381 Ga0268264_10010411 Ga0268264_100104113 279
413 3300035692 Ga0373935_0086357 Ga0373935_0086357_581_1423 279
414 3300036401 Ga0373937_0302335 Ga0373937_0302335_487_1344 279
415 3300037068 Ga0373925_0009867 Ga0373925_0009867_3547_4389 279
416 3300045051 Ga0451576_0406890 Ga0451576_0406890_536_1393 279
417 3300048911 Ga0496108_0017069 Ga0496108_0017069_3553_4428 279
418 3300048912 Ga0496109_0027634 Ga0496109_0027634_226_1101 279
419 3300048917 Ga0496114_0222221 Ga0496114_0222221_695_1570 279
420 3300053084 Ga0495595_0045109 Ga0495595_0045109_411_1253 279
421 3300053084 Ga0495595_0073078 Ga0495595_0073078_731_1606 279
422 3300005444 Ga0070694_100004678 Ga0070694_1000046785 280
423 3300005545 Ga0070695_100007172 Ga0070695_1000071723 280
424 3300005549 Ga0070704_100019944 Ga0070704_1000199444 280
425 3300032004 Ga0307414_10195151 Ga0307414_101951511 280
426 3300005328 Ga0070676_10093948 Ga0070676_100939482 282
427 3300005331 Ga0070670_100175821 Ga0070670_1001758212 282
428 3300005347 Ga0070668_100247837 Ga0070668_1002478372 282
429 3300005354 Ga0070675_100008431 Ga0070675_1000084315 282
430 3300005354 Ga0070675_100206915 Ga0070675_1002069152 282
431 3300005367 Ga0070667_100259025 Ga0070667_1002590252 282
432 3300005445 Ga0070708_100051904 Ga0070708_1000519046 282
433 3300005467 Ga0070706_100181600 Ga0070706_1001816003 282
434 3300005468 Ga0070707_100037001 Ga0070707_1000370014 282
435 3300005518 Ga0070699_100258735 Ga0070699_1002587352 282
436 3300005536 Ga0070697_100013851 Ga0070697_1000138514 282
437 3300005543 Ga0070672_100078858 Ga0070672_1000788582 282
438 3300005617 Ga0068859_100409592 Ga0068859_1004095922 282
439 3300005841 Ga0068863_100044347 Ga0068863_1000443473 282
440 3300005841 Ga0068863_100337045 Ga0068863_1003370452 282
441 3300005842 Ga0068858_100081612 Ga0068858_1000816122 282
442 3300005842 Ga0068858_100122180 Ga0068858_1001221803 282
443 3300005843 Ga0068860_100016447 Ga0068860_1000164475 282
444 3300005843 Ga0068860_100029246 Ga0068860_1000292463 282
445 3300006358 Ga0068871_100259275 Ga0068871_1002592752 282
446 3300006852 Ga0075433_10030502 Ga0075433_100305022 282
447 3300006871 Ga0075434_100021939 Ga0075434_1000219392 282
448 3300006914 Ga0075436_100035610 Ga0075436_1000356103 282
449 3300006931 Ga0097620_100409611 Ga0097620_1004096112 282
450 3300007076 Ga0075435_100008207 Ga0075435_1000082073 282
451 3300009147 Ga0114129_10068810 Ga0114129_100688103 282
452 3300013308 Ga0157375_10359397 Ga0157375_103593972 282
453 3300025910 Ga0207684_10013573 Ga0207684_100135734 282
454 3300025910 Ga0207684_10116171 Ga0207684_101161712 282
455 3300025922 Ga0207646_10007938 Ga0207646_100079386 282
456 3300025923 Ga0207681_10118862 Ga0207681_101188622 282
457 3300025925 Ga0207650_10016853 Ga0207650_100168534 282
458 3300025925 Ga0207650_10404466 Ga0207650_104044661 282
459 3300025926 Ga0207659_10006236 Ga0207659_100062364 282
460 3300025926 Ga0207659_10056912 Ga0207659_100569123 282
461 3300025939 Ga0207665_10082520 Ga0207665_100825202 282
462 3300025940 Ga0207691_10023315 Ga0207691_100233154 282
463 3300025940 Ga0207691_10078162 Ga0207691_100781622 282
464 3300025986 Ga0207658_10101393 Ga0207658_101013932 282
465 3300025986 Ga0207658_10121416 Ga0207658_101214162 282
466 3300026035 Ga0207703_10093198 Ga0207703_100931983 282
467 3300026035 Ga0207703_10105239 Ga0207703_101052392 282
468 3300026118 Ga0207675_100127694 Ga0207675_1001276942 282
469 3300028381 Ga0268264_10014615 Ga0268264_100146156 282
470 3300046472 Ga0495580_0150064 Ga0495580_0150064_591_1442 282
471 3300048907 Ga0496104_0416490 Ga0496104_0416490_135_1001 282
472 3300048908 Ga0496105_0459561 Ga0496105_0459561_30_896 282
473 3300050507 nmdc:mga05p37_99504_c1 nmdc:mga05p37_99504_c1_732_1583 282
474 3300050512 nmdc:mga0n895_14216_c1 nmdc:mga0n895_14216_c1_4163_5014 282
475 3300050513 nmdc:mga0rr50_6927_c1 nmdc:mga0rr50_6927_c1_5341_6192 282
476 3300050515 nmdc:mga0a205_43040_c1 nmdc:mga0a205_43040_c1_1320_2171 282
477 3300013307 Ga0157372_10071265 Ga0157372_100712654 283
478 3300007265 Ga0099794_10154035 Ga0099794_101540351 284
479 3300005347 Ga0070668_100002425 Ga0070668_10000242511 285
480 3300005353 Ga0070669_100035416 Ga0070669_1000354163 285
481 3300005356 Ga0070674_100006028 Ga0070674_1000060288 285
482 3300014326 Ga0157380_10007998 Ga0157380_100079984 285
483 3300025972 Ga0207668_10000894 Ga0207668_100008945 285
484 3300027395 Ga0209996_1012158 Ga0209996_10121582 285
485 3300005844 Ga0068862_100015687 Ga0068862_1000156878 286
486 3300025972 Ga0207668_10056834 Ga0207668_100568342 286
487 3300028381 Ga0268264_10101663 Ga0268264_101016633 286
488 3300005295 Ga0065707_10108281 Ga0065707_101082814 288
489 3300005295 Ga0065707_10251239 Ga0065707_102512392 288
490 3300005330 Ga0070690_100402209 Ga0070690_1004022091 288
491 3300005334 Ga0068869_100229020 Ga0068869_1002290203 288
492 3300005340 Ga0070689_100120950 Ga0070689_1001209504 288
493 3300005340 Ga0070689_100342332 Ga0070689_1003423322 288
494 3300005343 Ga0070687_100320358 Ga0070687_1003203581 288
495 3300005345 Ga0070692_10153622 Ga0070692_101536222 288
496 3300005354 Ga0070675_100094313 Ga0070675_1000943132 288
497 3300005365 Ga0070688_100089058 Ga0070688_1000890582 288
498 3300005444 Ga0070694_100203860 Ga0070694_1002038601 288
499 3300005444 Ga0070694_100326779 Ga0070694_1003267792 288
500 3300005468 Ga0070707_100033339 Ga0070707_1000333392 288
501 3300005471 Ga0070698_100101567 Ga0070698_1001015673 288
502 3300005471 Ga0070698_100177912 Ga0070698_1001779122 288
503 3300005518 Ga0070699_100254034 Ga0070699_1002540342 288
504 3300005546 Ga0070696_100071277 Ga0070696_1000712774 288
505 3300005549 Ga0070704_100001327 Ga0070704_10000132713 288
506 3300005577 Ga0068857_100149944 Ga0068857_1001499442 288
507 3300005617 Ga0068859_100037393 Ga0068859_1000373936 288
508 3300005618 Ga0068864_100082993 Ga0068864_1000829932 288
509 3300005844 Ga0068862_100569074 Ga0068862_1005690741 288
510 3300006844 Ga0075428_100080658 Ga0075428_1000806582 288
511 3300006844 Ga0075428_100108012 Ga0075428_1001080123 288
512 3300006846 Ga0075430_100000550 Ga0075430_1000005509 288
513 3300006846 Ga0075430_100007696 Ga0075430_1000076966 288
514 3300006847 Ga0075431_100005396 Ga0075431_1000053963 288
515 3300006847 Ga0075431_100242110 Ga0075431_1002421102 288
516 3300006852 Ga0075433_10068886 Ga0075433_100688863 288
517 3300006880 Ga0075429_100000511 Ga0075429_10000051132 288
518 3300006880 Ga0075429_100039718 Ga0075429_1000397184 288
519 3300006931 Ga0097620_100037393 Ga0097620_1000373936 288
520 3300007265 Ga0099794_10015782 Ga0099794_100157823 288
521 3300009094 Ga0111539_10013382 Ga0111539_100133826 288
522 3300009098 Ga0105245_10055737 Ga0105245_100557374 288
523 3300009176 Ga0105242_10001782 Ga0105242_1000178213 288
524 3300025885 Ga0207653_10065008 Ga0207653_100650082 288
525 3300025918 Ga0207662_10247088 Ga0207662_102470882 288
526 3300025927 Ga0207687_10011741 Ga0207687_100117415 288
527 3300025934 Ga0207686_10020882 Ga0207686_100208822 288
528 3300025936 Ga0207670_10102691 Ga0207670_101026914 288
529 3300025936 Ga0207670_10127750 Ga0207670_101277502 288
530 3300025938 Ga0207704_10006774 Ga0207704_100067746 288
531 3300025942 Ga0207689_10259174 Ga0207689_102591743 288
532 3300026116 Ga0207674_10118474 Ga0207674_101184744 288
533 3300026118 Ga0207675_100144068 Ga0207675_1001440682 288
534 3300026118 Ga0207675_100725849 Ga0207675_1007258492 288
535 3300027360 Ga0209969_1001086 Ga0209969_10010864 288
536 3300027378 Ga0209981_1001444 Ga0209981_10014444 288
537 3300027462 Ga0210000_1001892 Ga0210000_10018924 288
538 3300027471 Ga0209995_1001597 Ga0209995_10015975 288
539 3300027526 Ga0209968_1002375 Ga0209968_10023754 288
540 3300027665 Ga0209983_1025328 Ga0209983_10253282 288
541 3300027682 Ga0209971_1040499 Ga0209971_10404992 288
542 3300027695 Ga0209966_1005660 Ga0209966_10056602 288
543 3300027907 Ga0207428_10070921 Ga0207428_100709212 288
544 3300031548 Ga0307408_100003640 Ga0307408_1000036406 288
545 3300031731 Ga0307405_10003582 Ga0307405_100035823 288
546 3300031824 Ga0307413_10012513 Ga0307413_100125134 288
547 3300031852 Ga0307410_10000615 Ga0307410_1000061511 288
548 3300031901 Ga0307406_10002939 Ga0307406_100029395 288
549 3300031903 Ga0307407_10000267 Ga0307407_100002675 288
550 3300031911 Ga0307412_10007003 Ga0307412_100070032 288
551 3300031995 Ga0307409_100005162 Ga0307409_1000051623 288
552 3300032002 Ga0307416_100008868 Ga0307416_1000088684 288
553 3300032005 Ga0307411_10022388 Ga0307411_100223882 288
554 3300032126 Ga0307415_100000721 Ga0307415_10000072113 288
555 3300035117 Ga0373953_0012794 Ga0373953_0012794_2067_2936 288
556 3300035118 Ga0373954_0000002 Ga0373954_0000002_63607_64476 288
557 3300035691 Ga0373931_0066765 Ga0373931_0066765_669_1541 288
558 3300035724 Ga0373933_0000657 Ga0373933_0000657_18658_19527 288
559 3300036401 Ga0373937_0000358 Ga0373937_0000358_26161_27030 288
560 3300041410 Ga0439461_0002213 Ga0439461_0002213_2119_2988 288
561 3300041486 Ga0451807_1806802 Ga0451807_1806802_588_1463 288
562 3300041997 Ga0439431_0034581 Ga0439431_0034581_180_1049 288
563 3300042001 Ga0439441_000163 Ga0439441_000163_3122_3994 288
564 3300042001 Ga0439441_003222 Ga0439441_003222_628_1494 288
565 3300042156 Ga0439446_0000176 Ga0439446_0000176_5513_6382 288
566 3300042435 Ga0439434_0001633 Ga0439434_0001633_3769_4638 288
567 3300042436 Ga0439435_0000026 Ga0439435_0000026_481_1350 288
568 3300042436 Ga0439435_0013765 Ga0439435_0013765_925_1797 288
569 3300042876 Ga0451577_0452460 Ga0451577_0452460_100_966 288
570 3300045051 Ga0451576_0034631 Ga0451576_0034631_2535_3401 288
571 3300046454 Ga0495592_0003821 Ga0495592_0003821_6520_7389 288
572 3300046476 Ga0495662_0008976 Ga0495662_0008976_1013_1903 288
573 3300046476 Ga0495662_0027173 Ga0495662_0027173_24_893 288
574 3300046511 Ga0495608_0002044 Ga0495608_0002044_10022_10891 288
575 3300046514 Ga0495618_0022560 Ga0495618_0022560_1500_2369 288
576 3300046516 Ga0495628_0016487 Ga0495628_0016487_354_1223 288
577 3300046517 Ga0495630_0001185 Ga0495630_0001185_9161_10030 288
578 3300046517 Ga0495630_0039270 Ga0495630_0039270_2295_3185 288
579 3300046529 Ga0495652_0033401 Ga0495652_0033401_2494_3363 288
580 3300046533 Ga0495640_0000808 Ga0495640_0000808_14453_15322 288
581 3300046533 Ga0495640_0004665 Ga0495640_0004665_7817_8707 288
582 3300046535 Ga0495586_0000440 Ga0495586_0000440_13220_14089 288
583 3300046559 Ga0495667_0001153 Ga0495667_0001153_2002_2871 288
584 3300046642 Ga0495634_0002587 Ga0495634_0002587_9828_10697 288
585 3300046689 Ga0495613_0025295 Ga0495613_0025295_2404_3273 288
586 3300046690 Ga0495624_0034028 Ga0495624_0034028_1314_2204 288
587 3300047317 Ga0495604_0103336 Ga0495604_0103336_1063_1953 288
588 3300047319 Ga0495674_0123030 Ga0495674_0123030_306_1196 288
589 3300047322 Ga0495680_0001572 Ga0495680_0001572_12775_13644 288
590 3300047471 Ga0495684_0018458 Ga0495684_0018458_3159_4028 288
591 3300049576 Ga0501040_0018725 Ga0501040_0018725_1376_2245 288
592 3300049576 Ga0501040_0072432 Ga0501040_0072432_760_1632 288
593 3300049582 Ga0501048_0252032 Ga0501048_0252032_279_1148 288
594 3300049584 Ga0501068_0212842 Ga0501068_0212842_30_911 288
595 3300049590 Ga0501074_0299992 Ga0501074_0299992_109_978 288
596 3300049741 Ga0501079_0028118 Ga0501079_0028118_3014_3883 288
597 3300050507 nmdc:mga05p37_209_c1 nmdc:mga05p37_209_c1_45279_46145 288
598 3300050508 nmdc:mga09592_150_c1 nmdc:mga09592_150_c1_46200_47066 288
599 3300050509 nmdc:mga0qj67_20035_c1 nmdc:mga0qj67_20035_c1_19_900 288
600 3300050509 nmdc:mga0qj67_623_c1 nmdc:mga0qj67_623_c1_12005_12886 288
601 3300050510 nmdc:mga06r32_113730_c1 nmdc:mga06r32_113730_c1_1035_1901 288
602 3300050510 nmdc:mga06r32_187461_c1 nmdc:mga06r32_187461_c1_677_1573 288
603 3300050511 nmdc:mga08y16_30907_c1 nmdc:mga08y16_30907_c1_2440_3306 288
604 3300053077 Ga0495601_0005497 Ga0495601_0005497_3139_4008 288
605 3300053077 Ga0495601_0083732 Ga0495601_0083732_35_925 288
606 3300053094 Ga0500566_0122685 Ga0500566_0122685_384_1253 288
607 3300059426 Ga0590077_004080 Ga0590077_004080_566_1456 288
608 3300061734 Ga0530510_0284777 Ga0530510_0284777_91_960 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

46

268

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g2w-assembly1.cif.gz_B e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase 0.9647 2 273
4daa-assembly1.cif.gz_A crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form 0.9637 2 273
2dab-assembly1.cif.gz_A l201a mutant of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate 0.9637 2 273
5daa-assembly1.cif.gz_B e177k mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate 0.9626 2 273
4tm5-assembly1.cif.gz_A-2 x-ray crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 bound to the co-factor pyridoxal phosphate 0.9572 2 277
ID Description Score Start End Superfamily
3lqsA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.974 120 273 3.20.10.10
4pbcB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9701 147 281 3.20.10.10
4m0jB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9614 117 277 3.20.10.10
4m0jB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9426 117 277 3.20.10.10
1a0gA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9409 2 115 3.30.470.10
ID Description Score Start End GO Terms
AF-C6XB07-F1-model_v4 Aminotransferase class IV 0.9834 2 281 GO:0005829
GO:0008483
GO:0046394
AF-A0A6L5JYQ8-F1-model_v4 D-amino acid aminotransferase 0.9816 2 281 GO:0005829
GO:0008483
GO:0046394
AF-A0A839A0U5-F1-model_v4 deleted 0.9811 2 283
AF-A0A4Y1Z9P1-F1-model_v4 D-alanine aminotransferase (EC 2.6.1.21) 0.9799 132 279 GO:0005829
GO:0046394
GO:0047810
AF-A0A1E4PQV2-F1-model_v4 deleted 0.9788 40 280

Feature Viewer

pLDDT pTM Quality
93.2 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map