F468784
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 608 | 282 | 608 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10007998|Ga0157380_100079984 |
| Length | 303 |
| Sequence | VTNRLVRFEEMTMAEQQQIVYLNGELIPLGEAKVSVLDRGFIYGDGVYELVPVYARQLFRLEHHLRRLQHSLAGIGLATPMSPTQWESTIRALVARQPFDDQGVYLQVTRGVAKRDHAFPAGVAPTVFMMSNPLALPSREQVERGVAVVTADDNRWRRCDLKTTSLLGNVLMRQFAVENDAVETVMFRDGMLTEASASNVLVVIGGVVIAPPKDNLILPGITMDATFEFARDAGLSCEMRPVTKAEALAADEMWLSSSSKEVLAVTRVDGRAFGGGAPGPVFRRMWAEFQARRPRAAVAAGVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 194 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 211 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 213 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 214 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 215 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 216 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 281 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 282 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0 |
| Rhizoplane | 2.47 |
| Rhizosphere | 97.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10108281 | 3300005295 | Bacteria | 2516 |
| 2 | Ga0065707_10251239 | 3300005295 | Bacteria | 1115 |
| 3 | Ga0070676_10001948 | 3300005328 | Bacteria | 10502 |
| 4 | Ga0070676_10093948 | 3300005328 | Bacteria | 1842 |
| 5 | Ga0070676_10235796 | 3300005328 | Bacteria | 1215 |
| 6 | Ga0070683_100045484 | 3300005329 | Bacteria | 4051 |
| 7 | Ga0070683_100098767 | 3300005329 | Bacteria | 2747 |
| 8 | Ga0070690_100002869 | 3300005330 | Bacteria | 9295 |
| 9 | Ga0070690_100193293 | 3300005330 | Unclassified | 1412 |
| 10 | Ga0070690_100402209 | 3300005330 | Bacteria | 1006 |
| 11 | Ga0070670_100003760 | 3300005331 | Bacteria | 12633 |
| 12 | Ga0070670_100020212 | 3300005331 | Bacteria | 5721 |
| 13 | Ga0070670_100023997 | 3300005331 | Bacteria | 5247 |
| 14 | Ga0070670_100044539 | 3300005331 | Bacteria | 3815 |
| 15 | Ga0070670_100175821 | 3300005331 | Bacteria | 1858 |
| 16 | Ga0070677_10026492 | 3300005333 | Bacteria | 2174 |
| 17 | Ga0068869_100002327 | 3300005334 | Bacteria | 11433 |
| 18 | Ga0068869_100008953 | 3300005334 | Bacteria | 6480 |
| 19 | Ga0068869_100029310 | 3300005334 | Bacteria | 3855 |
| 20 | Ga0068869_100118177 | 3300005334 | Bacteria | 2025 |
| 21 | Ga0068869_100229020 | 3300005334 | Bacteria | 1476 |
| 22 | Ga0070666_10000816 | 3300005335 | Bacteria | 18906 |
| 23 | Ga0070666_10010730 | 3300005335 | Bacteria | 5732 |
| 24 | Ga0070666_10013432 | 3300005335 | Bacteria | 5196 |
| 25 | Ga0070680_100036078 | 3300005336 | Bacteria | 3994 |
| 26 | Ga0070680_100045898 | 3300005336 | Bacteria | 3553 |
| 27 | Ga0068868_100010780 | 3300005338 | Bacteria | 6628 |
| 28 | Ga0068868_100023100 | 3300005338 | Bacteria | 4703 |
| 29 | Ga0068868_100032040 | 3300005338 | Bacteria | 4041 |
| 30 | Ga0070660_100413139 | 3300005339 | Bacteria | 1117 |
| 31 | Ga0070689_100020757 | 3300005340 | Bacteria | 4879 |
| 32 | Ga0070689_100029842 | 3300005340 | Bacteria | 4134 |
| 33 | Ga0070689_100080660 | 3300005340 | Bacteria | 2554 |
| 34 | Ga0070689_100120950 | 3300005340 | Bacteria | 2091 |
| 35 | Ga0070689_100342332 | 3300005340 | Bacteria | 1252 |
| 36 | Ga0070687_100320358 | 3300005343 | Bacteria | 990 |
| 37 | Ga0070692_10153622 | 3300005345 | Bacteria | 1313 |
| 38 | Ga0070668_100002425 | 3300005347 | Bacteria | 13715 |
| 39 | Ga0070668_100002584 | 3300005347 | Bacteria | 13305 |
| 40 | Ga0070668_100004081 | 3300005347 | Bacteria | 10812 |
| 41 | Ga0070668_100104800 | 3300005347 | Bacteria | 2245 |
| 42 | Ga0070668_100247837 | 3300005347 | Bacteria | 1478 |
| 43 | Ga0070669_100001114 | 3300005353 | Bacteria | 19625 |
| 44 | Ga0070669_100035416 | 3300005353 | Bacteria | 3616 |
| 45 | Ga0070675_100003508 | 3300005354 | Bacteria | 11895 |
| 46 | Ga0070675_100004648 | 3300005354 | Bacteria | 10483 |
| 47 | Ga0070675_100008431 | 3300005354 | Bacteria | 7999 |
| 48 | Ga0070675_100012798 | 3300005354 | Bacteria | 6583 |
| 49 | Ga0070675_100030522 | 3300005354 | Bacteria | 4352 |
| 50 | Ga0070675_100094313 | 3300005354 | Bacteria | 2511 |
| 51 | Ga0070675_100206915 | 3300005354 | Bacteria | 1705 |
| 52 | Ga0070671_100008929 | 3300005355 | Bacteria | 8043 |
| 53 | Ga0070671_100012399 | 3300005355 | Bacteria | 6865 |
| 54 | Ga0070671_100052153 | 3300005355 | Bacteria | 3402 |
| 55 | Ga0070671_100236369 | 3300005355 | Bacteria | 1551 |
| 56 | Ga0070674_100000236 | 3300005356 | Bacteria | 27276 |
| 57 | Ga0070674_100006028 | 3300005356 | Bacteria | 7044 |
| 58 | Ga0070674_100023304 | 3300005356 | Bacteria | 4005 |
| 59 | Ga0070674_100026075 | 3300005356 | Bacteria | 3813 |
| 60 | Ga0070674_100079709 | 3300005356 | Bacteria | 2337 |
| 61 | Ga0070673_100001162 | 3300005364 | Bacteria | 15124 |
| 62 | Ga0070673_100001337 | 3300005364 | Bacteria | 14365 |
| 63 | Ga0070673_100003476 | 3300005364 | Bacteria | 9809 |
| 64 | Ga0070673_100036692 | 3300005364 | Bacteria | 3728 |
| 65 | Ga0070673_100113604 | 3300005364 | Bacteria | 2249 |
| 66 | Ga0070688_100002648 | 3300005365 | Bacteria | 9085 |
| 67 | Ga0070688_100089058 | 3300005365 | Bacteria | 2013 |
| 68 | Ga0070667_100006712 | 3300005367 | Bacteria | 9563 |
| 69 | Ga0070667_100008845 | 3300005367 | Bacteria | 8336 |
| 70 | Ga0070667_100204993 | 3300005367 | Bacteria | 1751 |
| 71 | Ga0070667_100259025 | 3300005367 | Bacteria | 1557 |
| 72 | Ga0070714_100006057 | 3300005435 | Bacteria | 9285 |
| 73 | Ga0070714_100069918 | 3300005435 | Bacteria | 3033 |
| 74 | Ga0070713_100000114 | 3300005436 | Bacteria | 52713 |
| 75 | Ga0070713_100059822 | 3300005436 | Bacteria | 3183 |
| 76 | Ga0070710_10009952 | 3300005437 | Bacteria | 4661 |
| 77 | Ga0070710_10273250 | 3300005437 | Bacteria | 1094 |
| 78 | Ga0070711_100003858 | 3300005439 | Bacteria | 8799 |
| 79 | Ga0070711_100071113 | 3300005439 | Bacteria | 2451 |
| 80 | Ga0070694_100004678 | 3300005444 | Bacteria | 8237 |
| 81 | Ga0070694_100203860 | 3300005444 | Bacteria | 1475 |
| 82 | Ga0070694_100326779 | 3300005444 | Bacteria | 1182 |
| 83 | Ga0070708_100002053 | 3300005445 | Bacteria | 15521 |
| 84 | Ga0070708_100051904 | 3300005445 | Bacteria | 3634 |
| 85 | Ga0070708_100589878 | 3300005445 | Bacteria | 1048 |
| 86 | Ga0070663_100085802 | 3300005455 | Bacteria | 2324 |
| 87 | Ga0070663_100238267 | 3300005455 | Bacteria | 1435 |
| 88 | Ga0070678_100000447 | 3300005456 | Bacteria | 19565 |
| 89 | Ga0070678_100004752 | 3300005456 | Bacteria | 7746 |
| 90 | Ga0070678_100036592 | 3300005456 | Bacteria | 3437 |
| 91 | Ga0070678_100425627 | 3300005456 | Bacteria | 1158 |
| 92 | Ga0070662_100319583 | 3300005457 | Bacteria | 1266 |
| 93 | Ga0070681_10004051 | 3300005458 | Bacteria | 13833 |
| 94 | Ga0070681_10041698 | 3300005458 | Bacteria | 4601 |
| 95 | Ga0068867_100001541 | 3300005459 | Bacteria | 16000 |
| 96 | Ga0068867_100002023 | 3300005459 | Bacteria | 14178 |
| 97 | Ga0068867_100016105 | 3300005459 | Bacteria | 5309 |
| 98 | Ga0070685_10001360 | 3300005466 | Bacteria | 12832 |
| 99 | Ga0070685_10029391 | 3300005466 | Bacteria | 3053 |
| 100 | Ga0070706_100181600 | 3300005467 | Bacteria | 1964 |
| 101 | Ga0070707_100033339 | 3300005468 | Bacteria | 4911 |
| 102 | Ga0070707_100037001 | 3300005468 | Bacteria | 4657 |
| 103 | Ga0070707_100299977 | 3300005468 | Bacteria | 1561 |
| 104 | Ga0070698_100045367 | 3300005471 | Bacteria | 4499 |
| 105 | Ga0070698_100101567 | 3300005471 | Bacteria | 2847 |
| 106 | Ga0070698_100151474 | 3300005471 | Bacteria | 2267 |
| 107 | Ga0070698_100177912 | 3300005471 | Bacteria | 2066 |
| 108 | Ga0070699_100138676 | 3300005518 | Bacteria | 2146 |
| 109 | Ga0070699_100189541 | 3300005518 | Bacteria | 1826 |
| 110 | Ga0070699_100254034 | 3300005518 | Bacteria | 1571 |
| 111 | Ga0070699_100258735 | 3300005518 | Bacteria | 1556 |
| 112 | Ga0070679_100010697 | 3300005530 | Bacteria | 8709 |
| 113 | Ga0070679_100468983 | 3300005530 | Bacteria | 1203 |
| 114 | Ga0070684_100013383 | 3300005535 | Bacteria | 6613 |
| 115 | Ga0070684_100093302 | 3300005535 | Bacteria | 2679 |
| 116 | Ga0070697_100013851 | 3300005536 | Bacteria | 6328 |
| 117 | Ga0070697_100379527 | 3300005536 | Bacteria | 1224 |
| 118 | Ga0068853_100000689 | 3300005539 | Bacteria | 23316 |
| 119 | Ga0068853_100077060 | 3300005539 | Bacteria | 2912 |
| 120 | Ga0070672_100061540 | 3300005543 | Bacteria | 2960 |
| 121 | Ga0070672_100077909 | 3300005543 | Bacteria | 2651 |
| 122 | Ga0070672_100078858 | 3300005543 | Bacteria | 2635 |
| 123 | Ga0070686_100109330 | 3300005544 | Bacteria | 1881 |
| 124 | Ga0070695_100007172 | 3300005545 | Bacteria | 6610 |
| 125 | Ga0070695_100342865 | 3300005545 | Unclassified | 1117 |
| 126 | Ga0070695_100502949 | 3300005545 | Unclassified | 938 |
| 127 | Ga0070696_100071277 | 3300005546 | Bacteria | 2445 |
| 128 | Ga0070696_100081818 | 3300005546 | Bacteria | 2288 |
| 129 | Ga0070696_100388414 | 3300005546 | Bacteria | 1089 |
| 130 | Ga0070693_100006610 | 3300005547 | Bacteria | 5628 |
| 131 | Ga0070693_100010305 | 3300005547 | Bacteria | 4679 |
| 132 | Ga0070693_100107936 | 3300005547 | Bacteria | 1707 |
| 133 | Ga0070665_100002874 | 3300005548 | Bacteria | 18606 |
| 134 | Ga0070665_100007383 | 3300005548 | Bacteria | 11183 |
| 135 | Ga0070665_100010734 | 3300005548 | Bacteria | 9267 |
| 136 | Ga0070704_100001327 | 3300005549 | Bacteria | 13101 |
| 137 | Ga0070704_100019944 | 3300005549 | Bacteria | 4314 |
| 138 | Ga0068855_100028779 | 3300005563 | Bacteria | 6647 |
| 139 | Ga0068857_100149944 | 3300005577 | Bacteria | 2112 |
| 140 | Ga0068854_100102089 | 3300005578 | Unclassified | 2151 |
| 141 | Ga0068854_100132321 | 3300005578 | Bacteria | 1906 |
| 142 | Ga0068854_100330656 | 3300005578 | Bacteria | 1241 |
| 143 | Ga0068856_100004914 | 3300005614 | Bacteria | 13229 |
| 144 | Ga0068856_100076866 | 3300005614 | Bacteria | 3307 |
| 145 | Ga0070702_100031314 | 3300005615 | Bacteria | 2908 |
| 146 | Ga0070702_100075566 | 3300005615 | Bacteria | 2003 |
| 147 | Ga0070702_100101990 | 3300005615 | Bacteria | 1762 |
| 148 | Ga0068852_100007280 | 3300005616 | Bacteria | 8069 |
| 149 | Ga0068852_100026753 | 3300005616 | Bacteria | 4694 |
| 150 | Ga0068852_100240044 | 3300005616 | Bacteria | 1731 |
| 151 | Ga0068859_100001172 | 3300005617 | Bacteria | 26797 |
| 152 | Ga0068859_100007142 | 3300005617 | Bacteria | 11338 |
| 153 | Ga0068859_100037393 | 3300005617 | Bacteria | 4871 |
| 154 | Ga0068859_100077083 | 3300005617 | Bacteria | 3374 |
| 155 | Ga0068859_100268841 | 3300005617 | Bacteria | 1797 |
| 156 | Ga0068859_100409592 | 3300005617 | Bacteria | 1452 |
| 157 | Ga0068864_100002663 | 3300005618 | Bacteria | 14746 |
| 158 | Ga0068864_100006458 | 3300005618 | Bacteria | 9605 |
| 159 | Ga0068864_100011915 | 3300005618 | Bacteria | 7182 |
| 160 | Ga0068864_100017297 | 3300005618 | Bacteria | 6009 |
| 161 | Ga0068864_100048253 | 3300005618 | Bacteria | 3660 |
| 162 | Ga0068864_100053038 | 3300005618 | Bacteria | 3497 |
| 163 | Ga0068864_100082993 | 3300005618 | Bacteria | 2813 |
| 164 | Ga0068864_100188438 | 3300005618 | Bacteria | 1890 |
| 165 | Ga0068866_10001452 | 3300005718 | Bacteria | 10132 |
| 166 | Ga0068866_10055564 | 3300005718 | Bacteria | 2034 |
| 167 | Ga0068866_10129509 | 3300005718 | Bacteria | 1433 |
| 168 | Ga0068861_100073760 | 3300005719 | Bacteria | 2652 |
| 169 | Ga0068851_10001073 | 3300005834 | Bacteria | 11839 |
| 170 | Ga0068851_10008538 | 3300005834 | Bacteria | 4740 |
| 171 | Ga0068851_10222347 | 3300005834 | Bacteria | 1061 |
| 172 | Ga0068870_10001220 | 3300005840 | Bacteria | 10345 |
| 173 | Ga0068870_10196464 | 3300005840 | Unclassified | 1220 |
| 174 | Ga0068863_100002857 | 3300005841 | Bacteria | 17111 |
| 175 | Ga0068863_100009074 | 3300005841 | Bacteria | 9712 |
| 176 | Ga0068863_100044347 | 3300005841 | Bacteria | 4221 |
| 177 | Ga0068863_100056480 | 3300005841 | Bacteria | 3716 |
| 178 | Ga0068863_100084840 | 3300005841 | Bacteria | 3001 |
| 179 | Ga0068863_100086214 | 3300005841 | Bacteria | 2975 |
| 180 | Ga0068863_100194706 | 3300005841 | Bacteria | 1949 |
| 181 | Ga0068863_100337045 | 3300005841 | Bacteria | 1467 |
| 182 | Ga0068858_100003418 | 3300005842 | Bacteria | 15791 |
| 183 | Ga0068858_100032683 | 3300005842 | Bacteria | 4831 |
| 184 | Ga0068858_100081612 | 3300005842 | Bacteria | 3005 |
| 185 | Ga0068858_100105223 | 3300005842 | Bacteria | 2633 |
| 186 | Ga0068858_100122180 | 3300005842 | Bacteria | 2436 |
| 187 | Ga0068858_100149812 | 3300005842 | Bacteria | 2193 |
| 188 | Ga0068860_100016447 | 3300005843 | Bacteria | 7212 |
| 189 | Ga0068860_100025511 | 3300005843 | Bacteria | 5702 |
| 190 | Ga0068860_100028894 | 3300005843 | Bacteria | 5335 |
| 191 | Ga0068860_100029246 | 3300005843 | Bacteria | 5299 |
| 192 | Ga0068860_100134539 | 3300005843 | Bacteria | 2374 |
| 193 | Ga0068862_100015687 | 3300005844 | Bacteria | 6296 |
| 194 | Ga0068862_100031529 | 3300005844 | Bacteria | 4475 |
| 195 | Ga0068862_100041628 | 3300005844 | Bacteria | 3909 |
| 196 | Ga0068862_100085113 | 3300005844 | Bacteria | 2748 |
| 197 | Ga0068862_100185362 | 3300005844 | Bacteria | 1870 |
| 198 | Ga0068862_100569074 | 3300005844 | Bacteria | 1084 |
| 199 | Ga0070715_10003865 | 3300006163 | Bacteria | 4839 |
| 200 | Ga0070716_100018313 | 3300006173 | Bacteria | 3646 |
| 201 | Ga0070712_100051723 | 3300006175 | Bacteria | 2862 |
| 202 | Ga0097621_100005645 | 3300006237 | Bacteria | 8826 |
| 203 | Ga0097621_100009563 | 3300006237 | Bacteria | 7046 |
| 204 | Ga0097621_100094791 | 3300006237 | Bacteria | 2503 |
| 205 | Ga0097621_100100361 | 3300006237 | Bacteria | 2435 |
| 206 | Ga0068871_100000551 | 3300006358 | Bacteria | 25532 |
| 207 | Ga0068871_100003069 | 3300006358 | Bacteria | 11453 |
| 208 | Ga0068871_100050549 | 3300006358 | Bacteria | 3363 |
| 209 | Ga0068871_100086899 | 3300006358 | Bacteria | 2599 |
| 210 | Ga0068871_100163861 | 3300006358 | Bacteria | 1902 |
| 211 | Ga0068871_100259275 | 3300006358 | Bacteria | 1516 |
| 212 | Ga0075428_100080658 | 3300006844 | Bacteria | 3551 |
| 213 | Ga0075428_100108012 | 3300006844 | Bacteria | 3033 |
| 214 | Ga0075430_100000550 | 3300006846 | Bacteria | 28484 |
| 215 | Ga0075430_100007696 | 3300006846 | Bacteria | 9098 |
| 216 | Ga0075431_100005396 | 3300006847 | Bacteria | 12626 |
| 217 | Ga0075431_100242110 | 3300006847 | Bacteria | 1835 |
| 218 | Ga0075433_10030502 | 3300006852 | Bacteria | 4601 |
| 219 | Ga0075433_10068886 | 3300006852 | Bacteria | 3107 |
| 220 | Ga0075434_100021939 | 3300006871 | Bacteria | 6214 |
| 221 | Ga0075429_100000511 | 3300006880 | Bacteria | 29379 |
| 222 | Ga0075429_100039718 | 3300006880 | Bacteria | 4095 |
| 223 | Ga0068865_100003205 | 3300006881 | Bacteria | 9800 |
| 224 | Ga0068865_100055704 | 3300006881 | Bacteria | 2752 |
| 225 | Ga0068865_100074777 | 3300006881 | Bacteria | 2414 |
| 226 | Ga0068865_100261117 | 3300006881 | Bacteria | 1371 |
| 227 | Ga0075436_100035610 | 3300006914 | Bacteria | 3433 |
| 228 | Ga0097620_100001172 | 3300006931 | Bacteria | 26797 |
| 229 | Ga0097620_100007142 | 3300006931 | Bacteria | 11338 |
| 230 | Ga0097620_100037393 | 3300006931 | Bacteria | 4871 |
| 231 | Ga0097620_100077081 | 3300006931 | Bacteria | 3374 |
| 232 | Ga0097620_100268828 | 3300006931 | Bacteria | 1797 |
| 233 | Ga0097620_100409611 | 3300006931 | Bacteria | 1452 |
| 234 | Ga0075435_100008207 | 3300007076 | Bacteria | 7481 |
| 235 | Ga0099794_10015782 | 3300007265 | Bacteria | 3340 |
| 236 | Ga0099794_10154035 | 3300007265 | Bacteria | 1167 |
| 237 | Ga0105240_10007422 | 3300009093 | Bacteria | 15928 |
| 238 | Ga0111539_10013382 | 3300009094 | Bacteria | 10256 |
| 239 | Ga0111539_10070916 | 3300009094 | Bacteria | 4112 |
| 240 | Ga0105245_10055737 | 3300009098 | Bacteria | 3551 |
| 241 | Ga0105245_10129621 | 3300009098 | Bacteria | 2365 |
| 242 | Ga0105247_10010369 | 3300009101 | Bacteria | 5637 |
| 243 | Ga0114129_10068810 | 3300009147 | Bacteria | 4935 |
| 244 | Ga0105241_10227580 | 3300009174 | Bacteria | 1571 |
| 245 | Ga0105242_10001782 | 3300009176 | Bacteria | 16996 |
| 246 | Ga0105242_10041480 | 3300009176 | Bacteria | 3713 |
| 247 | Ga0105242_10222964 | 3300009176 | Bacteria | 1686 |
| 248 | Ga0105248_10002637 | 3300009177 | Bacteria | 19937 |
| 249 | Ga0105248_10198693 | 3300009177 | Bacteria | 2259 |
| 250 | Ga0105248_10414506 | 3300009177 | Bacteria | 1517 |
| 251 | Ga0105248_10688705 | 3300009177 | Bacteria | 1153 |
| 252 | Ga0105237_10147303 | 3300009545 | Bacteria | 2349 |
| 253 | Ga0105249_10049577 | 3300009553 | Bacteria | 3829 |
| 254 | Ga0105249_10057803 | 3300009553 | Bacteria | 3554 |
| 255 | Ga0105239_10301624 | 3300010375 | Bacteria | 1804 |
| 256 | Ga0105239_10604944 | 3300010375 | Unclassified | 1250 |
| 257 | Ga0105246_10304059 | 3300011119 | Unclassified | 1289 |
| 258 | Ga0157370_10007918 | 3300013104 | Bacteria | 11509 |
| 259 | Ga0157370_10025283 | 3300013104 | Bacteria | 5878 |
| 260 | Ga0157369_10045838 | 3300013105 | Bacteria | 4753 |
| 261 | Ga0157374_10000596 | 3300013296 | Bacteria | 32001 |
| 262 | Ga0157374_10003531 | 3300013296 | Bacteria | 13155 |
| 263 | Ga0157374_10582507 | 3300013296 | Bacteria | 1128 |
| 264 | Ga0157378_10043444 | 3300013297 | Bacteria | 3990 |
| 265 | Ga0157378_10117962 | 3300013297 | Bacteria | 2442 |
| 266 | Ga0163162_10000806 | 3300013306 | Bacteria | 29097 |
| 267 | Ga0163162_10109941 | 3300013306 | Bacteria | 2853 |
| 268 | Ga0163162_10121295 | 3300013306 | Bacteria | 2719 |
| 269 | Ga0157372_10002331 | 3300013307 | Bacteria | 20579 |
| 270 | Ga0157372_10027510 | 3300013307 | Bacteria | 6195 |
| 271 | Ga0157372_10071265 | 3300013307 | Bacteria | 3913 |
| 272 | Ga0157372_10160040 | 3300013307 | Bacteria | 2602 |
| 273 | Ga0157375_10003811 | 3300013308 | Bacteria | 13072 |
| 274 | Ga0157375_10014883 | 3300013308 | Bacteria | 6953 |
| 275 | Ga0157375_10094115 | 3300013308 | Bacteria | 3064 |
| 276 | Ga0157375_10359397 | 3300013308 | Bacteria | 1622 |
| 277 | Ga0163163_10004542 | 3300014325 | Bacteria | 11854 |
| 278 | Ga0163163_10011269 | 3300014325 | Bacteria | 8102 |
| 279 | Ga0163163_10013670 | 3300014325 | Bacteria | 7436 |
| 280 | Ga0157380_10007998 | 3300014326 | Bacteria | 7532 |
| 281 | Ga0157380_10025621 | 3300014326 | Bacteria | 4473 |
| 282 | Ga0157380_10069279 | 3300014326 | Bacteria | 2846 |
| 283 | Ga0157380_10216133 | 3300014326 | Unclassified | 1712 |
| 284 | Ga0157377_10268125 | 3300014745 | Bacteria | 1114 |
| 285 | Ga0157379_10003325 | 3300014968 | Bacteria | 13621 |
| 286 | Ga0157379_10009604 | 3300014968 | Bacteria | 8424 |
| 287 | Ga0157376_10019433 | 3300014969 | Bacteria | 5236 |
| 288 | Ga0157376_10042432 | 3300014969 | Bacteria | 3728 |
| 289 | Ga0157376_10061004 | 3300014969 | Bacteria | 3169 |
| 290 | Ga0207697_10003081 | 3300025315 | Bacteria | 8353 |
| 291 | Ga0207656_10001807 | 3300025321 | Bacteria | 7116 |
| 292 | Ga0207656_10063164 | 3300025321 | Bacteria | 1629 |
| 293 | Ga0207653_10065008 | 3300025885 | Bacteria | 1238 |
| 294 | Ga0207682_10000242 | 3300025893 | Bacteria | 24724 |
| 295 | Ga0207682_10002765 | 3300025893 | Bacteria | 7773 |
| 296 | Ga0207682_10048977 | 3300025893 | Bacteria | 1743 |
| 297 | Ga0207692_10012700 | 3300025898 | Bacteria | 3625 |
| 298 | Ga0207642_10022010 | 3300025899 | Bacteria | 2520 |
| 299 | Ga0207642_10090296 | 3300025899 | Unclassified | 1511 |
| 300 | Ga0207710_10028460 | 3300025900 | Bacteria | 2426 |
| 301 | Ga0207680_10002437 | 3300025903 | Bacteria | 8677 |
| 302 | Ga0207680_10008730 | 3300025903 | Bacteria | 4991 |
| 303 | Ga0207680_10015307 | 3300025903 | Bacteria | 4000 |
| 304 | Ga0207685_10005534 | 3300025905 | Bacteria | 3345 |
| 305 | Ga0207699_10056467 | 3300025906 | Bacteria | 2340 |
| 306 | Ga0207645_10001123 | 3300025907 | Bacteria | 22130 |
| 307 | Ga0207645_10002011 | 3300025907 | Bacteria | 16329 |
| 308 | Ga0207645_10031886 | 3300025907 | Bacteria | 3388 |
| 309 | Ga0207645_10049460 | 3300025907 | Bacteria | 2684 |
| 310 | Ga0207643_10005469 | 3300025908 | Bacteria | 6792 |
| 311 | Ga0207643_10073500 | 3300025908 | Bacteria | 1971 |
| 312 | Ga0207643_10117297 | 3300025908 | Unclassified | 1573 |
| 313 | Ga0207705_10156517 | 3300025909 | Bacteria | 1710 |
| 314 | Ga0207684_10013573 | 3300025910 | Bacteria | 7042 |
| 315 | Ga0207684_10116171 | 3300025910 | Bacteria | 2292 |
| 316 | Ga0207654_10050973 | 3300025911 | Bacteria | 2381 |
| 317 | Ga0207707_10015357 | 3300025912 | Bacteria | 6668 |
| 318 | Ga0207695_10373661 | 3300025913 | Bacteria | 1312 |
| 319 | Ga0207693_10000104 | 3300025915 | Bacteria | 76023 |
| 320 | Ga0207693_10006353 | 3300025915 | Bacteria | 9793 |
| 321 | Ga0207660_10013758 | 3300025917 | Bacteria | 5310 |
| 322 | Ga0207662_10005874 | 3300025918 | Bacteria | 6582 |
| 323 | Ga0207662_10113794 | 3300025918 | Bacteria | 1690 |
| 324 | Ga0207662_10247088 | 3300025918 | Bacteria | 1170 |
| 325 | Ga0207657_10004654 | 3300025919 | Bacteria | 14496 |
| 326 | Ga0207657_10040315 | 3300025919 | Bacteria | 4139 |
| 327 | Ga0207652_10033282 | 3300025921 | Bacteria | 4339 |
| 328 | Ga0207652_10195804 | 3300025921 | Bacteria | 1818 |
| 329 | Ga0207646_10007938 | 3300025922 | Bacteria | 10710 |
| 330 | Ga0207646_10182159 | 3300025922 | Bacteria | 1897 |
| 331 | Ga0207681_10005369 | 3300025923 | Bacteria | 7872 |
| 332 | Ga0207681_10118862 | 3300025923 | Bacteria | 1935 |
| 333 | Ga0207650_10012311 | 3300025925 | Bacteria | 5903 |
| 334 | Ga0207650_10013289 | 3300025925 | Bacteria | 5698 |
| 335 | Ga0207650_10015751 | 3300025925 | Bacteria | 5271 |
| 336 | Ga0207650_10016853 | 3300025925 | Bacteria | 5110 |
| 337 | Ga0207650_10016873 | 3300025925 | Bacteria | 5107 |
| 338 | Ga0207650_10050645 | 3300025925 | Bacteria | 3072 |
| 339 | Ga0207650_10061370 | 3300025925 | Bacteria | 2807 |
| 340 | Ga0207650_10404466 | 3300025925 | Bacteria | 1130 |
| 341 | Ga0207659_10001235 | 3300025926 | Bacteria | 15308 |
| 342 | Ga0207659_10006236 | 3300025926 | Bacteria | 7294 |
| 343 | Ga0207659_10056912 | 3300025926 | Bacteria | 2801 |
| 344 | Ga0207659_10068777 | 3300025926 | Bacteria | 2577 |
| 345 | Ga0207687_10008617 | 3300025927 | Bacteria | 6670 |
| 346 | Ga0207687_10011741 | 3300025927 | Bacteria | 5731 |
| 347 | Ga0207687_10040880 | 3300025927 | Bacteria | 3181 |
| 348 | Ga0207700_10000018 | 3300025928 | Bacteria | 191007 |
| 349 | Ga0207664_10010626 | 3300025929 | Bacteria | 6506 |
| 350 | Ga0207664_10030822 | 3300025929 | Bacteria | 4099 |
| 351 | Ga0207644_10041489 | 3300025931 | Bacteria | 3255 |
| 352 | Ga0207644_10162009 | 3300025931 | Bacteria | 1739 |
| 353 | Ga0207644_10241578 | 3300025931 | Bacteria | 1438 |
| 354 | Ga0207690_10249038 | 3300025932 | Bacteria | 1372 |
| 355 | Ga0207706_10068189 | 3300025933 | Bacteria | 3130 |
| 356 | Ga0207686_10020882 | 3300025934 | Bacteria | 3749 |
| 357 | Ga0207686_10072370 | 3300025934 | Bacteria | 2221 |
| 358 | Ga0207709_10128144 | 3300025935 | Bacteria | 1725 |
| 359 | Ga0207670_10073666 | 3300025936 | Bacteria | 2368 |
| 360 | Ga0207670_10099090 | 3300025936 | Bacteria | 2078 |
| 361 | Ga0207670_10102691 | 3300025936 | Bacteria | 2045 |
| 362 | Ga0207670_10127750 | 3300025936 | Bacteria | 1857 |
| 363 | Ga0207669_10014976 | 3300025937 | Bacteria | 3900 |
| 364 | Ga0207669_10057677 | 3300025937 | Bacteria | 2365 |
| 365 | Ga0207669_10540084 | 3300025937 | Bacteria | 939 |
| 366 | Ga0207704_10006554 | 3300025938 | Bacteria | 5440 |
| 367 | Ga0207704_10006774 | 3300025938 | Bacteria | 5368 |
| 368 | Ga0207704_10097240 | 3300025938 | Bacteria | 1952 |
| 369 | Ga0207665_10033312 | 3300025939 | Bacteria | 3414 |
| 370 | Ga0207665_10082520 | 3300025939 | Bacteria | 2215 |
| 371 | Ga0207691_10000216 | 3300025940 | Bacteria | 55947 |
| 372 | Ga0207691_10000454 | 3300025940 | Bacteria | 40505 |
| 373 | Ga0207691_10001401 | 3300025940 | Bacteria | 24112 |
| 374 | Ga0207691_10023315 | 3300025940 | Bacteria | 5826 |
| 375 | Ga0207691_10023778 | 3300025940 | Bacteria | 5767 |
| 376 | Ga0207691_10078162 | 3300025940 | Bacteria | 2979 |
| 377 | Ga0207691_10190935 | 3300025940 | Bacteria | 1786 |
| 378 | Ga0207711_10000572 | 3300025941 | Bacteria | 37502 |
| 379 | Ga0207711_10003092 | 3300025941 | Bacteria | 14511 |
| 380 | Ga0207689_10000963 | 3300025942 | Bacteria | 27633 |
| 381 | Ga0207689_10006312 | 3300025942 | Bacteria | 10501 |
| 382 | Ga0207689_10055133 | 3300025942 | Bacteria | 3272 |
| 383 | Ga0207689_10259174 | 3300025942 | Bacteria | 1438 |
| 384 | Ga0207661_10125959 | 3300025944 | Bacteria | 2188 |
| 385 | Ga0207661_10634138 | 3300025944 | Unclassified | 982 |
| 386 | Ga0207679_10044939 | 3300025945 | Bacteria | 3191 |
| 387 | Ga0207679_10242841 | 3300025945 | Bacteria | 1527 |
| 388 | Ga0207667_10281976 | 3300025949 | Bacteria | 1698 |
| 389 | Ga0207651_10000642 | 3300025960 | Bacteria | 14819 |
| 390 | Ga0207651_10002919 | 3300025960 | Bacteria | 8260 |
| 391 | Ga0207651_10005325 | 3300025960 | Bacteria | 6594 |
| 392 | Ga0207651_10237981 | 3300025960 | Unclassified | 1482 |
| 393 | Ga0207712_10036789 | 3300025961 | Bacteria | 3336 |
| 394 | Ga0207668_10000894 | 3300025972 | Bacteria | 18003 |
| 395 | Ga0207668_10025686 | 3300025972 | Bacteria | 3814 |
| 396 | Ga0207668_10027692 | 3300025972 | Bacteria | 3695 |
| 397 | Ga0207668_10056834 | 3300025972 | Bacteria | 2727 |
| 398 | Ga0207640_10104584 | 3300025981 | Bacteria | 1993 |
| 399 | Ga0207640_10129810 | 3300025981 | Bacteria | 1820 |
| 400 | Ga0207658_10032283 | 3300025986 | Bacteria | 3725 |
| 401 | Ga0207658_10059694 | 3300025986 | Bacteria | 2842 |
| 402 | Ga0207658_10101393 | 3300025986 | Bacteria | 2256 |
| 403 | Ga0207658_10121416 | 3300025986 | Bacteria | 2084 |
| 404 | Ga0207658_10151167 | 3300025986 | Bacteria | 1892 |
| 405 | Ga0207658_10242326 | 3300025986 | Bacteria | 1528 |
| 406 | Ga0207677_10000469 | 3300026023 | Bacteria | 26525 |
| 407 | Ga0207677_10001861 | 3300026023 | Bacteria | 11157 |
| 408 | Ga0207677_10120424 | 3300026023 | Bacteria | 1973 |
| 409 | Ga0207677_10253544 | 3300026023 | Bacteria | 1430 |
| 410 | Ga0207703_10002876 | 3300026035 | Bacteria | 14649 |
| 411 | Ga0207703_10009883 | 3300026035 | Bacteria | 7485 |
| 412 | Ga0207703_10093198 | 3300026035 | Bacteria | 2536 |
| 413 | Ga0207703_10105239 | 3300026035 | Bacteria | 2398 |
| 414 | Ga0207703_10126170 | 3300026035 | Bacteria | 2204 |
| 415 | Ga0207639_10009864 | 3300026041 | Bacteria | 6596 |
| 416 | Ga0207678_10031271 | 3300026067 | Bacteria | 4644 |
| 417 | Ga0207678_10272642 | 3300026067 | Bacteria | 1451 |
| 418 | Ga0207708_10053128 | 3300026075 | Bacteria | 3086 |
| 419 | Ga0207702_10035970 | 3300026078 | Bacteria | 4141 |
| 420 | Ga0207702_10093771 | 3300026078 | Bacteria | 2634 |
| 421 | Ga0207702_10287987 | 3300026078 | Bacteria | 1555 |
| 422 | Ga0207641_10008544 | 3300026088 | Bacteria | 8457 |
| 423 | Ga0207641_10012275 | 3300026088 | Bacteria | 7029 |
| 424 | Ga0207641_10063674 | 3300026088 | Bacteria | 3150 |
| 425 | Ga0207641_10117374 | 3300026088 | Bacteria | 2369 |
| 426 | Ga0207641_10446741 | 3300026088 | Bacteria | 1249 |
| 427 | Ga0207648_10000763 | 3300026089 | Bacteria | 36138 |
| 428 | Ga0207648_10000829 | 3300026089 | Bacteria | 34794 |
| 429 | Ga0207648_10020296 | 3300026089 | Bacteria | 5986 |
| 430 | Ga0207648_10030919 | 3300026089 | Bacteria | 4737 |
| 431 | Ga0207676_10002530 | 3300026095 | Bacteria | 13039 |
| 432 | Ga0207676_10002692 | 3300026095 | Bacteria | 12633 |
| 433 | Ga0207676_10023341 | 3300026095 | Bacteria | 4562 |
| 434 | Ga0207674_10105497 | 3300026116 | Bacteria | 2796 |
| 435 | Ga0207674_10118474 | 3300026116 | Bacteria | 2618 |
| 436 | Ga0207675_100024243 | 3300026118 | Bacteria | 5642 |
| 437 | Ga0207675_100086145 | 3300026118 | Bacteria | 2950 |
| 438 | Ga0207675_100127694 | 3300026118 | Bacteria | 2409 |
| 439 | Ga0207675_100144068 | 3300026118 | Bacteria | 2265 |
| 440 | Ga0207675_100147753 | 3300026118 | Bacteria | 2236 |
| 441 | Ga0207675_100725849 | 3300026118 | Bacteria | 1004 |
| 442 | Ga0207683_10000401 | 3300026121 | Bacteria | 39796 |
| 443 | Ga0207683_10000705 | 3300026121 | Bacteria | 30486 |
| 444 | Ga0207683_10001133 | 3300026121 | Bacteria | 24266 |
| 445 | Ga0207683_10013560 | 3300026121 | Bacteria | 6953 |
| 446 | Ga0207698_10203015 | 3300026142 | Unclassified | 1777 |
| 447 | Ga0207698_10484738 | 3300026142 | Bacteria | 1200 |
| 448 | Ga0209969_1001086 | 3300027360 | Bacteria | 3731 |
| 449 | Ga0209981_1001444 | 3300027378 | Bacteria | 3001 |
| 450 | Ga0209996_1012158 | 3300027395 | Bacteria | 1155 |
| 451 | Ga0210000_1001892 | 3300027462 | Bacteria | 2958 |
| 452 | Ga0209995_1001597 | 3300027471 | Bacteria | 3511 |
| 453 | Ga0209968_1002375 | 3300027526 | Bacteria | 2843 |
| 454 | Ga0209983_1025328 | 3300027665 | Bacteria | 1251 |
| 455 | Ga0209971_1040499 | 3300027682 | Bacteria | 1121 |
| 456 | Ga0209966_1005660 | 3300027695 | Bacteria | 2148 |
| 457 | Ga0207428_10070921 | 3300027907 | Bacteria | 2737 |
| 458 | Ga0268266_10005748 | 3300028379 | Bacteria | 11481 |
| 459 | Ga0268266_10017606 | 3300028379 | Bacteria | 6093 |
| 460 | Ga0268265_10075945 | 3300028380 | Bacteria | 2634 |
| 461 | Ga0268264_10007810 | 3300028381 | Bacteria | 8902 |
| 462 | Ga0268264_10010411 | 3300028381 | Bacteria | 7688 |
| 463 | Ga0268264_10014615 | 3300028381 | Bacteria | 6450 |
| 464 | Ga0268264_10060412 | 3300028381 | Bacteria | 3177 |
| 465 | Ga0268264_10101663 | 3300028381 | Bacteria | 2499 |
| 466 | Ga0268264_10154146 | 3300028381 | Bacteria | 2063 |
| 467 | Ga0307408_100003640 | 3300031548 | Bacteria | 10503 |
| 468 | Ga0307405_10003582 | 3300031731 | Bacteria | 7170 |
| 469 | Ga0307413_10012513 | 3300031824 | Bacteria | 4226 |
| 470 | Ga0307410_10000615 | 3300031852 | Bacteria | 14669 |
| 471 | Ga0307406_10002939 | 3300031901 | Bacteria | 9279 |
| 472 | Ga0307407_10000267 | 3300031903 | Bacteria | 15354 |
| 473 | Ga0307412_10007003 | 3300031911 | Bacteria | 6400 |
| 474 | Ga0307412_10472663 | 3300031911 | Unclassified | 1038 |
| 475 | Ga0307409_100005162 | 3300031995 | Bacteria | 7465 |
| 476 | Ga0307416_100008868 | 3300032002 | Bacteria | 6529 |
| 477 | Ga0307414_10195151 | 3300032004 | Bacteria | 1642 |
| 478 | Ga0307411_10022388 | 3300032005 | Bacteria | 3719 |
| 479 | Ga0307415_100000721 | 3300032126 | Bacteria | 14812 |
| 480 | Ga0373938_0018515 | 3300034957 | Bacteria | 1382 |
| 481 | Ga0373934_0038382 | 3300035086 | Bacteria | 1886 |
| 482 | Ga0373923_0000205 | 3300035111 | Bacteria | 12151 |
| 483 | Ga0373953_0001394 | 3300035117 | Bacteria | 6962 |
| 484 | Ga0373953_0012794 | 3300035117 | Bacteria | 2980 |
| 485 | Ga0373954_0000002 | 3300035118 | Bacteria | 147478 |
| 486 | Ga0373954_0002022 | 3300035118 | Bacteria | 8424 |
| 487 | Ga0373957_0008010 | 3300035120 | Bacteria | 3406 |
| 488 | Ga0373946_0032003 | 3300035171 | Bacteria | 2110 |
| 489 | Ga0373955_0005365 | 3300035172 | Bacteria | 5755 |
| 490 | Ga0373955_0119781 | 3300035172 | Bacteria | 1529 |
| 491 | Ga0373924_0126983 | 3300035410 | Unclassified | 1108 |
| 492 | Ga0373931_0016875 | 3300035691 | Bacteria | 3601 |
| 493 | Ga0373931_0066765 | 3300035691 | Bacteria | 1953 |
| 494 | Ga0373935_0039146 | 3300035692 | Bacteria | 2971 |
| 495 | Ga0373935_0086357 | 3300035692 | Bacteria | 2047 |
| 496 | Ga0373935_0098112 | 3300035692 | Bacteria | 1928 |
| 497 | Ga0373927_0103290 | 3300035695 | Bacteria | 1854 |
| 498 | Ga0373933_0000657 | 3300035724 | Bacteria | 21450 |
| 499 | Ga0373933_0017492 | 3300035724 | Bacteria | 4021 |
| 500 | Ga0373947_0030883 | 3300035725 | Bacteria | 3150 |
| 501 | Ga0373947_0055504 | 3300035725 | Bacteria | 2392 |
| 502 | Ga0373937_0000358 | 3300036401 | Bacteria | 42468 |
| 503 | Ga0373937_0014725 | 3300036401 | Bacteria | 6904 |
| 504 | Ga0373937_0021545 | 3300036401 | Bacteria | 5784 |
| 505 | Ga0373937_0025596 | 3300036401 | Bacteria | 5329 |
| 506 | Ga0373937_0302335 | 3300036401 | Bacteria | 1512 |
| 507 | Ga0373925_0009867 | 3300037068 | Bacteria | 6937 |
| 508 | Ga0373925_0278958 | 3300037068 | Unclassified | 1345 |
| 509 | Ga0373925_0285317 | 3300037068 | Bacteria | 1330 |
| 510 | Ga0436365_0686227 | 3300039437 | Bacteria | 3590 |
| 511 | Ga0439461_0002213 | 3300041410 | Bacteria | 3086 |
| 512 | Ga0451807_1806802 | 3300041486 | Bacteria | 3040 |
| 513 | Ga0439431_0034581 | 3300041997 | Bacteria | 1267 |
| 514 | Ga0439441_000163 | 3300042001 | Bacteria | 5870 |
| 515 | Ga0439441_003222 | 3300042001 | Bacteria | 2384 |
| 516 | Ga0439446_0000176 | 3300042156 | Bacteria | 11244 |
| 517 | Ga0439434_0001633 | 3300042435 | Bacteria | 6483 |
| 518 | Ga0439435_0000026 | 3300042436 | Bacteria | 16073 |
| 519 | Ga0439435_0013765 | 3300042436 | Bacteria | 1986 |
| 520 | Ga0451577_0452460 | 3300042876 | Bacteria | 1166 |
| 521 | Ga0451576_0034631 | 3300045051 | Bacteria | 5362 |
| 522 | Ga0451576_0406890 | 3300045051 | Bacteria | 1427 |
| 523 | Ga0466967_0057018 | 3300045976 | Bacteria | 3447 |
| 524 | Ga0495592_0003821 | 3300046454 | Bacteria | 10887 |
| 525 | Ga0495592_0309309 | 3300046454 | Bacteria | 1025 |
| 526 | Ga0495603_0077020 | 3300046455 | Bacteria | 1957 |
| 527 | Ga0495653_0222837 | 3300046463 | Bacteria | 1267 |
| 528 | Ga0495580_0055990 | 3300046472 | Bacteria | 2777 |
| 529 | Ga0495580_0150064 | 3300046472 | Bacteria | 1615 |
| 530 | Ga0495580_0187079 | 3300046472 | Bacteria | 1429 |
| 531 | Ga0495582_0003693 | 3300046473 | Bacteria | 8618 |
| 532 | Ga0495662_0008976 | 3300046476 | Bacteria | 4910 |
| 533 | Ga0495662_0025122 | 3300046476 | Bacteria | 2876 |
| 534 | Ga0495662_0027173 | 3300046476 | Bacteria | 2765 |
| 535 | Ga0495594_0050679 | 3300046499 | Bacteria | 2284 |
| 536 | Ga0495608_0002044 | 3300046511 | Bacteria | 14501 |
| 537 | Ga0495618_0022560 | 3300046514 | Bacteria | 3888 |
| 538 | Ga0495628_0016487 | 3300046516 | Bacteria | 6161 |
| 539 | Ga0495630_0001185 | 3300046517 | Bacteria | 17975 |
| 540 | Ga0495630_0039270 | 3300046517 | Bacteria | 3540 |
| 541 | Ga0495652_0033401 | 3300046529 | Bacteria | 4491 |
| 542 | Ga0495665_0029121 | 3300046531 | Bacteria | 2959 |
| 543 | Ga0495640_0000808 | 3300046533 | Bacteria | 23777 |
| 544 | Ga0495640_0004665 | 3300046533 | Bacteria | 10928 |
| 545 | Ga0495586_0000440 | 3300046535 | Bacteria | 24985 |
| 546 | Ga0495621_0003552 | 3300046539 | Bacteria | 4302 |
| 547 | Ga0495645_0025778 | 3300046543 | Bacteria | 4268 |
| 548 | Ga0495667_0001153 | 3300046559 | Bacteria | 17225 |
| 549 | Ga0495634_0002587 | 3300046642 | Bacteria | 14917 |
| 550 | Ga0495634_0059578 | 3300046642 | Bacteria | 2543 |
| 551 | Ga0495635_0082244 | 3300046663 | Bacteria | 2203 |
| 552 | Ga0495659_0047479 | 3300046664 | Unclassified | 1553 |
| 553 | Ga0495623_0052380 | 3300046679 | Bacteria | 2579 |
| 554 | Ga0495658_0026403 | 3300046683 | Bacteria | 3112 |
| 555 | Ga0495613_0025295 | 3300046689 | Bacteria | 4423 |
| 556 | Ga0495613_0093433 | 3300046689 | Bacteria | 2177 |
| 557 | Ga0495624_0034028 | 3300046690 | Bacteria | 3299 |
| 558 | Ga0495600_0006681 | 3300046809 | Bacteria | 7029 |
| 559 | Ga0495604_0103336 | 3300047317 | Bacteria | 2090 |
| 560 | Ga0495674_0123030 | 3300047319 | Bacteria | 2191 |
| 561 | Ga0495674_0218376 | 3300047319 | Bacteria | 1577 |
| 562 | Ga0495680_0001572 | 3300047322 | Bacteria | 24459 |
| 563 | Ga0495680_0044568 | 3300047322 | Bacteria | 3507 |
| 564 | Ga0495684_0018458 | 3300047471 | Bacteria | 5374 |
| 565 | Ga0495593_0057647 | 3300047673 | Bacteria | 2039 |
| 566 | Ga0495602_0097632 | 3300048088 | Bacteria | 2420 |
| 567 | Ga0495614_0078529 | 3300048089 | Bacteria | 1428 |
| 568 | Ga0496101_0136489 | 3300048904 | Bacteria | 1867 |
| 569 | Ga0496103_0042137 | 3300048906 | Bacteria | 2808 |
| 570 | Ga0496104_0416490 | 3300048907 | Bacteria | 1256 |
| 571 | Ga0496105_0459561 | 3300048908 | Bacteria | 1004 |
| 572 | Ga0496106_0084317 | 3300048909 | Bacteria | 2445 |
| 573 | Ga0496108_0008141 | 3300048911 | Bacteria | 8503 |
| 574 | Ga0496108_0017069 | 3300048911 | Bacteria | 5935 |
| 575 | Ga0496109_0027634 | 3300048912 | Bacteria | 5069 |
| 576 | Ga0496109_0040364 | 3300048912 | Bacteria | 4227 |
| 577 | Ga0496109_0239075 | 3300048912 | Bacteria | 1709 |
| 578 | Ga0496112_0189653 | 3300048915 | Bacteria | 2018 |
| 579 | Ga0496114_0187853 | 3300048917 | Bacteria | 1807 |
| 580 | Ga0496114_0222221 | 3300048917 | Bacteria | 1658 |
| 581 | Ga0496115_0116217 | 3300048918 | Bacteria | 2200 |
| 582 | Ga0501040_0018725 | 3300049576 | Bacteria | 4599 |
| 583 | Ga0501040_0072432 | 3300049576 | Bacteria | 2380 |
| 584 | Ga0501048_0252032 | 3300049582 | Bacteria | 1253 |
| 585 | Ga0501068_0212842 | 3300049584 | Bacteria | 1228 |
| 586 | Ga0501074_0299992 | 3300049590 | Bacteria | 1141 |
| 587 | Ga0501079_0028118 | 3300049741 | Bacteria | 4314 |
| 588 | nmdc:mga05p37_209_c1 | 3300050507 | Bacteria | 59030 |
| 589 | nmdc:mga05p37_99504_c1 | 3300050507 | Bacteria | 3581 |
| 590 | nmdc:mga09592_150_c1 | 3300050508 | Bacteria | 47613 |
| 591 | nmdc:mga0qj67_20035_c1 | 3300050509 | Bacteria | 5118 |
| 592 | nmdc:mga0qj67_623_c1 | 3300050509 | Bacteria | 24285 |
| 593 | nmdc:mga06r32_113730_c1 | 3300050510 | Bacteria | 2664 |
| 594 | nmdc:mga06r32_187461_c1 | 3300050510 | Bacteria | 2056 |
| 595 | nmdc:mga08y16_30907_c1 | 3300050511 | Bacteria | 5631 |
| 596 | nmdc:mga0n895_14216_c1 | 3300050512 | Bacteria | 7219 |
| 597 | nmdc:mga0rr50_6927_c1 | 3300050513 | Bacteria | 6949 |
| 598 | nmdc:mga08x19_223567_c1 | 3300050514 | Bacteria | 1294 |
| 599 | nmdc:mga08x19_50596_c1 | 3300050514 | Bacteria | 2666 |
| 600 | nmdc:mga0a205_43040_c1 | 3300050515 | Bacteria | 4354 |
| 601 | Ga0495601_0005497 | 3300053077 | Bacteria | 7389 |
| 602 | Ga0495601_0083732 | 3300053077 | Bacteria | 2049 |
| 603 | Ga0495595_0045109 | 3300053084 | Bacteria | 2027 |
| 604 | Ga0495595_0073078 | 3300053084 | Bacteria | 1624 |
| 605 | Ga0495619_0009966 | 3300053085 | Bacteria | 5984 |
| 606 | Ga0500566_0122685 | 3300053094 | Bacteria | 1399 |
| 607 | Ga0590077_004080 | 3300059426 | Bacteria | 3007 |
| 608 | Ga0530510_0284777 | 3300061734 | Bacteria | 1235 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031911 | Ga0307412_10472663 | Ga0307412_104726631 | 252 |
| 2 | 3300005330 | Ga0070690_100002869 | Ga0070690_1000028695 | 257 |
| 3 | 3300005334 | Ga0068869_100118177 | Ga0068869_1001181771 | 257 |
| 4 | 3300005335 | Ga0070666_10010730 | Ga0070666_100107305 | 257 |
| 5 | 3300005338 | Ga0068868_100023100 | Ga0068868_1000231003 | 257 |
| 6 | 3300005340 | Ga0070689_100020757 | Ga0070689_1000207573 | 257 |
| 7 | 3300005355 | Ga0070671_100012399 | Ga0070671_1000123995 | 257 |
| 8 | 3300005356 | Ga0070674_100023304 | Ga0070674_1000233043 | 257 |
| 9 | 3300005364 | Ga0070673_100001337 | Ga0070673_1000013375 | 257 |
| 10 | 3300005365 | Ga0070688_100002648 | Ga0070688_1000026487 | 257 |
| 11 | 3300005437 | Ga0070710_10009952 | Ga0070710_100099524 | 257 |
| 12 | 3300005439 | Ga0070711_100003858 | Ga0070711_1000038588 | 257 |
| 13 | 3300005456 | Ga0070678_100004752 | Ga0070678_1000047523 | 257 |
| 14 | 3300005466 | Ga0070685_10001360 | Ga0070685_1000136012 | 257 |
| 15 | 3300005543 | Ga0070672_100061540 | Ga0070672_1000615403 | 257 |
| 16 | 3300005545 | Ga0070695_100342865 | Ga0070695_1003428651 | 257 |
| 17 | 3300005547 | Ga0070693_100010305 | Ga0070693_1000103053 | 257 |
| 18 | 3300005548 | Ga0070665_100010734 | Ga0070665_1000107345 | 257 |
| 19 | 3300005578 | Ga0068854_100102089 | Ga0068854_1001020893 | 257 |
| 20 | 3300005614 | Ga0068856_100076866 | Ga0068856_1000768664 | 257 |
| 21 | 3300005615 | Ga0070702_100031314 | Ga0070702_1000313143 | 257 |
| 22 | 3300005616 | Ga0068852_100026753 | Ga0068852_1000267536 | 257 |
| 23 | 3300005617 | Ga0068859_100007142 | Ga0068859_1000071427 | 257 |
| 24 | 3300005618 | Ga0068864_100002663 | Ga0068864_10000266313 | 257 |
| 25 | 3300005718 | Ga0068866_10001452 | Ga0068866_100014524 | 257 |
| 26 | 3300005841 | Ga0068863_100086214 | Ga0068863_1000862143 | 257 |
| 27 | 3300005842 | Ga0068858_100003418 | Ga0068858_1000034182 | 257 |
| 28 | 3300006163 | Ga0070715_10003865 | Ga0070715_100038654 | 257 |
| 29 | 3300006173 | Ga0070716_100018313 | Ga0070716_1000183133 | 257 |
| 30 | 3300006175 | Ga0070712_100051723 | Ga0070712_1000517232 | 257 |
| 31 | 3300006358 | Ga0068871_100163861 | Ga0068871_1001638612 | 257 |
| 32 | 3300006881 | Ga0068865_100074777 | Ga0068865_1000747772 | 257 |
| 33 | 3300006931 | Ga0097620_100007142 | Ga0097620_1000071427 | 257 |
| 34 | 3300009101 | Ga0105247_10010369 | Ga0105247_100103696 | 257 |
| 35 | 3300009176 | Ga0105242_10041480 | Ga0105242_100414803 | 257 |
| 36 | 3300010375 | Ga0105239_10604944 | Ga0105239_106049442 | 257 |
| 37 | 3300011119 | Ga0105246_10304059 | Ga0105246_103040592 | 257 |
| 38 | 3300013296 | Ga0157374_10000596 | Ga0157374_1000059610 | 257 |
| 39 | 3300013297 | Ga0157378_10043444 | Ga0157378_100434443 | 257 |
| 40 | 3300013308 | Ga0157375_10014883 | Ga0157375_100148837 | 257 |
| 41 | 3300014325 | Ga0163163_10004542 | Ga0163163_100045428 | 257 |
| 42 | 3300014968 | Ga0157379_10009604 | Ga0157379_100096048 | 257 |
| 43 | 3300025898 | Ga0207692_10012700 | Ga0207692_100127002 | 257 |
| 44 | 3300025899 | Ga0207642_10022010 | Ga0207642_100220102 | 257 |
| 45 | 3300025900 | Ga0207710_10028460 | Ga0207710_100284602 | 257 |
| 46 | 3300025903 | Ga0207680_10008730 | Ga0207680_100087303 | 257 |
| 47 | 3300025905 | Ga0207685_10005534 | Ga0207685_100055342 | 257 |
| 48 | 3300025908 | Ga0207643_10117297 | Ga0207643_101172972 | 257 |
| 49 | 3300025915 | Ga0207693_10000104 | Ga0207693_1000010448 | 257 |
| 50 | 3300025918 | Ga0207662_10005874 | Ga0207662_100058747 | 257 |
| 51 | 3300025925 | Ga0207650_10016873 | Ga0207650_100168733 | 257 |
| 52 | 3300025927 | Ga0207687_10008617 | Ga0207687_100086175 | 257 |
| 53 | 3300025935 | Ga0207709_10128144 | Ga0207709_101281442 | 257 |
| 54 | 3300025936 | Ga0207670_10073666 | Ga0207670_100736662 | 257 |
| 55 | 3300025937 | Ga0207669_10014976 | Ga0207669_100149763 | 257 |
| 56 | 3300025940 | Ga0207691_10023778 | Ga0207691_100237785 | 257 |
| 57 | 3300025941 | Ga0207711_10000572 | Ga0207711_100005725 | 257 |
| 58 | 3300025944 | Ga0207661_10634138 | Ga0207661_106341381 | 257 |
| 59 | 3300025960 | Ga0207651_10002919 | Ga0207651_100029195 | 257 |
| 60 | 3300025986 | Ga0207658_10059694 | Ga0207658_100596942 | 257 |
| 61 | 3300026023 | Ga0207677_10000469 | Ga0207677_100004693 | 257 |
| 62 | 3300026035 | Ga0207703_10002876 | Ga0207703_100028769 | 257 |
| 63 | 3300026078 | Ga0207702_10093771 | Ga0207702_100937712 | 257 |
| 64 | 3300026088 | Ga0207641_10008544 | Ga0207641_100085443 | 257 |
| 65 | 3300026095 | Ga0207676_10002530 | Ga0207676_100025309 | 257 |
| 66 | 3300026121 | Ga0207683_10001133 | Ga0207683_1000113312 | 257 |
| 67 | 3300026142 | Ga0207698_10203015 | Ga0207698_102030152 | 257 |
| 68 | 3300035086 | Ga0373934_0038382 | Ga0373934_0038382_1007_1843 | 257 |
| 69 | 3300035111 | Ga0373923_0000205 | Ga0373923_0000205_7806_8642 | 257 |
| 70 | 3300035117 | Ga0373953_0001394 | Ga0373953_0001394_1077_1913 | 257 |
| 71 | 3300035118 | Ga0373954_0002022 | Ga0373954_0002022_1718_2554 | 257 |
| 72 | 3300035120 | Ga0373957_0008010 | Ga0373957_0008010_2003_2839 | 257 |
| 73 | 3300035172 | Ga0373955_0005365 | Ga0373955_0005365_3798_4634 | 257 |
| 74 | 3300035410 | Ga0373924_0126983 | Ga0373924_0126983_79_915 | 257 |
| 75 | 3300035724 | Ga0373933_0017492 | Ga0373933_0017492_69_905 | 257 |
| 76 | 3300037068 | Ga0373925_0278958 | Ga0373925_0278958_11_847 | 257 |
| 77 | 3300046454 | Ga0495592_0309309 | Ga0495592_0309309_55_891 | 257 |
| 78 | 3300046539 | Ga0495621_0003552 | Ga0495621_0003552_1700_2536 | 257 |
| 79 | 3300046664 | Ga0495659_0047479 | Ga0495659_0047479_154_990 | 257 |
| 80 | 3300046679 | Ga0495623_0052380 | Ga0495623_0052380_1536_2372 | 257 |
| 81 | 3300048904 | Ga0496101_0136489 | Ga0496101_0136489_789_1625 | 257 |
| 82 | 3300048911 | Ga0496108_0008141 | Ga0496108_0008141_6572_7408 | 257 |
| 83 | 3300048912 | Ga0496109_0040364 | Ga0496109_0040364_521_1357 | 257 |
| 84 | 3300048918 | Ga0496115_0116217 | Ga0496115_0116217_158_994 | 257 |
| 85 | 3300005329 | Ga0070683_100098767 | Ga0070683_1000987671 | 261 |
| 86 | 3300005336 | Ga0070680_100045898 | Ga0070680_1000458981 | 261 |
| 87 | 3300005338 | Ga0068868_100032040 | Ga0068868_1000320403 | 261 |
| 88 | 3300005435 | Ga0070714_100069918 | Ga0070714_1000699183 | 261 |
| 89 | 3300005436 | Ga0070713_100059822 | Ga0070713_1000598222 | 261 |
| 90 | 3300005437 | Ga0070710_10273250 | Ga0070710_102732501 | 261 |
| 91 | 3300005445 | Ga0070708_100589878 | Ga0070708_1005898781 | 261 |
| 92 | 3300005457 | Ga0070662_100319583 | Ga0070662_1003195831 | 261 |
| 93 | 3300005468 | Ga0070707_100299977 | Ga0070707_1002999772 | 261 |
| 94 | 3300005471 | Ga0070698_100151474 | Ga0070698_1001514741 | 261 |
| 95 | 3300005518 | Ga0070699_100189541 | Ga0070699_1001895413 | 261 |
| 96 | 3300005530 | Ga0070679_100468983 | Ga0070679_1004689831 | 261 |
| 97 | 3300005535 | Ga0070684_100093302 | Ga0070684_1000933023 | 261 |
| 98 | 3300005546 | Ga0070696_100081818 | Ga0070696_1000818182 | 261 |
| 99 | 3300005547 | Ga0070693_100006610 | Ga0070693_1000066101 | 261 |
| 100 | 3300005578 | Ga0068854_100330656 | Ga0068854_1003306562 | 261 |
| 101 | 3300005834 | Ga0068851_10008538 | Ga0068851_100085384 | 261 |
| 102 | 3300009098 | Ga0105245_10129621 | Ga0105245_101296211 | 261 |
| 103 | 3300009174 | Ga0105241_10227580 | Ga0105241_102275802 | 261 |
| 104 | 3300010375 | Ga0105239_10301624 | Ga0105239_103016242 | 261 |
| 105 | 3300013104 | Ga0157370_10025283 | Ga0157370_100252834 | 261 |
| 106 | 3300013105 | Ga0157369_10045838 | Ga0157369_100458386 | 261 |
| 107 | 3300025321 | Ga0207656_10063164 | Ga0207656_100631641 | 261 |
| 108 | 3300025906 | Ga0207699_10056467 | Ga0207699_100564672 | 261 |
| 109 | 3300025911 | Ga0207654_10050973 | Ga0207654_100509733 | 261 |
| 110 | 3300025913 | Ga0207695_10373661 | Ga0207695_103736612 | 261 |
| 111 | 3300025915 | Ga0207693_10006353 | Ga0207693_100063537 | 261 |
| 112 | 3300025919 | Ga0207657_10004654 | Ga0207657_100046541 | 261 |
| 113 | 3300025921 | Ga0207652_10195804 | Ga0207652_101958042 | 261 |
| 114 | 3300025922 | Ga0207646_10182159 | Ga0207646_101821592 | 261 |
| 115 | 3300025927 | Ga0207687_10040880 | Ga0207687_100408803 | 261 |
| 116 | 3300025929 | Ga0207664_10010626 | Ga0207664_100106263 | 261 |
| 117 | 3300025933 | Ga0207706_10068189 | Ga0207706_100681892 | 261 |
| 118 | 3300025939 | Ga0207665_10033312 | Ga0207665_100333122 | 261 |
| 119 | 3300025944 | Ga0207661_10125959 | Ga0207661_101259593 | 261 |
| 120 | 3300026023 | Ga0207677_10253544 | Ga0207677_102535441 | 261 |
| 121 | 3300026142 | Ga0207698_10484738 | Ga0207698_104847381 | 261 |
| 122 | 3300035171 | Ga0373946_0032003 | Ga0373946_0032003_118_975 | 261 |
| 123 | 3300035692 | Ga0373935_0098112 | Ga0373935_0098112_826_1683 | 261 |
| 124 | 3300035725 | Ga0373947_0030883 | Ga0373947_0030883_169_1026 | 261 |
| 125 | 3300037068 | Ga0373925_0285317 | Ga0373925_0285317_271_1128 | 261 |
| 126 | 3300048906 | Ga0496103_0042137 | Ga0496103_0042137_1885_2721 | 261 |
| 127 | 3300048909 | Ga0496106_0084317 | Ga0496106_0084317_34_870 | 261 |
| 128 | 3300048915 | Ga0496112_0189653 | Ga0496112_0189653_57_893 | 261 |
| 129 | 3300050514 | nmdc:mga08x19_223567_c1 | nmdc:mga08x19_223567_c1_403_1239 | 261 |
| 130 | 3300005329 | Ga0070683_100045484 | Ga0070683_1000454844 | 263 |
| 131 | 3300005535 | Ga0070684_100013383 | Ga0070684_1000133838 | 263 |
| 132 | 3300005547 | Ga0070693_100107936 | Ga0070693_1001079362 | 263 |
| 133 | 3300006237 | Ga0097621_100009563 | Ga0097621_1000095634 | 263 |
| 134 | 3300006358 | Ga0068871_100003069 | Ga0068871_1000030696 | 263 |
| 135 | 3300009177 | Ga0105248_10414506 | Ga0105248_104145062 | 263 |
| 136 | 3300014969 | Ga0157376_10042432 | Ga0157376_100424324 | 263 |
| 137 | 3300034957 | Ga0373938_0018515 | Ga0373938_0018515_251_1129 | 263 |
| 138 | 3300035691 | Ga0373931_0016875 | Ga0373931_0016875_80_958 | 263 |
| 139 | 3300009094 | Ga0111539_10070916 | Ga0111539_100709166 | 265 |
| 140 | 3300025937 | Ga0207669_10540084 | Ga0207669_105400841 | 265 |
| 141 | 3300005546 | Ga0070696_100388414 | Ga0070696_1003884142 | 268 |
| 142 | 3300046472 | Ga0495580_0187079 | Ga0495580_0187079_75_941 | 268 |
| 143 | 3300035692 | Ga0373935_0039146 | Ga0373935_0039146_830_1666 | 271 |
| 144 | 3300035695 | Ga0373927_0103290 | Ga0373927_0103290_786_1622 | 271 |
| 145 | 3300035725 | Ga0373947_0055504 | Ga0373947_0055504_474_1310 | 271 |
| 146 | 3300036401 | Ga0373937_0021545 | Ga0373937_0021545_1212_2048 | 271 |
| 147 | 3300046455 | Ga0495603_0077020 | Ga0495603_0077020_926_1762 | 271 |
| 148 | 3300046463 | Ga0495653_0222837 | Ga0495653_0222837_383_1219 | 271 |
| 149 | 3300046472 | Ga0495580_0055990 | Ga0495580_0055990_1330_2166 | 271 |
| 150 | 3300046473 | Ga0495582_0003693 | Ga0495582_0003693_6453_7289 | 271 |
| 151 | 3300046476 | Ga0495662_0025122 | Ga0495662_0025122_709_1545 | 271 |
| 152 | 3300046499 | Ga0495594_0050679 | Ga0495594_0050679_266_1102 | 271 |
| 153 | 3300046531 | Ga0495665_0029121 | Ga0495665_0029121_1811_2647 | 271 |
| 154 | 3300046543 | Ga0495645_0025778 | Ga0495645_0025778_1025_1861 | 271 |
| 155 | 3300046642 | Ga0495634_0059578 | Ga0495634_0059578_652_1488 | 271 |
| 156 | 3300046663 | Ga0495635_0082244 | Ga0495635_0082244_907_1743 | 271 |
| 157 | 3300046683 | Ga0495658_0026403 | Ga0495658_0026403_2070_2906 | 271 |
| 158 | 3300046689 | Ga0495613_0093433 | Ga0495613_0093433_832_1668 | 271 |
| 159 | 3300046809 | Ga0495600_0006681 | Ga0495600_0006681_4716_5552 | 271 |
| 160 | 3300047319 | Ga0495674_0218376 | Ga0495674_0218376_675_1511 | 271 |
| 161 | 3300047322 | Ga0495680_0044568 | Ga0495680_0044568_1715_2551 | 271 |
| 162 | 3300047673 | Ga0495593_0057647 | Ga0495593_0057647_53_889 | 271 |
| 163 | 3300048089 | Ga0495614_0078529 | Ga0495614_0078529_531_1367 | 271 |
| 164 | 3300053085 | Ga0495619_0009966 | Ga0495619_0009966_1413_2249 | 271 |
| 165 | 3300048917 | Ga0496114_0187853 | Ga0496114_0187853_610_1503 | 272 |
| 166 | 3300005458 | Ga0070681_10041698 | Ga0070681_100416982 | 275 |
| 167 | 3300013104 | Ga0157370_10007918 | Ga0157370_100079187 | 275 |
| 168 | 3300005336 | Ga0070680_100036078 | Ga0070680_1000360783 | 276 |
| 169 | 3300005355 | Ga0070671_100236369 | Ga0070671_1002363692 | 276 |
| 170 | 3300005435 | Ga0070714_100006057 | Ga0070714_1000060575 | 276 |
| 171 | 3300005458 | Ga0070681_10004051 | Ga0070681_1000405111 | 276 |
| 172 | 3300005530 | Ga0070679_100010697 | Ga0070679_1000106975 | 276 |
| 173 | 3300005563 | Ga0068855_100028779 | Ga0068855_1000287794 | 276 |
| 174 | 3300005614 | Ga0068856_100004914 | Ga0068856_1000049143 | 276 |
| 175 | 3300013307 | Ga0157372_10002331 | Ga0157372_1000233124 | 276 |
| 176 | 3300013307 | Ga0157372_10160040 | Ga0157372_101600402 | 276 |
| 177 | 3300025912 | Ga0207707_10015357 | Ga0207707_100153575 | 276 |
| 178 | 3300025917 | Ga0207660_10013758 | Ga0207660_100137584 | 276 |
| 179 | 3300025921 | Ga0207652_10033282 | Ga0207652_100332825 | 276 |
| 180 | 3300025929 | Ga0207664_10030822 | Ga0207664_100308222 | 276 |
| 181 | 3300025945 | Ga0207679_10044939 | Ga0207679_100449393 | 276 |
| 182 | 3300025981 | Ga0207640_10104584 | Ga0207640_101045842 | 276 |
| 183 | 3300026078 | Ga0207702_10035970 | Ga0207702_100359703 | 276 |
| 184 | 3300026078 | Ga0207702_10287987 | Ga0207702_102879872 | 276 |
| 185 | 3300026116 | Ga0207674_10105497 | Ga0207674_101054973 | 276 |
| 186 | 3300045976 | Ga0466967_0057018 | Ga0466967_0057018_1424_2272 | 276 |
| 187 | 3300005330 | Ga0070690_100193293 | Ga0070690_1001932931 | 277 |
| 188 | 3300005331 | Ga0070670_100003760 | Ga0070670_1000037607 | 277 |
| 189 | 3300005331 | Ga0070670_100020212 | Ga0070670_1000202123 | 277 |
| 190 | 3300005333 | Ga0070677_10026492 | Ga0070677_100264921 | 277 |
| 191 | 3300005334 | Ga0068869_100008953 | Ga0068869_1000089533 | 277 |
| 192 | 3300005339 | Ga0070660_100413139 | Ga0070660_1004131391 | 277 |
| 193 | 3300005340 | Ga0070689_100029842 | Ga0070689_1000298424 | 277 |
| 194 | 3300005354 | Ga0070675_100012798 | Ga0070675_1000127983 | 277 |
| 195 | 3300005354 | Ga0070675_100030522 | Ga0070675_1000305224 | 277 |
| 196 | 3300005356 | Ga0070674_100026075 | Ga0070674_1000260752 | 277 |
| 197 | 3300005364 | Ga0070673_100036692 | Ga0070673_1000366922 | 277 |
| 198 | 3300005364 | Ga0070673_100113604 | Ga0070673_1001136042 | 277 |
| 199 | 3300005367 | Ga0070667_100204993 | Ga0070667_1002049932 | 277 |
| 200 | 3300005456 | Ga0070678_100425627 | Ga0070678_1004256271 | 277 |
| 201 | 3300005459 | Ga0068867_100016105 | Ga0068867_1000161051 | 277 |
| 202 | 3300005536 | Ga0070697_100379527 | Ga0070697_1003795272 | 277 |
| 203 | 3300005543 | Ga0070672_100077909 | Ga0070672_1000779093 | 277 |
| 204 | 3300005544 | Ga0070686_100109330 | Ga0070686_1001093302 | 277 |
| 205 | 3300005545 | Ga0070695_100502949 | Ga0070695_1005029491 | 277 |
| 206 | 3300005615 | Ga0070702_100075566 | Ga0070702_1000755662 | 277 |
| 207 | 3300005616 | Ga0068852_100240044 | Ga0068852_1002400442 | 277 |
| 208 | 3300005617 | Ga0068859_100077083 | Ga0068859_1000770832 | 277 |
| 209 | 3300005617 | Ga0068859_100268841 | Ga0068859_1002688412 | 277 |
| 210 | 3300005618 | Ga0068864_100006458 | Ga0068864_1000064586 | 277 |
| 211 | 3300005618 | Ga0068864_100017297 | Ga0068864_1000172974 | 277 |
| 212 | 3300005618 | Ga0068864_100053038 | Ga0068864_1000530383 | 277 |
| 213 | 3300005618 | Ga0068864_100188438 | Ga0068864_1001884382 | 277 |
| 214 | 3300005718 | Ga0068866_10055564 | Ga0068866_100555641 | 277 |
| 215 | 3300005834 | Ga0068851_10222347 | Ga0068851_102223471 | 277 |
| 216 | 3300005840 | Ga0068870_10196464 | Ga0068870_101964642 | 277 |
| 217 | 3300005841 | Ga0068863_100002857 | Ga0068863_1000028578 | 277 |
| 218 | 3300005841 | Ga0068863_100056480 | Ga0068863_1000564802 | 277 |
| 219 | 3300005841 | Ga0068863_100194706 | Ga0068863_1001947063 | 277 |
| 220 | 3300005842 | Ga0068858_100149812 | Ga0068858_1001498123 | 277 |
| 221 | 3300005843 | Ga0068860_100134539 | Ga0068860_1001345393 | 277 |
| 222 | 3300005844 | Ga0068862_100041628 | Ga0068862_1000416283 | 277 |
| 223 | 3300005844 | Ga0068862_100085113 | Ga0068862_1000851133 | 277 |
| 224 | 3300005844 | Ga0068862_100185362 | Ga0068862_1001853623 | 277 |
| 225 | 3300006237 | Ga0097621_100094791 | Ga0097621_1000947913 | 277 |
| 226 | 3300006358 | Ga0068871_100086899 | Ga0068871_1000868993 | 277 |
| 227 | 3300006881 | Ga0068865_100055704 | Ga0068865_1000557042 | 277 |
| 228 | 3300006931 | Ga0097620_100077081 | Ga0097620_1000770812 | 277 |
| 229 | 3300006931 | Ga0097620_100268828 | Ga0097620_1002688282 | 277 |
| 230 | 3300009176 | Ga0105242_10222964 | Ga0105242_102229642 | 277 |
| 231 | 3300009177 | Ga0105248_10198693 | Ga0105248_101986933 | 277 |
| 232 | 3300009177 | Ga0105248_10688705 | Ga0105248_106887051 | 277 |
| 233 | 3300009553 | Ga0105249_10057803 | Ga0105249_100578034 | 277 |
| 234 | 3300013296 | Ga0157374_10582507 | Ga0157374_105825072 | 277 |
| 235 | 3300013297 | Ga0157378_10117962 | Ga0157378_101179622 | 277 |
| 236 | 3300013306 | Ga0163162_10121295 | Ga0163162_101212953 | 277 |
| 237 | 3300013307 | Ga0157372_10027510 | Ga0157372_100275106 | 277 |
| 238 | 3300013308 | Ga0157375_10094115 | Ga0157375_100941152 | 277 |
| 239 | 3300014325 | Ga0163163_10011269 | Ga0163163_100112694 | 277 |
| 240 | 3300014325 | Ga0163163_10013670 | Ga0163163_100136703 | 277 |
| 241 | 3300014326 | Ga0157380_10069279 | Ga0157380_100692793 | 277 |
| 242 | 3300014326 | Ga0157380_10216133 | Ga0157380_102161332 | 277 |
| 243 | 3300014969 | Ga0157376_10061004 | Ga0157376_100610043 | 277 |
| 244 | 3300025893 | Ga0207682_10002765 | Ga0207682_100027658 | 277 |
| 245 | 3300025899 | Ga0207642_10090296 | Ga0207642_100902961 | 277 |
| 246 | 3300025907 | Ga0207645_10031886 | Ga0207645_100318862 | 277 |
| 247 | 3300025908 | Ga0207643_10005469 | Ga0207643_100054694 | 277 |
| 248 | 3300025918 | Ga0207662_10113794 | Ga0207662_101137942 | 277 |
| 249 | 3300025919 | Ga0207657_10040315 | Ga0207657_100403153 | 277 |
| 250 | 3300025925 | Ga0207650_10013289 | Ga0207650_100132894 | 277 |
| 251 | 3300025925 | Ga0207650_10050645 | Ga0207650_100506452 | 277 |
| 252 | 3300025926 | Ga0207659_10068777 | Ga0207659_100687773 | 277 |
| 253 | 3300025931 | Ga0207644_10241578 | Ga0207644_102415781 | 277 |
| 254 | 3300025932 | Ga0207690_10249038 | Ga0207690_102490381 | 277 |
| 255 | 3300025934 | Ga0207686_10072370 | Ga0207686_100723702 | 277 |
| 256 | 3300025936 | Ga0207670_10099090 | Ga0207670_100990902 | 277 |
| 257 | 3300025940 | Ga0207691_10001401 | Ga0207691_1000140120 | 277 |
| 258 | 3300025940 | Ga0207691_10190935 | Ga0207691_101909352 | 277 |
| 259 | 3300025942 | Ga0207689_10006312 | Ga0207689_100063128 | 277 |
| 260 | 3300025945 | Ga0207679_10242841 | Ga0207679_102428412 | 277 |
| 261 | 3300025949 | Ga0207667_10281976 | Ga0207667_102819762 | 277 |
| 262 | 3300025960 | Ga0207651_10237981 | Ga0207651_102379811 | 277 |
| 263 | 3300025986 | Ga0207658_10151167 | Ga0207658_101511672 | 277 |
| 264 | 3300026075 | Ga0207708_10053128 | Ga0207708_100531283 | 277 |
| 265 | 3300026088 | Ga0207641_10063674 | Ga0207641_100636743 | 277 |
| 266 | 3300026088 | Ga0207641_10446741 | Ga0207641_104467412 | 277 |
| 267 | 3300026089 | Ga0207648_10020296 | Ga0207648_100202965 | 277 |
| 268 | 3300026095 | Ga0207676_10023341 | Ga0207676_100233415 | 277 |
| 269 | 3300026118 | Ga0207675_100147753 | Ga0207675_1001477532 | 277 |
| 270 | 3300026121 | Ga0207683_10013560 | Ga0207683_100135605 | 277 |
| 271 | 3300028381 | Ga0268264_10060412 | Ga0268264_100604122 | 277 |
| 272 | 3300028381 | Ga0268264_10154146 | Ga0268264_101541463 | 277 |
| 273 | 3300035172 | Ga0373955_0119781 | Ga0373955_0119781_580_1416 | 277 |
| 274 | 3300036401 | Ga0373937_0014725 | Ga0373937_0014725_5417_6253 | 277 |
| 275 | 3300036401 | Ga0373937_0025596 | Ga0373937_0025596_3562_4398 | 277 |
| 276 | 3300039437 | Ga0436365_0686227 | Ga0436365_0686227_23_859 | 277 |
| 277 | 3300048088 | Ga0495602_0097632 | Ga0495602_0097632_1041_1877 | 277 |
| 278 | 3300048912 | Ga0496109_0239075 | Ga0496109_0239075_328_1164 | 277 |
| 279 | 3300005328 | Ga0070676_10235796 | Ga0070676_102357961 | 278 |
| 280 | 3300005331 | Ga0070670_100023997 | Ga0070670_1000239972 | 278 |
| 281 | 3300005347 | Ga0070668_100104800 | Ga0070668_1001048001 | 278 |
| 282 | 3300005471 | Ga0070698_100045367 | Ga0070698_1000453673 | 278 |
| 283 | 3300005518 | Ga0070699_100138676 | Ga0070699_1001386762 | 278 |
| 284 | 3300009093 | Ga0105240_10007422 | Ga0105240_1000742215 | 278 |
| 285 | 3300009545 | Ga0105237_10147303 | Ga0105237_101473034 | 278 |
| 286 | 3300025907 | Ga0207645_10049460 | Ga0207645_100494602 | 278 |
| 287 | 3300025925 | Ga0207650_10015751 | Ga0207650_100157517 | 278 |
| 288 | 3300025972 | Ga0207668_10027692 | Ga0207668_100276923 | 278 |
| 289 | 3300026089 | Ga0207648_10030919 | Ga0207648_100309195 | 278 |
| 290 | 3300050514 | nmdc:mga08x19_50596_c1 | nmdc:mga08x19_50596_c1_853_1722 | 278 |
| 291 | 3300005328 | Ga0070676_10001948 | Ga0070676_100019483 | 279 |
| 292 | 3300005331 | Ga0070670_100044539 | Ga0070670_1000445394 | 279 |
| 293 | 3300005334 | Ga0068869_100002327 | Ga0068869_1000023278 | 279 |
| 294 | 3300005334 | Ga0068869_100029310 | Ga0068869_1000293103 | 279 |
| 295 | 3300005335 | Ga0070666_10000816 | Ga0070666_100008168 | 279 |
| 296 | 3300005335 | Ga0070666_10013432 | Ga0070666_100134322 | 279 |
| 297 | 3300005338 | Ga0068868_100010780 | Ga0068868_1000107805 | 279 |
| 298 | 3300005340 | Ga0070689_100080660 | Ga0070689_1000806602 | 279 |
| 299 | 3300005347 | Ga0070668_100002584 | Ga0070668_1000025846 | 279 |
| 300 | 3300005347 | Ga0070668_100004081 | Ga0070668_1000040817 | 279 |
| 301 | 3300005353 | Ga0070669_100001114 | Ga0070669_10000111412 | 279 |
| 302 | 3300005354 | Ga0070675_100003508 | Ga0070675_1000035085 | 279 |
| 303 | 3300005354 | Ga0070675_100004648 | Ga0070675_1000046488 | 279 |
| 304 | 3300005355 | Ga0070671_100008929 | Ga0070671_1000089292 | 279 |
| 305 | 3300005355 | Ga0070671_100052153 | Ga0070671_1000521534 | 279 |
| 306 | 3300005356 | Ga0070674_100000236 | Ga0070674_10000023630 | 279 |
| 307 | 3300005356 | Ga0070674_100079709 | Ga0070674_1000797092 | 279 |
| 308 | 3300005364 | Ga0070673_100001162 | Ga0070673_1000011623 | 279 |
| 309 | 3300005364 | Ga0070673_100003476 | Ga0070673_10000347610 | 279 |
| 310 | 3300005367 | Ga0070667_100006712 | Ga0070667_1000067124 | 279 |
| 311 | 3300005367 | Ga0070667_100008845 | Ga0070667_1000088453 | 279 |
| 312 | 3300005436 | Ga0070713_100000114 | Ga0070713_1000001147 | 279 |
| 313 | 3300005439 | Ga0070711_100071113 | Ga0070711_1000711132 | 279 |
| 314 | 3300005445 | Ga0070708_100002053 | Ga0070708_1000020537 | 279 |
| 315 | 3300005455 | Ga0070663_100085802 | Ga0070663_1000858022 | 279 |
| 316 | 3300005455 | Ga0070663_100238267 | Ga0070663_1002382672 | 279 |
| 317 | 3300005456 | Ga0070678_100000447 | Ga0070678_1000004478 | 279 |
| 318 | 3300005456 | Ga0070678_100036592 | Ga0070678_1000365923 | 279 |
| 319 | 3300005459 | Ga0068867_100001541 | Ga0068867_1000015418 | 279 |
| 320 | 3300005459 | Ga0068867_100002023 | Ga0068867_1000020231 | 279 |
| 321 | 3300005466 | Ga0070685_10029391 | Ga0070685_100293913 | 279 |
| 322 | 3300005539 | Ga0068853_100000689 | Ga0068853_1000006896 | 279 |
| 323 | 3300005539 | Ga0068853_100077060 | Ga0068853_1000770602 | 279 |
| 324 | 3300005548 | Ga0070665_100002874 | Ga0070665_1000028748 | 279 |
| 325 | 3300005548 | Ga0070665_100007383 | Ga0070665_1000073832 | 279 |
| 326 | 3300005578 | Ga0068854_100132321 | Ga0068854_1001323212 | 279 |
| 327 | 3300005615 | Ga0070702_100101990 | Ga0070702_1001019902 | 279 |
| 328 | 3300005616 | Ga0068852_100007280 | Ga0068852_1000072805 | 279 |
| 329 | 3300005617 | Ga0068859_100001172 | Ga0068859_10000117215 | 279 |
| 330 | 3300005618 | Ga0068864_100011915 | Ga0068864_1000119156 | 279 |
| 331 | 3300005618 | Ga0068864_100048253 | Ga0068864_1000482535 | 279 |
| 332 | 3300005718 | Ga0068866_10129509 | Ga0068866_101295092 | 279 |
| 333 | 3300005719 | Ga0068861_100073760 | Ga0068861_1000737603 | 279 |
| 334 | 3300005834 | Ga0068851_10001073 | Ga0068851_100010732 | 279 |
| 335 | 3300005840 | Ga0068870_10001220 | Ga0068870_1000122010 | 279 |
| 336 | 3300005841 | Ga0068863_100009074 | Ga0068863_10000907412 | 279 |
| 337 | 3300005841 | Ga0068863_100084840 | Ga0068863_1000848401 | 279 |
| 338 | 3300005842 | Ga0068858_100032683 | Ga0068858_1000326835 | 279 |
| 339 | 3300005842 | Ga0068858_100105223 | Ga0068858_1001052233 | 279 |
| 340 | 3300005843 | Ga0068860_100025511 | Ga0068860_1000255114 | 279 |
| 341 | 3300005843 | Ga0068860_100028894 | Ga0068860_1000288945 | 279 |
| 342 | 3300005844 | Ga0068862_100031529 | Ga0068862_1000315293 | 279 |
| 343 | 3300006237 | Ga0097621_100005645 | Ga0097621_10000564511 | 279 |
| 344 | 3300006237 | Ga0097621_100100361 | Ga0097621_1001003612 | 279 |
| 345 | 3300006358 | Ga0068871_100000551 | Ga0068871_10000055116 | 279 |
| 346 | 3300006358 | Ga0068871_100050549 | Ga0068871_1000505493 | 279 |
| 347 | 3300006881 | Ga0068865_100003205 | Ga0068865_1000032055 | 279 |
| 348 | 3300006881 | Ga0068865_100261117 | Ga0068865_1002611172 | 279 |
| 349 | 3300006931 | Ga0097620_100001172 | Ga0097620_10000117215 | 279 |
| 350 | 3300009177 | Ga0105248_10002637 | Ga0105248_100026378 | 279 |
| 351 | 3300009553 | Ga0105249_10049577 | Ga0105249_100495775 | 279 |
| 352 | 3300013296 | Ga0157374_10003531 | Ga0157374_1000353114 | 279 |
| 353 | 3300013306 | Ga0163162_10000806 | Ga0163162_1000080615 | 279 |
| 354 | 3300013306 | Ga0163162_10109941 | Ga0163162_101099412 | 279 |
| 355 | 3300013308 | Ga0157375_10003811 | Ga0157375_100038113 | 279 |
| 356 | 3300014326 | Ga0157380_10025621 | Ga0157380_100256214 | 279 |
| 357 | 3300014745 | Ga0157377_10268125 | Ga0157377_102681251 | 279 |
| 358 | 3300014968 | Ga0157379_10003325 | Ga0157379_100033252 | 279 |
| 359 | 3300014969 | Ga0157376_10019433 | Ga0157376_100194334 | 279 |
| 360 | 3300025315 | Ga0207697_10003081 | Ga0207697_100030814 | 279 |
| 361 | 3300025321 | Ga0207656_10001807 | Ga0207656_100018076 | 279 |
| 362 | 3300025893 | Ga0207682_10000242 | Ga0207682_1000024210 | 279 |
| 363 | 3300025893 | Ga0207682_10048977 | Ga0207682_100489772 | 279 |
| 364 | 3300025903 | Ga0207680_10002437 | Ga0207680_100024375 | 279 |
| 365 | 3300025903 | Ga0207680_10015307 | Ga0207680_100153073 | 279 |
| 366 | 3300025907 | Ga0207645_10001123 | Ga0207645_1000112313 | 279 |
| 367 | 3300025907 | Ga0207645_10002011 | Ga0207645_1000201110 | 279 |
| 368 | 3300025908 | Ga0207643_10073500 | Ga0207643_100735002 | 279 |
| 369 | 3300025909 | Ga0207705_10156517 | Ga0207705_101565172 | 279 |
| 370 | 3300025923 | Ga0207681_10005369 | Ga0207681_100053699 | 279 |
| 371 | 3300025925 | Ga0207650_10012311 | Ga0207650_100123113 | 279 |
| 372 | 3300025925 | Ga0207650_10061370 | Ga0207650_100613702 | 279 |
| 373 | 3300025926 | Ga0207659_10001235 | Ga0207659_100012356 | 279 |
| 374 | 3300025928 | Ga0207700_10000018 | Ga0207700_10000018138 | 279 |
| 375 | 3300025931 | Ga0207644_10041489 | Ga0207644_100414894 | 279 |
| 376 | 3300025931 | Ga0207644_10162009 | Ga0207644_101620091 | 279 |
| 377 | 3300025937 | Ga0207669_10057677 | Ga0207669_100576772 | 279 |
| 378 | 3300025938 | Ga0207704_10006554 | Ga0207704_100065543 | 279 |
| 379 | 3300025938 | Ga0207704_10097240 | Ga0207704_100972402 | 279 |
| 380 | 3300025940 | Ga0207691_10000216 | Ga0207691_1000021614 | 279 |
| 381 | 3300025940 | Ga0207691_10000454 | Ga0207691_1000045418 | 279 |
| 382 | 3300025941 | Ga0207711_10003092 | Ga0207711_100030924 | 279 |
| 383 | 3300025942 | Ga0207689_10000963 | Ga0207689_100009634 | 279 |
| 384 | 3300025942 | Ga0207689_10055133 | Ga0207689_100551334 | 279 |
| 385 | 3300025960 | Ga0207651_10000642 | Ga0207651_100006422 | 279 |
| 386 | 3300025960 | Ga0207651_10005325 | Ga0207651_100053253 | 279 |
| 387 | 3300025961 | Ga0207712_10036789 | Ga0207712_100367894 | 279 |
| 388 | 3300025972 | Ga0207668_10025686 | Ga0207668_100256863 | 279 |
| 389 | 3300025981 | Ga0207640_10129810 | Ga0207640_101298102 | 279 |
| 390 | 3300025986 | Ga0207658_10032283 | Ga0207658_100322833 | 279 |
| 391 | 3300025986 | Ga0207658_10242326 | Ga0207658_102423263 | 279 |
| 392 | 3300026023 | Ga0207677_10001861 | Ga0207677_100018612 | 279 |
| 393 | 3300026023 | Ga0207677_10120424 | Ga0207677_101204241 | 279 |
| 394 | 3300026035 | Ga0207703_10009883 | Ga0207703_100098839 | 279 |
| 395 | 3300026035 | Ga0207703_10126170 | Ga0207703_101261702 | 279 |
| 396 | 3300026041 | Ga0207639_10009864 | Ga0207639_100098645 | 279 |
| 397 | 3300026067 | Ga0207678_10031271 | Ga0207678_100312717 | 279 |
| 398 | 3300026067 | Ga0207678_10272642 | Ga0207678_102726422 | 279 |
| 399 | 3300026088 | Ga0207641_10012275 | Ga0207641_100122758 | 279 |
| 400 | 3300026088 | Ga0207641_10117374 | Ga0207641_101173742 | 279 |
| 401 | 3300026089 | Ga0207648_10000763 | Ga0207648_1000076322 | 279 |
| 402 | 3300026089 | Ga0207648_10000829 | Ga0207648_100008293 | 279 |
| 403 | 3300026095 | Ga0207676_10002692 | Ga0207676_1000269216 | 279 |
| 404 | 3300026118 | Ga0207675_100024243 | Ga0207675_1000242433 | 279 |
| 405 | 3300026118 | Ga0207675_100086145 | Ga0207675_1000861452 | 279 |
| 406 | 3300026121 | Ga0207683_10000401 | Ga0207683_1000040121 | 279 |
| 407 | 3300026121 | Ga0207683_10000705 | Ga0207683_1000070520 | 279 |
| 408 | 3300028379 | Ga0268266_10005748 | Ga0268266_100057486 | 279 |
| 409 | 3300028379 | Ga0268266_10017606 | Ga0268266_100176062 | 279 |
| 410 | 3300028380 | Ga0268265_10075945 | Ga0268265_100759452 | 279 |
| 411 | 3300028381 | Ga0268264_10007810 | Ga0268264_100078105 | 279 |
| 412 | 3300028381 | Ga0268264_10010411 | Ga0268264_100104113 | 279 |
| 413 | 3300035692 | Ga0373935_0086357 | Ga0373935_0086357_581_1423 | 279 |
| 414 | 3300036401 | Ga0373937_0302335 | Ga0373937_0302335_487_1344 | 279 |
| 415 | 3300037068 | Ga0373925_0009867 | Ga0373925_0009867_3547_4389 | 279 |
| 416 | 3300045051 | Ga0451576_0406890 | Ga0451576_0406890_536_1393 | 279 |
| 417 | 3300048911 | Ga0496108_0017069 | Ga0496108_0017069_3553_4428 | 279 |
| 418 | 3300048912 | Ga0496109_0027634 | Ga0496109_0027634_226_1101 | 279 |
| 419 | 3300048917 | Ga0496114_0222221 | Ga0496114_0222221_695_1570 | 279 |
| 420 | 3300053084 | Ga0495595_0045109 | Ga0495595_0045109_411_1253 | 279 |
| 421 | 3300053084 | Ga0495595_0073078 | Ga0495595_0073078_731_1606 | 279 |
| 422 | 3300005444 | Ga0070694_100004678 | Ga0070694_1000046785 | 280 |
| 423 | 3300005545 | Ga0070695_100007172 | Ga0070695_1000071723 | 280 |
| 424 | 3300005549 | Ga0070704_100019944 | Ga0070704_1000199444 | 280 |
| 425 | 3300032004 | Ga0307414_10195151 | Ga0307414_101951511 | 280 |
| 426 | 3300005328 | Ga0070676_10093948 | Ga0070676_100939482 | 282 |
| 427 | 3300005331 | Ga0070670_100175821 | Ga0070670_1001758212 | 282 |
| 428 | 3300005347 | Ga0070668_100247837 | Ga0070668_1002478372 | 282 |
| 429 | 3300005354 | Ga0070675_100008431 | Ga0070675_1000084315 | 282 |
| 430 | 3300005354 | Ga0070675_100206915 | Ga0070675_1002069152 | 282 |
| 431 | 3300005367 | Ga0070667_100259025 | Ga0070667_1002590252 | 282 |
| 432 | 3300005445 | Ga0070708_100051904 | Ga0070708_1000519046 | 282 |
| 433 | 3300005467 | Ga0070706_100181600 | Ga0070706_1001816003 | 282 |
| 434 | 3300005468 | Ga0070707_100037001 | Ga0070707_1000370014 | 282 |
| 435 | 3300005518 | Ga0070699_100258735 | Ga0070699_1002587352 | 282 |
| 436 | 3300005536 | Ga0070697_100013851 | Ga0070697_1000138514 | 282 |
| 437 | 3300005543 | Ga0070672_100078858 | Ga0070672_1000788582 | 282 |
| 438 | 3300005617 | Ga0068859_100409592 | Ga0068859_1004095922 | 282 |
| 439 | 3300005841 | Ga0068863_100044347 | Ga0068863_1000443473 | 282 |
| 440 | 3300005841 | Ga0068863_100337045 | Ga0068863_1003370452 | 282 |
| 441 | 3300005842 | Ga0068858_100081612 | Ga0068858_1000816122 | 282 |
| 442 | 3300005842 | Ga0068858_100122180 | Ga0068858_1001221803 | 282 |
| 443 | 3300005843 | Ga0068860_100016447 | Ga0068860_1000164475 | 282 |
| 444 | 3300005843 | Ga0068860_100029246 | Ga0068860_1000292463 | 282 |
| 445 | 3300006358 | Ga0068871_100259275 | Ga0068871_1002592752 | 282 |
| 446 | 3300006852 | Ga0075433_10030502 | Ga0075433_100305022 | 282 |
| 447 | 3300006871 | Ga0075434_100021939 | Ga0075434_1000219392 | 282 |
| 448 | 3300006914 | Ga0075436_100035610 | Ga0075436_1000356103 | 282 |
| 449 | 3300006931 | Ga0097620_100409611 | Ga0097620_1004096112 | 282 |
| 450 | 3300007076 | Ga0075435_100008207 | Ga0075435_1000082073 | 282 |
| 451 | 3300009147 | Ga0114129_10068810 | Ga0114129_100688103 | 282 |
| 452 | 3300013308 | Ga0157375_10359397 | Ga0157375_103593972 | 282 |
| 453 | 3300025910 | Ga0207684_10013573 | Ga0207684_100135734 | 282 |
| 454 | 3300025910 | Ga0207684_10116171 | Ga0207684_101161712 | 282 |
| 455 | 3300025922 | Ga0207646_10007938 | Ga0207646_100079386 | 282 |
| 456 | 3300025923 | Ga0207681_10118862 | Ga0207681_101188622 | 282 |
| 457 | 3300025925 | Ga0207650_10016853 | Ga0207650_100168534 | 282 |
| 458 | 3300025925 | Ga0207650_10404466 | Ga0207650_104044661 | 282 |
| 459 | 3300025926 | Ga0207659_10006236 | Ga0207659_100062364 | 282 |
| 460 | 3300025926 | Ga0207659_10056912 | Ga0207659_100569123 | 282 |
| 461 | 3300025939 | Ga0207665_10082520 | Ga0207665_100825202 | 282 |
| 462 | 3300025940 | Ga0207691_10023315 | Ga0207691_100233154 | 282 |
| 463 | 3300025940 | Ga0207691_10078162 | Ga0207691_100781622 | 282 |
| 464 | 3300025986 | Ga0207658_10101393 | Ga0207658_101013932 | 282 |
| 465 | 3300025986 | Ga0207658_10121416 | Ga0207658_101214162 | 282 |
| 466 | 3300026035 | Ga0207703_10093198 | Ga0207703_100931983 | 282 |
| 467 | 3300026035 | Ga0207703_10105239 | Ga0207703_101052392 | 282 |
| 468 | 3300026118 | Ga0207675_100127694 | Ga0207675_1001276942 | 282 |
| 469 | 3300028381 | Ga0268264_10014615 | Ga0268264_100146156 | 282 |
| 470 | 3300046472 | Ga0495580_0150064 | Ga0495580_0150064_591_1442 | 282 |
| 471 | 3300048907 | Ga0496104_0416490 | Ga0496104_0416490_135_1001 | 282 |
| 472 | 3300048908 | Ga0496105_0459561 | Ga0496105_0459561_30_896 | 282 |
| 473 | 3300050507 | nmdc:mga05p37_99504_c1 | nmdc:mga05p37_99504_c1_732_1583 | 282 |
| 474 | 3300050512 | nmdc:mga0n895_14216_c1 | nmdc:mga0n895_14216_c1_4163_5014 | 282 |
| 475 | 3300050513 | nmdc:mga0rr50_6927_c1 | nmdc:mga0rr50_6927_c1_5341_6192 | 282 |
| 476 | 3300050515 | nmdc:mga0a205_43040_c1 | nmdc:mga0a205_43040_c1_1320_2171 | 282 |
| 477 | 3300013307 | Ga0157372_10071265 | Ga0157372_100712654 | 283 |
| 478 | 3300007265 | Ga0099794_10154035 | Ga0099794_101540351 | 284 |
| 479 | 3300005347 | Ga0070668_100002425 | Ga0070668_10000242511 | 285 |
| 480 | 3300005353 | Ga0070669_100035416 | Ga0070669_1000354163 | 285 |
| 481 | 3300005356 | Ga0070674_100006028 | Ga0070674_1000060288 | 285 |
| 482 | 3300014326 | Ga0157380_10007998 | Ga0157380_100079984 | 285 |
| 483 | 3300025972 | Ga0207668_10000894 | Ga0207668_100008945 | 285 |
| 484 | 3300027395 | Ga0209996_1012158 | Ga0209996_10121582 | 285 |
| 485 | 3300005844 | Ga0068862_100015687 | Ga0068862_1000156878 | 286 |
| 486 | 3300025972 | Ga0207668_10056834 | Ga0207668_100568342 | 286 |
| 487 | 3300028381 | Ga0268264_10101663 | Ga0268264_101016633 | 286 |
| 488 | 3300005295 | Ga0065707_10108281 | Ga0065707_101082814 | 288 |
| 489 | 3300005295 | Ga0065707_10251239 | Ga0065707_102512392 | 288 |
| 490 | 3300005330 | Ga0070690_100402209 | Ga0070690_1004022091 | 288 |
| 491 | 3300005334 | Ga0068869_100229020 | Ga0068869_1002290203 | 288 |
| 492 | 3300005340 | Ga0070689_100120950 | Ga0070689_1001209504 | 288 |
| 493 | 3300005340 | Ga0070689_100342332 | Ga0070689_1003423322 | 288 |
| 494 | 3300005343 | Ga0070687_100320358 | Ga0070687_1003203581 | 288 |
| 495 | 3300005345 | Ga0070692_10153622 | Ga0070692_101536222 | 288 |
| 496 | 3300005354 | Ga0070675_100094313 | Ga0070675_1000943132 | 288 |
| 497 | 3300005365 | Ga0070688_100089058 | Ga0070688_1000890582 | 288 |
| 498 | 3300005444 | Ga0070694_100203860 | Ga0070694_1002038601 | 288 |
| 499 | 3300005444 | Ga0070694_100326779 | Ga0070694_1003267792 | 288 |
| 500 | 3300005468 | Ga0070707_100033339 | Ga0070707_1000333392 | 288 |
| 501 | 3300005471 | Ga0070698_100101567 | Ga0070698_1001015673 | 288 |
| 502 | 3300005471 | Ga0070698_100177912 | Ga0070698_1001779122 | 288 |
| 503 | 3300005518 | Ga0070699_100254034 | Ga0070699_1002540342 | 288 |
| 504 | 3300005546 | Ga0070696_100071277 | Ga0070696_1000712774 | 288 |
| 505 | 3300005549 | Ga0070704_100001327 | Ga0070704_10000132713 | 288 |
| 506 | 3300005577 | Ga0068857_100149944 | Ga0068857_1001499442 | 288 |
| 507 | 3300005617 | Ga0068859_100037393 | Ga0068859_1000373936 | 288 |
| 508 | 3300005618 | Ga0068864_100082993 | Ga0068864_1000829932 | 288 |
| 509 | 3300005844 | Ga0068862_100569074 | Ga0068862_1005690741 | 288 |
| 510 | 3300006844 | Ga0075428_100080658 | Ga0075428_1000806582 | 288 |
| 511 | 3300006844 | Ga0075428_100108012 | Ga0075428_1001080123 | 288 |
| 512 | 3300006846 | Ga0075430_100000550 | Ga0075430_1000005509 | 288 |
| 513 | 3300006846 | Ga0075430_100007696 | Ga0075430_1000076966 | 288 |
| 514 | 3300006847 | Ga0075431_100005396 | Ga0075431_1000053963 | 288 |
| 515 | 3300006847 | Ga0075431_100242110 | Ga0075431_1002421102 | 288 |
| 516 | 3300006852 | Ga0075433_10068886 | Ga0075433_100688863 | 288 |
| 517 | 3300006880 | Ga0075429_100000511 | Ga0075429_10000051132 | 288 |
| 518 | 3300006880 | Ga0075429_100039718 | Ga0075429_1000397184 | 288 |
| 519 | 3300006931 | Ga0097620_100037393 | Ga0097620_1000373936 | 288 |
| 520 | 3300007265 | Ga0099794_10015782 | Ga0099794_100157823 | 288 |
| 521 | 3300009094 | Ga0111539_10013382 | Ga0111539_100133826 | 288 |
| 522 | 3300009098 | Ga0105245_10055737 | Ga0105245_100557374 | 288 |
| 523 | 3300009176 | Ga0105242_10001782 | Ga0105242_1000178213 | 288 |
| 524 | 3300025885 | Ga0207653_10065008 | Ga0207653_100650082 | 288 |
| 525 | 3300025918 | Ga0207662_10247088 | Ga0207662_102470882 | 288 |
| 526 | 3300025927 | Ga0207687_10011741 | Ga0207687_100117415 | 288 |
| 527 | 3300025934 | Ga0207686_10020882 | Ga0207686_100208822 | 288 |
| 528 | 3300025936 | Ga0207670_10102691 | Ga0207670_101026914 | 288 |
| 529 | 3300025936 | Ga0207670_10127750 | Ga0207670_101277502 | 288 |
| 530 | 3300025938 | Ga0207704_10006774 | Ga0207704_100067746 | 288 |
| 531 | 3300025942 | Ga0207689_10259174 | Ga0207689_102591743 | 288 |
| 532 | 3300026116 | Ga0207674_10118474 | Ga0207674_101184744 | 288 |
| 533 | 3300026118 | Ga0207675_100144068 | Ga0207675_1001440682 | 288 |
| 534 | 3300026118 | Ga0207675_100725849 | Ga0207675_1007258492 | 288 |
| 535 | 3300027360 | Ga0209969_1001086 | Ga0209969_10010864 | 288 |
| 536 | 3300027378 | Ga0209981_1001444 | Ga0209981_10014444 | 288 |
| 537 | 3300027462 | Ga0210000_1001892 | Ga0210000_10018924 | 288 |
| 538 | 3300027471 | Ga0209995_1001597 | Ga0209995_10015975 | 288 |
| 539 | 3300027526 | Ga0209968_1002375 | Ga0209968_10023754 | 288 |
| 540 | 3300027665 | Ga0209983_1025328 | Ga0209983_10253282 | 288 |
| 541 | 3300027682 | Ga0209971_1040499 | Ga0209971_10404992 | 288 |
| 542 | 3300027695 | Ga0209966_1005660 | Ga0209966_10056602 | 288 |
| 543 | 3300027907 | Ga0207428_10070921 | Ga0207428_100709212 | 288 |
| 544 | 3300031548 | Ga0307408_100003640 | Ga0307408_1000036406 | 288 |
| 545 | 3300031731 | Ga0307405_10003582 | Ga0307405_100035823 | 288 |
| 546 | 3300031824 | Ga0307413_10012513 | Ga0307413_100125134 | 288 |
| 547 | 3300031852 | Ga0307410_10000615 | Ga0307410_1000061511 | 288 |
| 548 | 3300031901 | Ga0307406_10002939 | Ga0307406_100029395 | 288 |
| 549 | 3300031903 | Ga0307407_10000267 | Ga0307407_100002675 | 288 |
| 550 | 3300031911 | Ga0307412_10007003 | Ga0307412_100070032 | 288 |
| 551 | 3300031995 | Ga0307409_100005162 | Ga0307409_1000051623 | 288 |
| 552 | 3300032002 | Ga0307416_100008868 | Ga0307416_1000088684 | 288 |
| 553 | 3300032005 | Ga0307411_10022388 | Ga0307411_100223882 | 288 |
| 554 | 3300032126 | Ga0307415_100000721 | Ga0307415_10000072113 | 288 |
| 555 | 3300035117 | Ga0373953_0012794 | Ga0373953_0012794_2067_2936 | 288 |
| 556 | 3300035118 | Ga0373954_0000002 | Ga0373954_0000002_63607_64476 | 288 |
| 557 | 3300035691 | Ga0373931_0066765 | Ga0373931_0066765_669_1541 | 288 |
| 558 | 3300035724 | Ga0373933_0000657 | Ga0373933_0000657_18658_19527 | 288 |
| 559 | 3300036401 | Ga0373937_0000358 | Ga0373937_0000358_26161_27030 | 288 |
| 560 | 3300041410 | Ga0439461_0002213 | Ga0439461_0002213_2119_2988 | 288 |
| 561 | 3300041486 | Ga0451807_1806802 | Ga0451807_1806802_588_1463 | 288 |
| 562 | 3300041997 | Ga0439431_0034581 | Ga0439431_0034581_180_1049 | 288 |
| 563 | 3300042001 | Ga0439441_000163 | Ga0439441_000163_3122_3994 | 288 |
| 564 | 3300042001 | Ga0439441_003222 | Ga0439441_003222_628_1494 | 288 |
| 565 | 3300042156 | Ga0439446_0000176 | Ga0439446_0000176_5513_6382 | 288 |
| 566 | 3300042435 | Ga0439434_0001633 | Ga0439434_0001633_3769_4638 | 288 |
| 567 | 3300042436 | Ga0439435_0000026 | Ga0439435_0000026_481_1350 | 288 |
| 568 | 3300042436 | Ga0439435_0013765 | Ga0439435_0013765_925_1797 | 288 |
| 569 | 3300042876 | Ga0451577_0452460 | Ga0451577_0452460_100_966 | 288 |
| 570 | 3300045051 | Ga0451576_0034631 | Ga0451576_0034631_2535_3401 | 288 |
| 571 | 3300046454 | Ga0495592_0003821 | Ga0495592_0003821_6520_7389 | 288 |
| 572 | 3300046476 | Ga0495662_0008976 | Ga0495662_0008976_1013_1903 | 288 |
| 573 | 3300046476 | Ga0495662_0027173 | Ga0495662_0027173_24_893 | 288 |
| 574 | 3300046511 | Ga0495608_0002044 | Ga0495608_0002044_10022_10891 | 288 |
| 575 | 3300046514 | Ga0495618_0022560 | Ga0495618_0022560_1500_2369 | 288 |
| 576 | 3300046516 | Ga0495628_0016487 | Ga0495628_0016487_354_1223 | 288 |
| 577 | 3300046517 | Ga0495630_0001185 | Ga0495630_0001185_9161_10030 | 288 |
| 578 | 3300046517 | Ga0495630_0039270 | Ga0495630_0039270_2295_3185 | 288 |
| 579 | 3300046529 | Ga0495652_0033401 | Ga0495652_0033401_2494_3363 | 288 |
| 580 | 3300046533 | Ga0495640_0000808 | Ga0495640_0000808_14453_15322 | 288 |
| 581 | 3300046533 | Ga0495640_0004665 | Ga0495640_0004665_7817_8707 | 288 |
| 582 | 3300046535 | Ga0495586_0000440 | Ga0495586_0000440_13220_14089 | 288 |
| 583 | 3300046559 | Ga0495667_0001153 | Ga0495667_0001153_2002_2871 | 288 |
| 584 | 3300046642 | Ga0495634_0002587 | Ga0495634_0002587_9828_10697 | 288 |
| 585 | 3300046689 | Ga0495613_0025295 | Ga0495613_0025295_2404_3273 | 288 |
| 586 | 3300046690 | Ga0495624_0034028 | Ga0495624_0034028_1314_2204 | 288 |
| 587 | 3300047317 | Ga0495604_0103336 | Ga0495604_0103336_1063_1953 | 288 |
| 588 | 3300047319 | Ga0495674_0123030 | Ga0495674_0123030_306_1196 | 288 |
| 589 | 3300047322 | Ga0495680_0001572 | Ga0495680_0001572_12775_13644 | 288 |
| 590 | 3300047471 | Ga0495684_0018458 | Ga0495684_0018458_3159_4028 | 288 |
| 591 | 3300049576 | Ga0501040_0018725 | Ga0501040_0018725_1376_2245 | 288 |
| 592 | 3300049576 | Ga0501040_0072432 | Ga0501040_0072432_760_1632 | 288 |
| 593 | 3300049582 | Ga0501048_0252032 | Ga0501048_0252032_279_1148 | 288 |
| 594 | 3300049584 | Ga0501068_0212842 | Ga0501068_0212842_30_911 | 288 |
| 595 | 3300049590 | Ga0501074_0299992 | Ga0501074_0299992_109_978 | 288 |
| 596 | 3300049741 | Ga0501079_0028118 | Ga0501079_0028118_3014_3883 | 288 |
| 597 | 3300050507 | nmdc:mga05p37_209_c1 | nmdc:mga05p37_209_c1_45279_46145 | 288 |
| 598 | 3300050508 | nmdc:mga09592_150_c1 | nmdc:mga09592_150_c1_46200_47066 | 288 |
| 599 | 3300050509 | nmdc:mga0qj67_20035_c1 | nmdc:mga0qj67_20035_c1_19_900 | 288 |
| 600 | 3300050509 | nmdc:mga0qj67_623_c1 | nmdc:mga0qj67_623_c1_12005_12886 | 288 |
| 601 | 3300050510 | nmdc:mga06r32_113730_c1 | nmdc:mga06r32_113730_c1_1035_1901 | 288 |
| 602 | 3300050510 | nmdc:mga06r32_187461_c1 | nmdc:mga06r32_187461_c1_677_1573 | 288 |
| 603 | 3300050511 | nmdc:mga08y16_30907_c1 | nmdc:mga08y16_30907_c1_2440_3306 | 288 |
| 604 | 3300053077 | Ga0495601_0005497 | Ga0495601_0005497_3139_4008 | 288 |
| 605 | 3300053077 | Ga0495601_0083732 | Ga0495601_0083732_35_925 | 288 |
| 606 | 3300053094 | Ga0500566_0122685 | Ga0500566_0122685_384_1253 | 288 |
| 607 | 3300059426 | Ga0590077_004080 | Ga0590077_004080_566_1456 | 288 |
| 608 | 3300061734 | Ga0530510_0284777 | Ga0530510_0284777_91_960 | 288 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1g2w-assembly1.cif.gz_B | e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase | 0.9647 | 2 | 273 |
| 4daa-assembly1.cif.gz_A | crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form | 0.9637 | 2 | 273 |
| 2dab-assembly1.cif.gz_A | l201a mutant of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate | 0.9637 | 2 | 273 |
| 5daa-assembly1.cif.gz_B | e177k mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate | 0.9626 | 2 | 273 |
| 4tm5-assembly1.cif.gz_A-2 | x-ray crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 bound to the co-factor pyridoxal phosphate | 0.9572 | 2 | 277 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lqsA02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.974 | 120 | 273 | 3.20.10.10 |
| 4pbcB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9701 | 147 | 281 | 3.20.10.10 |
| 4m0jB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9614 | 117 | 277 | 3.20.10.10 |
| 4m0jB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9426 | 117 | 277 | 3.20.10.10 |
| 1a0gA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9409 | 2 | 115 | 3.30.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C6XB07-F1-model_v4 | Aminotransferase class IV | 0.9834 | 2 | 281 |
GO:0005829
GO:0008483 GO:0046394 |
| AF-A0A6L5JYQ8-F1-model_v4 | D-amino acid aminotransferase | 0.9816 | 2 | 281 |
GO:0005829
GO:0008483 GO:0046394 |
| AF-A0A839A0U5-F1-model_v4 | deleted | 0.9811 | 2 | 283 |
|
| AF-A0A4Y1Z9P1-F1-model_v4 | D-alanine aminotransferase (EC 2.6.1.21) | 0.9799 | 132 | 279 |
GO:0005829
GO:0046394 GO:0047810 |
| AF-A0A1E4PQV2-F1-model_v4 | deleted | 0.9788 | 40 | 280 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar