F468748

General Info

Members Datasets Scaffolds Average Seq Length
607 274 1214 289

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0002050|Ga0500616_0002050_8972_9952
Length 326
Sequence MMLNGQTAQSISNGVKCSELNGRQVSKGLLDKIATQSAELAARGWPPRLVSISIGDQAPTELYVRNQKRAAERVGIAFHELRFPANVSFGGLHAVIQTLNADPRVSGIVLQRPVPRQLSIRAVQTAIDPLKDVEGMHPVSIGDIMYGGSNLAPCTALAAVELLRETGLNFQGLEVTVIGHSEIVGKPVAFLMMAEGATVTVCHHMTRSVATHSRYADAVIIAVGKPQLLTGNMIKPGAAIIDIGINQIEVDGQVRVVGDADTQSCAQVAGWITPVPGGVGPVTVAMLMRNVITAVRQQMEQKGKQLDSSSHSATPSVHRAGEGVKQ

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
177 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
272 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
273 2808606372 Agromyces sp. 23-23 Isolate Unclassified
274 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0
Rhizoplane 4.45
Rhizosphere 93.25
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0002050 3300053153 Bacteria 17716
2 JGI25406J46586_10005910 3300003203 Bacteria 5662
3 Ga0065704_10077288 3300005289 Bacteria 4783
4 Ga0065707_10001323 3300005295 Bacteria 7202
5 Ga0065707_10082329 3300005295 Bacteria 16782
6 Ga0070658_10143876 3300005327 Bacteria 1993
7 Ga0070683_100067258 3300005329 Bacteria 3337
8 Ga0070690_100010525 3300005330 Bacteria 5386
9 Ga0070690_100027966 3300005330 Bacteria 3489
10 Ga0070690_100080589 3300005330 Bacteria 2129
11 Ga0070670_100038240 3300005331 Bacteria 4126
12 Ga0070670_100064326 3300005331 Bacteria 3147
13 Ga0070670_100293703 3300005331 Bacteria 1421
14 Ga0070677_10012315 3300005333 Bacteria 2969
15 Ga0068869_100082154 3300005334 Bacteria 2408
16 Ga0068869_100136872 3300005334 Bacteria 1888
17 Ga0070666_10003408 3300005335 Bacteria 9629
18 Ga0070666_10045949 3300005335 Bacteria 2928
19 Ga0070666_10300217 3300005335 Bacteria 1143
20 Ga0070680_100043563 3300005336 Bacteria 3646
21 Ga0070680_100085513 3300005336 Bacteria 2606
22 Ga0070680_100263379 3300005336 Bacteria 1459
23 Ga0068868_100035762 3300005338 Bacteria 3841
24 Ga0068868_100106313 3300005338 Bacteria 2276
25 Ga0070660_100037276 3300005339 Bacteria 3686
26 Ga0070660_100230452 3300005339 Bacteria 1507
27 Ga0070689_100012543 3300005340 Bacteria 6109
28 Ga0070689_100108208 3300005340 Bacteria 2208
29 Ga0070661_100002259 3300005344 Bacteria 13203
30 Ga0070668_100002402 3300005347 Bacteria 13778
31 Ga0070668_100012971 3300005347 Bacteria 6205
32 Ga0070668_100091241 3300005347 Bacteria 2401
33 Ga0070668_100315624 3300005347 Bacteria 1314
34 Ga0070675_100194156 3300005354 Bacteria 1760
35 Ga0070675_100216041 3300005354 Bacteria 1668
36 Ga0070671_100012985 3300005355 Bacteria 6711
37 Ga0070671_100050486 3300005355 Bacteria 3460
38 Ga0070674_100000959 3300005356 Bacteria 15042
39 Ga0070674_100021346 3300005356 Bacteria 4154
40 Ga0070674_100076928 3300005356 Bacteria 2374
41 Ga0070673_100000167 3300005364 Bacteria 31804
42 Ga0070673_100022602 3300005364 Bacteria 4581
43 Ga0070688_100001497 3300005365 Bacteria 11642
44 Ga0070688_100001532 3300005365 Bacteria 11550
45 Ga0070688_100116965 3300005365 Bacteria 1780
46 Ga0070659_100184176 3300005366 Bacteria 1714
47 Ga0070667_100230062 3300005367 Bacteria 1653
48 Ga0070713_100000757 3300005436 Bacteria 20671
49 Ga0070713_100122518 3300005436 Bacteria 2282
50 Ga0070710_10007504 3300005437 Bacteria 5283
51 Ga0070711_100000353 3300005439 Bacteria 23775
52 Ga0070711_100017769 3300005439 Bacteria 4531
53 Ga0070705_100027808 3300005440 Bacteria 3091
54 Ga0070700_100026331 3300005441 Bacteria 3434
55 Ga0070694_100024514 3300005444 Bacteria 3893
56 Ga0070708_100006294 3300005445 Bacteria 9446
57 Ga0070708_100011356 3300005445 Bacteria 7244
58 Ga0070708_100497850 3300005445 Bacteria 1149
59 Ga0070663_100150347 3300005455 Bacteria 1785
60 Ga0070663_100329306 3300005455 Bacteria 1230
61 Ga0070678_100000671 3300005456 Bacteria 16812
62 Ga0070678_100001165 3300005456 Bacteria 13936
63 Ga0070678_100074651 3300005456 Bacteria 2549
64 Ga0070678_100080212 3300005456 Bacteria 2471
65 Ga0070678_100281568 3300005456 Bacteria 1406
66 Ga0070662_100041634 3300005457 Bacteria 3278
67 Ga0070681_10004889 3300005458 Bacteria 12854
68 Ga0070681_10071708 3300005458 Bacteria 3429
69 Ga0070681_10159706 3300005458 Bacteria 2178
70 Ga0068867_100000611 3300005459 Bacteria 23660
71 Ga0068867_100017674 3300005459 Bacteria 5062
72 Ga0068867_100094969 3300005459 Bacteria 2268
73 Ga0070685_10020561 3300005466 Bacteria 3573
74 Ga0070706_100000046 3300005467 Bacteria 143869
75 Ga0070706_100055344 3300005467 Bacteria 3662
76 Ga0070706_100399993 3300005467 Bacteria 1279
77 Ga0070707_100032309 3300005468 Bacteria 4986
78 Ga0070707_100091384 3300005468 Bacteria 2947
79 Ga0070707_100293051 3300005468 Bacteria 1581
80 Ga0070698_100104300 3300005471 Unclassified 2805
81 Ga0070698_100159183 3300005471 Bacteria 2203
82 Ga0070698_100168235 3300005471 Bacteria 2133
83 Ga0070699_100005218 3300005518 Bacteria 11418
84 Ga0070699_100015114 3300005518 Bacteria 6632
85 Ga0070699_100028329 3300005518 Bacteria 4830
86 Ga0070679_100018321 3300005530 Bacteria 6793
87 Ga0070679_100058947 3300005530 Bacteria 3826
88 Ga0070679_100131587 3300005530 Bacteria 2483
89 Ga0070679_100164105 3300005530 Bacteria 2195
90 Ga0070679_100353629 3300005530 Bacteria 1417
91 Ga0070679_100697271 3300005530 Bacteria 958
92 Ga0070684_100065590 3300005535 Bacteria 3187
93 Ga0070684_100370574 3300005535 Bacteria 1318
94 Ga0068853_100500150 3300005539 Bacteria 1147
95 Ga0070672_100001991 3300005543 Bacteria 12816
96 Ga0070672_100013607 3300005543 Bacteria 5752
97 Ga0070686_100063612 3300005544 Bacteria 2391
98 Ga0070696_100013374 3300005546 Bacteria 5505
99 Ga0070693_100000828 3300005547 Bacteria 13726
100 Ga0070693_100009141 3300005547 Bacteria 4921
101 Ga0070693_100131618 3300005547 Bacteria 1564
102 Ga0070665_100003546 3300005548 Bacteria 16568
103 Ga0070665_100005025 3300005548 Bacteria 13723
104 Ga0070665_100028922 3300005548 Bacteria 5579
105 Ga0070665_100172793 3300005548 Bacteria 2162
106 Ga0070704_100107771 3300005549 Bacteria 2114
107 Ga0068855_100192894 3300005563 Bacteria 2297
108 Ga0068855_100270680 3300005563 Bacteria 1889
109 Ga0068855_100369651 3300005563 Bacteria 1577
110 Ga0070664_100032907 3300005564 Bacteria 4338
111 Ga0070664_100098490 3300005564 Bacteria 2540
112 Ga0068857_100325840 3300005577 Bacteria 1419
113 Ga0068857_100445238 3300005577 Bacteria 1210
114 Ga0068854_100002997 3300005578 Bacteria 10480
115 Ga0068854_100020107 3300005578 Bacteria 4510
116 Ga0068854_100028145 3300005578 Bacteria 3880
117 Ga0068856_100001739 3300005614 Bacteria 22768
118 Ga0068856_100180834 3300005614 Bacteria 2122
119 Ga0070702_100041788 3300005615 Bacteria 2574
120 Ga0068852_100001036 3300005616 Bacteria 18277
121 Ga0068852_100062058 3300005616 Bacteria 3249
122 Ga0068852_100505028 3300005616 Bacteria 1204
123 Ga0068859_100003087 3300005617 Bacteria 16901
124 Ga0068859_100003577 3300005617 Bacteria 15829
125 Ga0068859_100154929 3300005617 Bacteria 2368
126 Ga0068859_100233477 3300005617 Bacteria 1928
127 Ga0068859_100409611 3300005617 Bacteria 1452
128 Ga0068864_100000942 3300005618 Bacteria 24336
129 Ga0068864_100025733 3300005618 Bacteria 4959
130 Ga0068864_100026814 3300005618 Bacteria 4860
131 Ga0068864_100043358 3300005618 Bacteria 3852
132 Ga0068864_100160391 3300005618 Bacteria 2044
133 Ga0068864_100287748 3300005618 Bacteria 1535
134 Ga0068864_100466494 3300005618 Bacteria 1210
135 Ga0068866_10003303 3300005718 Bacteria 6625
136 Ga0068866_10004677 3300005718 Bacteria 5617
137 Ga0068861_100137484 3300005719 Unclassified 1990
138 Ga0068851_10012976 3300005834 Bacteria 3937
139 Ga0068851_10014182 3300005834 Bacteria 3781
140 Ga0068870_10023698 3300005840 Bacteria 3030
141 Ga0068870_10075694 3300005840 Bacteria 1847
142 Ga0068863_100001007 3300005841 Bacteria 28209
143 Ga0068863_100105650 3300005841 Bacteria 2678
144 Ga0068863_100163493 3300005841 Bacteria 2134
145 Ga0068863_100275772 3300005841 Bacteria 1628
146 Ga0068858_100001611 3300005842 Bacteria 23012
147 Ga0068858_100005588 3300005842 Bacteria 12296
148 Ga0068858_100045627 3300005842 Bacteria 4062
149 Ga0068858_100048100 3300005842 Bacteria 3953
150 Ga0068858_100279420 3300005842 Bacteria 1590
151 Ga0068860_100015391 3300005843 Bacteria 7475
152 Ga0068860_100168210 3300005843 Bacteria 2117
153 Ga0068860_100278268 3300005843 Bacteria 1635
154 Ga0068862_100075970 3300005844 Bacteria 2907
155 Ga0068862_100087686 3300005844 Bacteria 2706
156 Ga0081539_10005319 3300005985 Bacteria 13220
157 Ga0070717_10000469 3300006028 Bacteria 25683
158 Ga0070716_100020082 3300006173 Bacteria 3502
159 Ga0070712_100320411 3300006175 Bacteria 1260
160 Ga0075366_10142303 3300006195 Bacteria 1450
161 Ga0097621_100055148 3300006237 Bacteria 3245
162 Ga0097621_100115448 3300006237 Bacteria 2272
163 Ga0097621_100130005 3300006237 Bacteria 2143
164 Ga0097621_100605879 3300006237 Bacteria 1001
165 Ga0068871_100003319 3300006358 Bacteria 11049
166 Ga0068871_100084174 3300006358 Bacteria 2639
167 Ga0068871_100100919 3300006358 Bacteria 2418
168 Ga0068871_100184343 3300006358 Bacteria 1795
169 Ga0075428_100022329 3300006844 Bacteria 7006
170 Ga0075428_100199430 3300006844 Bacteria 2164
171 Ga0075428_100273425 3300006844 Bacteria 1818
172 Ga0075428_100275777 3300006844 Bacteria 1809
173 Ga0075430_100062144 3300006846 Bacteria 3138
174 Ga0075431_100066391 3300006847 Bacteria 3725
175 Ga0075431_100078671 3300006847 Bacteria 3404
176 Ga0075433_10436925 3300006852 Unclassified 1154
177 Ga0075434_100292807 3300006871 Unclassified 1648
178 Ga0075429_100007967 3300006880 Bacteria 9202
179 Ga0075429_100058617 3300006880 Bacteria 3353
180 Ga0075429_100071865 3300006880 Bacteria 3013
181 Ga0075429_100087410 3300006880 Bacteria 2716
182 Ga0075429_100091670 3300006880 Bacteria 2651
183 Ga0068865_100348409 3300006881 Bacteria 1199
184 Ga0097620_100003087 3300006931 Bacteria 16901
185 Ga0097620_100003577 3300006931 Bacteria 15829
186 Ga0097620_100154926 3300006931 Bacteria 2368
187 Ga0097620_100233490 3300006931 Bacteria 1928
188 Ga0097620_100409582 3300006931 Bacteria 1452
189 Ga0075435_100171622 3300007076 Bacteria 1830
190 Ga0105240_10013339 3300009093 Bacteria 11292
191 Ga0105240_10054626 3300009093 Bacteria 5005
192 Ga0105240_10285262 3300009093 Bacteria 1895
193 Ga0111539_10452565 3300009094 Bacteria 1495
194 Ga0105247_10015291 3300009101 Bacteria 4598
195 Ga0114129_10006655 3300009147 Bacteria 16408
196 Ga0114129_10009412 3300009147 Bacteria 13924
197 Ga0114129_10293281 3300009147 Bacteria 2170
198 Ga0114129_10353611 3300009147 Bacteria 1945
199 Ga0114129_10564231 3300009147 Bacteria 1479
200 Ga0105243_10067320 3300009148 Unclassified 2883
201 Ga0105243_10196360 3300009148 Bacteria 1767
202 Ga0105243_10443681 3300009148 Bacteria 1216
203 Ga0105242_10003292 3300009176 Bacteria 12586
204 Ga0105242_10097125 3300009176 Bacteria 2490
205 Ga0105242_10358235 3300009176 Bacteria 1349
206 Ga0105242_10442663 3300009176 Bacteria 1223
207 Ga0105248_10004085 3300009177 Bacteria 16142
208 Ga0105248_10012962 3300009177 Bacteria 9190
209 Ga0105248_10260526 3300009177 Bacteria 1952
210 Ga0105248_10374178 3300009177 Bacteria 1604
211 Ga0105248_10455607 3300009177 Bacteria 1442
212 Ga0105238_10264914 3300009551 Bacteria 1698
213 Ga0105238_10362673 3300009551 Bacteria 1439
214 Ga0105238_10364453 3300009551 Bacteria 1435
215 Ga0105238_10464169 3300009551 Bacteria 1264
216 Ga0105249_10046546 3300009553 Bacteria 3947
217 Ga0105249_10120807 3300009553 Bacteria 2489
218 Ga0105249_10197158 3300009553 Bacteria 1968
219 Ga0105246_10054278 3300011119 Bacteria 2761
220 Ga0105246_10145416 3300011119 Bacteria 1788
221 Ga0157373_10095238 3300013100 Bacteria 2096
222 Ga0157371_10036827 3300013102 Bacteria 3503
223 Ga0157370_10003726 3300013104 Bacteria 17814
224 Ga0157370_10055916 3300013104 Bacteria 3757
225 Ga0157370_10139480 3300013104 Bacteria 2259
226 Ga0157369_10000578 3300013105 Bacteria 47949
227 Ga0157369_10025661 3300013105 Bacteria 6540
228 Ga0157369_10239552 3300013105 Bacteria 1895
229 Ga0157369_10779792 3300013105 Bacteria 983
230 Ga0157374_10001764 3300013296 Bacteria 18201
231 Ga0157374_10005173 3300013296 Bacteria 10940
232 Ga0157378_10015183 3300013297 Bacteria 6743
233 Ga0157378_10041811 3300013297 Bacteria 4067
234 Ga0157378_10068601 3300013297 Bacteria 3180
235 Ga0157378_10264727 3300013297 Bacteria 1651
236 Ga0157378_10466249 3300013297 Bacteria 1256
237 Ga0163162_10050751 3300013306 Bacteria 4160
238 Ga0157372_10004165 3300013307 Bacteria 15480
239 Ga0157372_10068759 3300013307 Bacteria 3982
240 Ga0157372_10101521 3300013307 Bacteria 3284
241 Ga0157372_10125701 3300013307 Bacteria 2948
242 Ga0157372_10318414 3300013307 Bacteria 1811
243 Ga0157372_10589622 3300013307 Bacteria 1296
244 Ga0157375_10017775 3300013308 Bacteria 6429
245 Ga0157375_10065495 3300013308 Bacteria 3622
246 Ga0157375_10075067 3300013308 Bacteria 3404
247 Ga0157375_10119337 3300013308 Bacteria 2745
248 Ga0157375_10313887 3300013308 Bacteria 1732
249 Ga0157375_10706520 3300013308 Bacteria 1162
250 Ga0157375_10756313 3300013308 Bacteria 1123
251 Ga0163163_10000609 3300014325 Bacteria 31134
252 Ga0163163_10033032 3300014325 Bacteria 5002
253 Ga0157380_10055602 3300014326 Bacteria 3144
254 Ga0157379_10003475 3300014968 Bacteria 13334
255 Ga0157379_10005793 3300014968 Bacteria 10633
256 Ga0157379_10089270 3300014968 Bacteria 2765
257 Ga0157379_10167191 3300014968 Bacteria 1985
258 Ga0157379_10454668 3300014968 Bacteria 1183
259 Ga0157376_10123778 3300014969 Bacteria 2296
260 Ga0163161_10026766 3300017792 Bacteria 4087
261 Ga0163161_10133583 3300017792 Bacteria 1874
262 Ga0163161_10203357 3300017792 Bacteria 1527
263 Ga0213876_10001349 3300021384 Bacteria 15356
264 Ga0209148_1001879 3300025254 Bacteria 8687
265 Ga0209676_1022679 3300025292 Bacteria 2073
266 Ga0207697_10002913 3300025315 Bacteria 8656
267 Ga0207697_10008144 3300025315 Bacteria 4614
268 Ga0207697_10030927 3300025315 Bacteria 2190
269 Ga0207656_10003450 3300025321 Bacteria 5432
270 Ga0207656_10008385 3300025321 Bacteria 3801
271 Ga0207656_10107752 3300025321 Bacteria 1284
272 Ga0207682_10000342 3300025893 Bacteria 21268
273 Ga0207692_10191864 3300025898 Bacteria 1196
274 Ga0207642_10001795 3300025899 Bacteria 6644
275 Ga0207688_10002202 3300025901 Bacteria 10507
276 Ga0207680_10002144 3300025903 Bacteria 9250
277 Ga0207680_10006688 3300025903 Bacteria 5593
278 Ga0207680_10012372 3300025903 Bacteria 4343
279 Ga0207680_10031674 3300025903 Bacteria 2997
280 Ga0207699_10086108 3300025906 Bacteria 1962
281 Ga0207645_10000187 3300025907 Bacteria 49829
282 Ga0207645_10000549 3300025907 Bacteria 31247
283 Ga0207645_10031547 3300025907 Bacteria 3409
284 Ga0207643_10004724 3300025908 Bacteria 7306
285 Ga0207643_10015392 3300025908 Bacteria 4164
286 Ga0207643_10039255 3300025908 Bacteria 2663
287 Ga0207684_10000046 3300025910 Bacteria 251569
288 Ga0207684_10035624 3300025910 Bacteria 4225
289 Ga0207684_10202661 3300025910 Bacteria 1712
290 Ga0207654_10054899 3300025911 Bacteria 2304
291 Ga0207654_10078809 3300025911 Bacteria 1978
292 Ga0207707_10068022 3300025912 Bacteria 3103
293 Ga0207707_10141227 3300025912 Bacteria 2106
294 Ga0207707_10160865 3300025912 Bacteria 1963
295 Ga0207695_10028175 3300025913 Bacteria 6236
296 Ga0207695_10041225 3300025913 Bacteria 4942
297 Ga0207695_10143040 3300025913 Bacteria 2338
298 Ga0207695_10200419 3300025913 Bacteria 1910
299 Ga0207695_10303108 3300025913 Bacteria 1489
300 Ga0207695_10309902 3300025913 Bacteria 1469
301 Ga0207693_10000760 3300025915 Bacteria 28971
302 Ga0207663_10012541 3300025916 Bacteria 4585
303 Ga0207663_10100456 3300025916 Bacteria 1942
304 Ga0207660_10132135 3300025917 Bacteria 1901
305 Ga0207657_10002028 3300025919 Bacteria 21896
306 Ga0207657_10008214 3300025919 Bacteria 10628
307 Ga0207657_10157980 3300025919 Bacteria 1843
308 Ga0207657_10360881 3300025919 Bacteria 1145
309 Ga0207649_10033213 3300025920 Bacteria 3081
310 Ga0207649_10186856 3300025920 Bacteria 1454
311 Ga0207649_10200846 3300025920 Bacteria 1408
312 Ga0207652_10163231 3300025921 Bacteria 1997
313 Ga0207652_10644714 3300025921 Bacteria 947
314 Ga0207646_10065247 3300025922 Bacteria 3250
315 Ga0207646_10085930 3300025922 Bacteria 2814
316 Ga0207646_10313843 3300025922 Bacteria 1416
317 Ga0207681_10002729 3300025923 Bacteria 11176
318 Ga0207681_10100711 3300025923 Bacteria 2083
319 Ga0207694_10239996 3300025924 Bacteria 1481
320 Ga0207694_10314006 3300025924 Bacteria 1292
321 Ga0207694_10414342 3300025924 Bacteria 1122
322 Ga0207650_10046131 3300025925 Bacteria 3208
323 Ga0207659_10011526 3300025926 Bacteria 5586
324 Ga0207659_10019966 3300025926 Bacteria 4422
325 Ga0207659_10041311 3300025926 Bacteria 3229
326 Ga0207659_10162854 3300025926 Bacteria 1753
327 Ga0207687_10000552 3300025927 Bacteria 25163
328 Ga0207700_10003286 3300025928 Bacteria 9358
329 Ga0207664_10012811 3300025929 Bacteria 6006
330 Ga0207664_10089478 3300025929 Bacteria 2521
331 Ga0207644_10002572 3300025931 Bacteria 11670
332 Ga0207644_10011528 3300025931 Bacteria 5853
333 Ga0207644_10055232 3300025931 Bacteria 2862
334 Ga0207644_10203718 3300025931 Bacteria 1561
335 Ga0207644_10219135 3300025931 Bacteria 1507
336 Ga0207690_10070710 3300025932 Bacteria 2405
337 Ga0207706_10008022 3300025933 Bacteria 9743
338 Ga0207706_10044781 3300025933 Bacteria 3921
339 Ga0207686_10000568 3300025934 Bacteria 23395
340 Ga0207686_10006045 3300025934 Bacteria 6499
341 Ga0207686_10404223 3300025934 Bacteria 1041
342 Ga0207686_10437894 3300025934 Bacteria 1003
343 Ga0207709_10059332 3300025935 Bacteria 2381
344 Ga0207709_10140346 3300025935 Unclassified 1660
345 Ga0207709_10214438 3300025935 Unclassified 1384
346 Ga0207709_10303396 3300025935 Bacteria 1188
347 Ga0207670_10015582 3300025936 Bacteria 4546
348 Ga0207670_10022253 3300025936 Bacteria 3926
349 Ga0207669_10002058 3300025937 Bacteria 8517
350 Ga0207669_10006406 3300025937 Bacteria 5378
351 Ga0207669_10007399 3300025937 Bacteria 5075
352 Ga0207669_10007629 3300025937 Bacteria 5022
353 Ga0207669_10033896 3300025937 Bacteria 2888
354 Ga0207704_10170553 3300025938 Bacteria 1560
355 Ga0207704_10316097 3300025938 Bacteria 1203
356 Ga0207665_10020775 3300025939 Bacteria 4317
357 Ga0207691_10000024 3300025940 Bacteria 132111
358 Ga0207691_10000105 3300025940 Bacteria 74790
359 Ga0207691_10002234 3300025940 Bacteria 18960
360 Ga0207691_10043516 3300025940 Bacteria 4138
361 Ga0207691_10482366 3300025940 Bacteria 1054
362 Ga0207711_10005936 3300025941 Bacteria 10322
363 Ga0207711_10013155 3300025941 Bacteria 6872
364 Ga0207711_10175447 3300025941 Bacteria 1947
365 Ga0207711_10202087 3300025941 Bacteria 1813
366 Ga0207689_10007082 3300025942 Bacteria 9858
367 Ga0207689_10007473 3300025942 Bacteria 9580
368 Ga0207689_10015724 3300025942 Bacteria 6407
369 Ga0207689_10074319 3300025942 Bacteria 2793
370 Ga0207661_10028013 3300025944 Bacteria 4311
371 Ga0207679_10055414 3300025945 Bacteria 2922
372 Ga0207679_10107569 3300025945 Bacteria 2195
373 Ga0207667_10022230 3300025949 Bacteria 7011
374 Ga0207667_10092517 3300025949 Bacteria 3123
375 Ga0207651_10000505 3300025960 Bacteria 16387
376 Ga0207651_10045979 3300025960 Bacteria 2931
377 Ga0207651_10048403 3300025960 Bacteria 2874
378 Ga0207651_10133731 3300025960 Bacteria 1903
379 Ga0207651_10143361 3300025960 Bacteria 1848
380 Ga0207651_10441171 3300025960 Bacteria 1115
381 Ga0207668_10002236 3300025972 Bacteria 11295
382 Ga0207668_10020298 3300025972 Bacteria 4219
383 Ga0207668_10032496 3300025972 Bacteria 3448
384 Ga0207668_10058257 3300025972 Bacteria 2699
385 Ga0207668_10085209 3300025972 Bacteria 2305
386 Ga0207668_10086424 3300025972 Bacteria 2291
387 Ga0207668_10293349 3300025972 Bacteria 1339
388 Ga0207640_10028061 3300025981 Bacteria 3436
389 Ga0207640_10071415 3300025981 Bacteria 2338
390 Ga0207640_10106430 3300025981 Bacteria 1978
391 Ga0207640_10347448 3300025981 Bacteria 1191
392 Ga0207658_10005413 3300025986 Bacteria 8752
393 Ga0207658_10027931 3300025986 Bacteria 3969
394 Ga0207677_10000920 3300026023 Bacteria 16454
395 Ga0207677_10004579 3300026023 Bacteria 7434
396 Ga0207677_10007574 3300026023 Bacteria 6024
397 Ga0207677_10080634 3300026023 Bacteria 2332
398 Ga0207703_10001926 3300026035 Bacteria 18380
399 Ga0207703_10002556 3300026035 Bacteria 15720
400 Ga0207703_10009771 3300026035 Bacteria 7526
401 Ga0207703_10014385 3300026035 Bacteria 6170
402 Ga0207703_10081992 3300026035 Bacteria 2690
403 Ga0207703_10384404 3300026035 Bacteria 1299
404 Ga0207639_10026241 3300026041 Bacteria 4233
405 Ga0207639_10141215 3300026041 Bacteria 2007
406 Ga0207639_10148096 3300026041 Bacteria 1963
407 Ga0207678_10025042 3300026067 Bacteria 5211
408 Ga0207678_10153240 3300026067 Bacteria 1968
409 Ga0207678_10234788 3300026067 Bacteria 1570
410 Ga0207678_10478517 3300026067 Bacteria 1084
411 Ga0207708_10004184 3300026075 Bacteria 10608
412 Ga0207708_10093488 3300026075 Bacteria 2321
413 Ga0207641_10007772 3300026088 Bacteria 8909
414 Ga0207641_10062753 3300026088 Bacteria 3172
415 Ga0207641_10264552 3300026088 Bacteria 1611
416 Ga0207648_10000320 3300026089 Bacteria 52595
417 Ga0207648_10010022 3300026089 Bacteria 9012
418 Ga0207648_10012459 3300026089 Bacteria 7961
419 Ga0207648_10015079 3300026089 Bacteria 7115
420 Ga0207648_10025301 3300026089 Bacteria 5289
421 Ga0207648_10028092 3300026089 Bacteria 4990
422 Ga0207676_10000754 3300026095 Bacteria 25321
423 Ga0207676_10031856 3300026095 Bacteria 3967
424 Ga0207676_10039647 3300026095 Bacteria 3604
425 Ga0207676_10134037 3300026095 Bacteria 2111
426 Ga0207676_10156012 3300026095 Bacteria 1972
427 Ga0207676_10306685 3300026095 Bacteria 1451
428 Ga0207676_10370760 3300026095 Bacteria 1330
429 Ga0207674_10003123 3300026116 Bacteria 20429
430 Ga0207674_10244772 3300026116 Bacteria 1740
431 Ga0207675_100006614 3300026118 Bacteria 10962
432 Ga0207675_100032054 3300026118 Bacteria 4895
433 Ga0207675_100093928 3300026118 Bacteria 2822
434 Ga0207675_100100197 3300026118 Bacteria 2729
435 Ga0207675_100159728 3300026118 Bacteria 2149
436 Ga0207675_100403195 3300026118 Bacteria 1348
437 Ga0207683_10000012 3300026121 Bacteria 134768
438 Ga0207683_10001281 3300026121 Bacteria 22746
439 Ga0207683_10001576 3300026121 Bacteria 20549
440 Ga0207683_10041635 3300026121 Bacteria 4012
441 Ga0207698_10005981 3300026142 Bacteria 7561
442 Ga0207698_10275101 3300026142 Bacteria 1554
443 Ga0207698_10301584 3300026142 Bacteria 1491
444 Ga0207698_10459332 3300026142 Bacteria 1231
445 Ga0209969_1007955 3300027360 Bacteria 1500
446 Ga0209984_1012581 3300027424 Bacteria 1104
447 Ga0268266_10011709 3300028379 Bacteria 7610
448 Ga0268266_10034576 3300028379 Bacteria 4298
449 Ga0268266_10041587 3300028379 Bacteria 3922
450 Ga0268266_10049955 3300028379 Bacteria 3587
451 Ga0268266_10191869 3300028379 Bacteria 1866
452 Ga0268265_10048346 3300028380 Bacteria 3193
453 Ga0268265_10111544 3300028380 Bacteria 2234
454 Ga0268265_10117057 3300028380 Bacteria 2188
455 Ga0268265_10204959 3300028380 Bacteria 1714
456 Ga0268265_10210970 3300028380 Bacteria 1692
457 Ga0268265_10301291 3300028380 Bacteria 1443
458 Ga0268264_10002657 3300028381 Bacteria 15612
459 Ga0268264_10008245 3300028381 Bacteria 8652
460 Ga0268264_10011215 3300028381 Bacteria 7404
461 Ga0268264_10062008 3300028381 Bacteria 3138
462 Ga0268264_10066944 3300028381 Bacteria 3030
463 Ga0265330_10001597 3300031235 Bacteria 13009
464 Ga0265328_10000313 3300031239 Bacteria 22524
465 Ga0265329_10046044 3300031242 Bacteria 1394
466 Ga0265327_10003670 3300031251 Bacteria 14391
467 Ga0265327_10008917 3300031251 Bacteria 7360
468 Ga0265316_10123694 3300031344 Bacteria 1952
469 Ga0265342_10013796 3300031712 Bacteria 5395
470 Ga0316576_10147714 3300031727 Bacteria 1771
471 Ga0316578_10088068 3300031728 Bacteria 1852
472 Ga0307405_10032935 3300031731 Bacteria 3069
473 Ga0307413_10067554 3300031824 Bacteria 2236
474 Ga0307413_10282519 3300031824 Bacteria 1249
475 Ga0307410_10140506 3300031852 Bacteria 1786
476 Ga0307410_10241371 3300031852 Bacteria 1400
477 Ga0307407_10228751 3300031903 Bacteria 1262
478 Ga0307412_10009677 3300031911 Bacteria 5535
479 Ga0307409_100044174 3300031995 Bacteria 3354
480 Ga0307414_10317398 3300032004 Bacteria 1325
481 Ga0373934_0036472 3300035086 Bacteria 1937
482 Ga0373923_0012768 3300035111 Bacteria 3116
483 Ga0373945_0012712 3300035116 Bacteria 2800
484 Ga0373945_0162873 3300035116 Bacteria 910
485 Ga0373953_0002967 3300035117 Bacteria 5186
486 Ga0373954_0003328 3300035118 Bacteria 6797
487 Ga0373956_0003461 3300035119 Bacteria 6350
488 Ga0373956_0112092 3300035119 Bacteria 1270
489 Ga0373943_0050543 3300035170 Bacteria 2043
490 Ga0373943_0090491 3300035170 Bacteria 1584
491 Ga0373955_0014644 3300035172 Bacteria 3820
492 Ga0373961_0084142 3300035241 Bacteria 1005
493 Ga0316574_0015484 3300035398 Bacteria 4426
494 Ga0373931_0236274 3300035691 Bacteria 1106
495 Ga0373935_0004177 3300035692 Bacteria 8457
496 Ga0373927_0013802 3300035695 Bacteria 5362
497 Ga0373927_0059390 3300035695 Bacteria 2473
498 Ga0373927_0068550 3300035695 Bacteria 2295
499 Ga0373947_0013887 3300035725 Bacteria 4617
500 Ga0373947_0064620 3300035725 Bacteria 2231
501 Ga0373947_0224388 3300035725 Bacteria 1236
502 Ga0373937_0006837 3300036401 Bacteria 9841
503 Ga0373937_0413704 3300036401 Bacteria 1279
504 Ga0316584_0137254 3300036712 Bacteria 1825
505 Ga0436364_1134497 3300037853 Bacteria 4454
506 Ga0436364_1252050 3300037853 Bacteria 9639
507 Ga0400483_083361 3300039062 Bacteria 3746
508 Ga0436365_0296507 3300039437 Bacteria 3427
509 Ga0436365_1020685 3300039437 Bacteria 27637
510 Ga0439460_0014756 3300042461 Bacteria 2057
511 Ga0451577_0386632 3300042876 Bacteria 1270
512 Ga0453683_0009751 3300044673 Bacteria 6402
513 Ga0453683_0030673 3300044673 Unclassified 3398
514 Ga0453683_0039079 3300044673 Bacteria 2983
515 Ga0466963_0207681 3300044694 Bacteria 1370
516 Ga0466964_0148263 3300044706 Bacteria 1085
517 Ga0453684_0005425 3300044712 Bacteria 25259
518 Ga0453684_0068752 3300044712 Bacteria 4496
519 Ga0453684_0205920 3300044712 Bacteria 2290
520 Ga0453684_0390307 3300044712 Bacteria 1561
521 Ga0466957_0122291 3300044842 Bacteria 1660
522 Ga0451576_0000106 3300045051 Bacteria 213255
523 Ga0451576_0000347 3300045051 Bacteria 111807
524 Ga0451576_0034791 3300045051 Bacteria 5349
525 Ga0451576_0081307 3300045051 Bacteria 3369
526 Ga0451576_0240971 3300045051 Bacteria 1889
527 Ga0466967_0013998 3300045976 Bacteria 6227
528 Ga0466967_0702016 3300045976 Bacteria 1002
529 Ga0495629_0047244 3300046459 Bacteria 3019
530 Ga0495651_0107067 3300046462 Bacteria 2072
531 Ga0495653_0077238 3300046463 Bacteria 2473
532 Ga0495580_0037221 3300046472 Bacteria 3493
533 Ga0495582_0077982 3300046473 Bacteria 1837
534 Ga0495639_0097438 3300046475 Bacteria 1386
535 Ga0495662_0089191 3300046476 Bacteria 1502
536 Ga0495664_0007370 3300046477 Bacteria 6110
537 Ga0495594_0013125 3300046499 Bacteria 4320
538 Ga0495642_0064954 3300046528 Bacteria 1519
539 Ga0495652_0386495 3300046529 Bacteria 994
540 Ga0495665_0063728 3300046531 Bacteria 1945
541 Ga0495587_0019544 3300046536 Bacteria 4191
542 Ga0495645_0011397 3300046543 Bacteria 6255
543 Ga0495645_0041118 3300046543 Bacteria 3371
544 Ga0495634_0193774 3300046642 Bacteria 1266
545 Ga0495635_0017219 3300046663 Bacteria 5047
546 Ga0495635_0307674 3300046663 Bacteria 1062
547 Ga0495623_0035003 3300046679 Bacteria 3219
548 Ga0495647_0046527 3300046681 Bacteria 1671
549 Ga0495658_0020282 3300046683 Bacteria 3485
550 Ga0495613_0060716 3300046689 Bacteria 2768
551 Ga0495600_0068483 3300046809 Bacteria 2319
552 Ga0495581_0006293 3300047315 Bacteria 6883
553 Ga0495604_0106331 3300047317 Bacteria 2053
554 Ga0495674_0383854 3300047319 Bacteria 1136
555 Ga0495684_0009674 3300047471 Bacteria 7433
556 Ga0495684_0058637 3300047471 Bacteria 2932
557 Ga0495593_0052176 3300047673 Bacteria 2162
558 Ga0495602_0203830 3300048088 Bacteria 1507
559 Ga0496100_0079422 3300048903 Bacteria 2211
560 Ga0496100_0130717 3300048903 Bacteria 1768
561 Ga0496100_0489535 3300048903 Bacteria 947
562 Ga0496101_0038252 3300048904 Bacteria 3407
563 Ga0496101_0082377 3300048904 Bacteria 2381
564 Ga0496101_0230037 3300048904 Bacteria 1441
565 Ga0496101_0522202 3300048904 Bacteria 938
566 Ga0496104_0012926 3300048907 Bacteria 7517
567 Ga0496104_0072684 3300048907 Bacteria 3270
568 Ga0496105_0004334 3300048908 Bacteria 10691
569 Ga0496106_0012007 3300048909 Bacteria 6392
570 Ga0496106_0089816 3300048909 Bacteria 2370
571 Ga0496106_0289478 3300048909 Bacteria 1313
572 Ga0496107_0080885 3300048910 Bacteria 2370
573 Ga0496107_0082421 3300048910 Bacteria 2346
574 Ga0496107_0085943 3300048910 Bacteria 2295
575 Ga0496108_0003376 3300048911 Bacteria 12818
576 Ga0496108_0427242 3300048911 Bacteria 1157
577 Ga0496109_0006131 3300048912 Bacteria 10102
578 Ga0496109_0174139 3300048912 Bacteria 2020
579 Ga0496109_0217103 3300048912 Bacteria 1798
580 Ga0496110_0014042 3300048913 Bacteria 6638
581 Ga0496111_0018599 3300048914 Bacteria 4815
582 Ga0496112_0000236 3300048915 Bacteria 35432
583 Ga0496114_0182628 3300048917 Bacteria 1832
584 Ga0496114_0201685 3300048917 Bacteria 1742
585 Ga0496115_0165450 3300048918 Bacteria 1829
586 Ga0501039_0135401 3300049575 Bacteria 1934
587 Ga0501072_0376779 3300049588 Bacteria 1126
588 Ga0501080_0471089 3300049742 Bacteria 1124
589 nmdc:mga0k408_50276_c1 3300050493 Bacteria 2413
590 nmdc:mga05p37_150412_c1 3300050507 Unclassified 2848
591 nmdc:mga05p37_3339_c1 3300050507 Bacteria 16107
592 nmdc:mga05p37_396699_c1 3300050507 Bacteria 1612
593 nmdc:mga05p37_40774_c1 3300050507 Bacteria 5701
594 nmdc:mga05p37_5115_c1 3300050507 Bacteria 15379
595 nmdc:mga09592_46553_c1 3300050508 Bacteria 3654
596 nmdc:mga0qj67_298000_c1 3300050509 Bacteria 1306
597 nmdc:mga0qj67_40481_c1 3300050509 Bacteria 3662
598 nmdc:mga06r32_86863_c1 3300050510 Bacteria 3051
599 nmdc:mga08y16_239952_c1 3300050511 Bacteria 1874
600 nmdc:mga0n895_652243_c1 3300050512 Unclassified 1051
601 nmdc:mga0a205_284661_c1 3300050515 Unclassified 1528
602 Ga0495601_0247972 3300053077 Bacteria 1163
603 Ga0500622_0000029 3300053156 Bacteria 213762
604 Ga0530510_0074372 3300061734 Bacteria 2467
605 2644181891 2643221632 Bacteria 3406696
606 2808899338 2808606372 Bacteria 4649509
607 2898796480 2898795034 Bacteria 4294459
608 Ga0500616_0002050
609 JGI25406J46586_10005910
610 Ga0065704_10077288
611 Ga0065707_10001323
612 Ga0065707_10082329
613 Ga0070658_10143876
614 Ga0070683_100067258
615 Ga0070690_100010525
616 Ga0070690_100027966
617 Ga0070690_100080589
618 Ga0070670_100038240
619 Ga0070670_100064326
620 Ga0070670_100293703
621 Ga0070677_10012315
622 Ga0068869_100082154
623 Ga0068869_100136872
624 Ga0070666_10003408
625 Ga0070666_10045949
626 Ga0070666_10300217
627 Ga0070680_100043563
628 Ga0070680_100085513
629 Ga0070680_100263379
630 Ga0068868_100035762
631 Ga0068868_100106313
632 Ga0070660_100037276
633 Ga0070660_100230452
634 Ga0070689_100012543
635 Ga0070689_100108208
636 Ga0070661_100002259
637 Ga0070668_100002402
638 Ga0070668_100012971
639 Ga0070668_100091241
640 Ga0070668_100315624
641 Ga0070675_100194156
642 Ga0070675_100216041
643 Ga0070671_100012985
644 Ga0070671_100050486
645 Ga0070674_100000959
646 Ga0070674_100021346
647 Ga0070674_100076928
648 Ga0070673_100000167
649 Ga0070673_100022602
650 Ga0070688_100001497
651 Ga0070688_100001532
652 Ga0070688_100116965
653 Ga0070659_100184176
654 Ga0070667_100230062
655 Ga0070713_100000757
656 Ga0070713_100122518
657 Ga0070710_10007504
658 Ga0070711_100000353
659 Ga0070711_100017769
660 Ga0070705_100027808
661 Ga0070700_100026331
662 Ga0070694_100024514
663 Ga0070708_100006294
664 Ga0070708_100011356
665 Ga0070708_100497850
666 Ga0070663_100150347
667 Ga0070663_100329306
668 Ga0070678_100000671
669 Ga0070678_100001165
670 Ga0070678_100074651
671 Ga0070678_100080212
672 Ga0070678_100281568
673 Ga0070662_100041634
674 Ga0070681_10004889
675 Ga0070681_10071708
676 Ga0070681_10159706
677 Ga0068867_100000611
678 Ga0068867_100017674
679 Ga0068867_100094969
680 Ga0070685_10020561
681 Ga0070706_100000046
682 Ga0070706_100055344
683 Ga0070706_100399993
684 Ga0070707_100032309
685 Ga0070707_100091384
686 Ga0070707_100293051
687 Ga0070698_100104300
688 Ga0070698_100159183
689 Ga0070698_100168235
690 Ga0070699_100005218
691 Ga0070699_100015114
692 Ga0070699_100028329
693 Ga0070679_100018321
694 Ga0070679_100058947
695 Ga0070679_100131587
696 Ga0070679_100164105
697 Ga0070679_100353629
698 Ga0070679_100697271
699 Ga0070684_100065590
700 Ga0070684_100370574
701 Ga0068853_100500150
702 Ga0070672_100001991
703 Ga0070672_100013607
704 Ga0070686_100063612
705 Ga0070696_100013374
706 Ga0070693_100000828
707 Ga0070693_100009141
708 Ga0070693_100131618
709 Ga0070665_100003546
710 Ga0070665_100005025
711 Ga0070665_100028922
712 Ga0070665_100172793
713 Ga0070704_100107771
714 Ga0068855_100192894
715 Ga0068855_100270680
716 Ga0068855_100369651
717 Ga0070664_100032907
718 Ga0070664_100098490
719 Ga0068857_100325840
720 Ga0068857_100445238
721 Ga0068854_100002997
722 Ga0068854_100020107
723 Ga0068854_100028145
724 Ga0068856_100001739
725 Ga0068856_100180834
726 Ga0070702_100041788
727 Ga0068852_100001036
728 Ga0068852_100062058
729 Ga0068852_100505028
730 Ga0068859_100003087
731 Ga0068859_100003577
732 Ga0068859_100154929
733 Ga0068859_100233477
734 Ga0068859_100409611
735 Ga0068864_100000942
736 Ga0068864_100025733
737 Ga0068864_100026814
738 Ga0068864_100043358
739 Ga0068864_100160391
740 Ga0068864_100287748
741 Ga0068864_100466494
742 Ga0068866_10003303
743 Ga0068866_10004677
744 Ga0068861_100137484
745 Ga0068851_10012976
746 Ga0068851_10014182
747 Ga0068870_10023698
748 Ga0068870_10075694
749 Ga0068863_100001007
750 Ga0068863_100105650
751 Ga0068863_100163493
752 Ga0068863_100275772
753 Ga0068858_100001611
754 Ga0068858_100005588
755 Ga0068858_100045627
756 Ga0068858_100048100
757 Ga0068858_100279420
758 Ga0068860_100015391
759 Ga0068860_100168210
760 Ga0068860_100278268
761 Ga0068862_100075970
762 Ga0068862_100087686
763 Ga0081539_10005319
764 Ga0070717_10000469
765 Ga0070716_100020082
766 Ga0070712_100320411
767 Ga0075366_10142303
768 Ga0097621_100055148
769 Ga0097621_100115448
770 Ga0097621_100130005
771 Ga0097621_100605879
772 Ga0068871_100003319
773 Ga0068871_100084174
774 Ga0068871_100100919
775 Ga0068871_100184343
776 Ga0075428_100022329
777 Ga0075428_100199430
778 Ga0075428_100273425
779 Ga0075428_100275777
780 Ga0075430_100062144
781 Ga0075431_100066391
782 Ga0075431_100078671
783 Ga0075433_10436925
784 Ga0075434_100292807
785 Ga0075429_100007967
786 Ga0075429_100058617
787 Ga0075429_100071865
788 Ga0075429_100087410
789 Ga0075429_100091670
790 Ga0068865_100348409
791 Ga0097620_100003087
792 Ga0097620_100003577
793 Ga0097620_100154926
794 Ga0097620_100233490
795 Ga0097620_100409582
796 Ga0075435_100171622
797 Ga0105240_10013339
798 Ga0105240_10054626
799 Ga0105240_10285262
800 Ga0111539_10452565
801 Ga0105247_10015291
802 Ga0114129_10006655
803 Ga0114129_10009412
804 Ga0114129_10293281
805 Ga0114129_10353611
806 Ga0114129_10564231
807 Ga0105243_10067320
808 Ga0105243_10196360
809 Ga0105243_10443681
810 Ga0105242_10003292
811 Ga0105242_10097125
812 Ga0105242_10358235
813 Ga0105242_10442663
814 Ga0105248_10004085
815 Ga0105248_10012962
816 Ga0105248_10260526
817 Ga0105248_10374178
818 Ga0105248_10455607
819 Ga0105238_10264914
820 Ga0105238_10362673
821 Ga0105238_10364453
822 Ga0105238_10464169
823 Ga0105249_10046546
824 Ga0105249_10120807
825 Ga0105249_10197158
826 Ga0105246_10054278
827 Ga0105246_10145416
828 Ga0157373_10095238
829 Ga0157371_10036827
830 Ga0157370_10003726
831 Ga0157370_10055916
832 Ga0157370_10139480
833 Ga0157369_10000578
834 Ga0157369_10025661
835 Ga0157369_10239552
836 Ga0157369_10779792
837 Ga0157374_10001764
838 Ga0157374_10005173
839 Ga0157378_10015183
840 Ga0157378_10041811
841 Ga0157378_10068601
842 Ga0157378_10264727
843 Ga0157378_10466249
844 Ga0163162_10050751
845 Ga0157372_10004165
846 Ga0157372_10068759
847 Ga0157372_10101521
848 Ga0157372_10125701
849 Ga0157372_10318414
850 Ga0157372_10589622
851 Ga0157375_10017775
852 Ga0157375_10065495
853 Ga0157375_10075067
854 Ga0157375_10119337
855 Ga0157375_10313887
856 Ga0157375_10706520
857 Ga0157375_10756313
858 Ga0163163_10000609
859 Ga0163163_10033032
860 Ga0157380_10055602
861 Ga0157379_10003475
862 Ga0157379_10005793
863 Ga0157379_10089270
864 Ga0157379_10167191
865 Ga0157379_10454668
866 Ga0157376_10123778
867 Ga0163161_10026766
868 Ga0163161_10133583
869 Ga0163161_10203357
870 Ga0213876_10001349
871 Ga0209148_1001879
872 Ga0209676_1022679
873 Ga0207697_10002913
874 Ga0207697_10008144
875 Ga0207697_10030927
876 Ga0207656_10003450
877 Ga0207656_10008385
878 Ga0207656_10107752
879 Ga0207682_10000342
880 Ga0207692_10191864
881 Ga0207642_10001795
882 Ga0207688_10002202
883 Ga0207680_10002144
884 Ga0207680_10006688
885 Ga0207680_10012372
886 Ga0207680_10031674
887 Ga0207699_10086108
888 Ga0207645_10000187
889 Ga0207645_10000549
890 Ga0207645_10031547
891 Ga0207643_10004724
892 Ga0207643_10015392
893 Ga0207643_10039255
894 Ga0207684_10000046
895 Ga0207684_10035624
896 Ga0207684_10202661
897 Ga0207654_10054899
898 Ga0207654_10078809
899 Ga0207707_10068022
900 Ga0207707_10141227
901 Ga0207707_10160865
902 Ga0207695_10028175
903 Ga0207695_10041225
904 Ga0207695_10143040
905 Ga0207695_10200419
906 Ga0207695_10303108
907 Ga0207695_10309902
908 Ga0207693_10000760
909 Ga0207663_10012541
910 Ga0207663_10100456
911 Ga0207660_10132135
912 Ga0207657_10002028
913 Ga0207657_10008214
914 Ga0207657_10157980
915 Ga0207657_10360881
916 Ga0207649_10033213
917 Ga0207649_10186856
918 Ga0207649_10200846
919 Ga0207652_10163231
920 Ga0207652_10644714
921 Ga0207646_10065247
922 Ga0207646_10085930
923 Ga0207646_10313843
924 Ga0207681_10002729
925 Ga0207681_10100711
926 Ga0207694_10239996
927 Ga0207694_10314006
928 Ga0207694_10414342
929 Ga0207650_10046131
930 Ga0207659_10011526
931 Ga0207659_10019966
932 Ga0207659_10041311
933 Ga0207659_10162854
934 Ga0207687_10000552
935 Ga0207700_10003286
936 Ga0207664_10012811
937 Ga0207664_10089478
938 Ga0207644_10002572
939 Ga0207644_10011528
940 Ga0207644_10055232
941 Ga0207644_10203718
942 Ga0207644_10219135
943 Ga0207690_10070710
944 Ga0207706_10008022
945 Ga0207706_10044781
946 Ga0207686_10000568
947 Ga0207686_10006045
948 Ga0207686_10404223
949 Ga0207686_10437894
950 Ga0207709_10059332
951 Ga0207709_10140346
952 Ga0207709_10214438
953 Ga0207709_10303396
954 Ga0207670_10015582
955 Ga0207670_10022253
956 Ga0207669_10002058
957 Ga0207669_10006406
958 Ga0207669_10007399
959 Ga0207669_10007629
960 Ga0207669_10033896
961 Ga0207704_10170553
962 Ga0207704_10316097
963 Ga0207665_10020775
964 Ga0207691_10000024
965 Ga0207691_10000105
966 Ga0207691_10002234
967 Ga0207691_10043516
968 Ga0207691_10482366
969 Ga0207711_10005936
970 Ga0207711_10013155
971 Ga0207711_10175447
972 Ga0207711_10202087
973 Ga0207689_10007082
974 Ga0207689_10007473
975 Ga0207689_10015724
976 Ga0207689_10074319
977 Ga0207661_10028013
978 Ga0207679_10055414
979 Ga0207679_10107569
980 Ga0207667_10022230
981 Ga0207667_10092517
982 Ga0207651_10000505
983 Ga0207651_10045979
984 Ga0207651_10048403
985 Ga0207651_10133731
986 Ga0207651_10143361
987 Ga0207651_10441171
988 Ga0207668_10002236
989 Ga0207668_10020298
990 Ga0207668_10032496
991 Ga0207668_10058257
992 Ga0207668_10085209
993 Ga0207668_10086424
994 Ga0207668_10293349
995 Ga0207640_10028061
996 Ga0207640_10071415
997 Ga0207640_10106430
998 Ga0207640_10347448
999 Ga0207658_10005413
1000 Ga0207658_10027931
1001 Ga0207677_10000920
1002 Ga0207677_10004579
1003 Ga0207677_10007574
1004 Ga0207677_10080634
1005 Ga0207703_10001926
1006 Ga0207703_10002556
1007 Ga0207703_10009771
1008 Ga0207703_10014385
1009 Ga0207703_10081992
1010 Ga0207703_10384404
1011 Ga0207639_10026241
1012 Ga0207639_10141215
1013 Ga0207639_10148096
1014 Ga0207678_10025042
1015 Ga0207678_10153240
1016 Ga0207678_10234788
1017 Ga0207678_10478517
1018 Ga0207708_10004184
1019 Ga0207708_10093488
1020 Ga0207641_10007772
1021 Ga0207641_10062753
1022 Ga0207641_10264552
1023 Ga0207648_10000320
1024 Ga0207648_10010022
1025 Ga0207648_10012459
1026 Ga0207648_10015079
1027 Ga0207648_10025301
1028 Ga0207648_10028092
1029 Ga0207676_10000754
1030 Ga0207676_10031856
1031 Ga0207676_10039647
1032 Ga0207676_10134037
1033 Ga0207676_10156012
1034 Ga0207676_10306685
1035 Ga0207676_10370760
1036 Ga0207674_10003123
1037 Ga0207674_10244772
1038 Ga0207675_100006614
1039 Ga0207675_100032054
1040 Ga0207675_100093928
1041 Ga0207675_100100197
1042 Ga0207675_100159728
1043 Ga0207675_100403195
1044 Ga0207683_10000012
1045 Ga0207683_10001281
1046 Ga0207683_10001576
1047 Ga0207683_10041635
1048 Ga0207698_10005981
1049 Ga0207698_10275101
1050 Ga0207698_10301584
1051 Ga0207698_10459332
1052 Ga0209969_1007955
1053 Ga0209984_1012581
1054 Ga0268266_10011709
1055 Ga0268266_10034576
1056 Ga0268266_10041587
1057 Ga0268266_10049955
1058 Ga0268266_10191869
1059 Ga0268265_10048346
1060 Ga0268265_10111544
1061 Ga0268265_10117057
1062 Ga0268265_10204959
1063 Ga0268265_10210970
1064 Ga0268265_10301291
1065 Ga0268264_10002657
1066 Ga0268264_10008245
1067 Ga0268264_10011215
1068 Ga0268264_10062008
1069 Ga0268264_10066944
1070 Ga0265330_10001597
1071 Ga0265328_10000313
1072 Ga0265329_10046044
1073 Ga0265327_10003670
1074 Ga0265327_10008917
1075 Ga0265316_10123694
1076 Ga0265342_10013796
1077 Ga0316576_10147714
1078 Ga0316578_10088068
1079 Ga0307405_10032935
1080 Ga0307413_10067554
1081 Ga0307413_10282519
1082 Ga0307410_10140506
1083 Ga0307410_10241371
1084 Ga0307407_10228751
1085 Ga0307412_10009677
1086 Ga0307409_100044174
1087 Ga0307414_10317398
1088 Ga0373934_0036472
1089 Ga0373923_0012768
1090 Ga0373945_0012712
1091 Ga0373945_0162873
1092 Ga0373953_0002967
1093 Ga0373954_0003328
1094 Ga0373956_0003461
1095 Ga0373956_0112092
1096 Ga0373943_0050543
1097 Ga0373943_0090491
1098 Ga0373955_0014644
1099 Ga0373961_0084142
1100 Ga0316574_0015484
1101 Ga0373931_0236274
1102 Ga0373935_0004177
1103 Ga0373927_0013802
1104 Ga0373927_0059390
1105 Ga0373927_0068550
1106 Ga0373947_0013887
1107 Ga0373947_0064620
1108 Ga0373947_0224388
1109 Ga0373937_0006837
1110 Ga0373937_0413704
1111 Ga0316584_0137254
1112 Ga0436364_1134497
1113 Ga0436364_1252050
1114 Ga0400483_083361
1115 Ga0436365_0296507
1116 Ga0436365_1020685
1117 Ga0439460_0014756
1118 Ga0451577_0386632
1119 Ga0453683_0009751
1120 Ga0453683_0030673
1121 Ga0453683_0039079
1122 Ga0466963_0207681
1123 Ga0466964_0148263
1124 Ga0453684_0005425
1125 Ga0453684_0068752
1126 Ga0453684_0205920
1127 Ga0453684_0390307
1128 Ga0466957_0122291
1129 Ga0451576_0000106
1130 Ga0451576_0000347
1131 Ga0451576_0034791
1132 Ga0451576_0081307
1133 Ga0451576_0240971
1134 Ga0466967_0013998
1135 Ga0466967_0702016
1136 Ga0495629_0047244
1137 Ga0495651_0107067
1138 Ga0495653_0077238
1139 Ga0495580_0037221
1140 Ga0495582_0077982
1141 Ga0495639_0097438
1142 Ga0495662_0089191
1143 Ga0495664_0007370
1144 Ga0495594_0013125
1145 Ga0495642_0064954
1146 Ga0495652_0386495
1147 Ga0495665_0063728
1148 Ga0495587_0019544
1149 Ga0495645_0011397
1150 Ga0495645_0041118
1151 Ga0495634_0193774
1152 Ga0495635_0017219
1153 Ga0495635_0307674
1154 Ga0495623_0035003
1155 Ga0495647_0046527
1156 Ga0495658_0020282
1157 Ga0495613_0060716
1158 Ga0495600_0068483
1159 Ga0495581_0006293
1160 Ga0495604_0106331
1161 Ga0495674_0383854
1162 Ga0495684_0009674
1163 Ga0495684_0058637
1164 Ga0495593_0052176
1165 Ga0495602_0203830
1166 Ga0496100_0079422
1167 Ga0496100_0130717
1168 Ga0496100_0489535
1169 Ga0496101_0038252
1170 Ga0496101_0082377
1171 Ga0496101_0230037
1172 Ga0496101_0522202
1173 Ga0496104_0012926
1174 Ga0496104_0072684
1175 Ga0496105_0004334
1176 Ga0496106_0012007
1177 Ga0496106_0089816
1178 Ga0496106_0289478
1179 Ga0496107_0080885
1180 Ga0496107_0082421
1181 Ga0496107_0085943
1182 Ga0496108_0003376
1183 Ga0496108_0427242
1184 Ga0496109_0006131
1185 Ga0496109_0174139
1186 Ga0496109_0217103
1187 Ga0496110_0014042
1188 Ga0496111_0018599
1189 Ga0496112_0000236
1190 Ga0496114_0182628
1191 Ga0496114_0201685
1192 Ga0496115_0165450
1193 Ga0501039_0135401
1194 Ga0501072_0376779
1195 Ga0501080_0471089
1196 nmdc:mga0k408_50276_c1
1197 nmdc:mga05p37_150412_c1
1198 nmdc:mga05p37_3339_c1
1199 nmdc:mga05p37_396699_c1
1200 nmdc:mga05p37_40774_c1
1201 nmdc:mga05p37_5115_c1
1202 nmdc:mga09592_46553_c1
1203 nmdc:mga0qj67_298000_c1
1204 nmdc:mga0qj67_40481_c1
1205 nmdc:mga06r32_86863_c1
1206 nmdc:mga08y16_239952_c1
1207 nmdc:mga0n895_652243_c1
1208 nmdc:mga0a205_284661_c1
1209 Ga0495601_0247972
1210 Ga0500622_0000029
1211 Ga0530510_0074372
1212 2644181891
1213 2808899338
1214 2898796480

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

20

134

0.99

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

137

299

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v6y-assembly1.cif.gz_A-2 crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) 0.967 3 289
6v6y-assembly1.cif.gz_A-2 crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) 0.9567 3 289
3ngl-assembly1.cif.gz_C crystal structure of bifunctional 5,10-methylenetetrahydrofolate dehydrogenase / cyclohydrolase from thermoplasma acidophilum 0.9561 5 291
4a5o-assembly2.cif.gz_D crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) 0.9558 4 287
6de8-assembly1.cif.gz_A crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni 0.9528 4 289
ID Description Score Start End Superfamily
af_Q54VK0_115_197_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9927 33 114 3.40.50.10860
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9927 33 115 3.40.50.10860
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9807 34 114 3.40.50.10860
af_A0A0R0F3H3_60_174_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.97 14 125 3.40.50.10860
af_P9WG81_7_102_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9695 8 103 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A842P7U8-F1-model_v4 Bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase (EC 1.5.1.5, EC 3.5.4.9) 0.9963 8 107 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-A0A399ZQZ2-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9886 3 299 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A0G1Y7C9-F1-model_v4 Bifunctional protein FolD 0.987 8 103 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A496S4Q7-F1-model_v4 Bifunctional 5,10-methylenetetrahydrofolate dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase 0.9846 3 179 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A660WK15-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9812 5 111 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999

Map